data_7YSI # _entry.id 7YSI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7YSI pdb_00007ysi 10.2210/pdb7ysi/pdb WWPDB D_1300031556 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-03-15 2 'Structure model' 1 1 2023-11-29 3 'Structure model' 1 2 2024-10-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' 3 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model 4 3 'Structure model' pdbx_entry_details 5 3 'Structure model' pdbx_modification_feature # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 3 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7YSI _pdbx_database_status.recvd_initial_deposition_date 2022-08-12 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email xrayleox@cau.ac.kr _pdbx_contact_author.name_first 'Hyun ho' _pdbx_contact_author.name_last Park _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-9928-0847 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Chang, Y.J.' 1 ? 'Park, H.H.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Iucrj _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2052-2525 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 10 _citation.language ? _citation.page_first 147 _citation.page_last 155 _citation.title 'Comparison of the structure and activity of thioredoxin 2 and thioredoxin 1 from Acinetobacter baumannii.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1107/S2052252523000404 _citation.pdbx_database_id_PubMed 36752373 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Chang, Y.J.' 1 ? primary 'Sung, J.H.' 2 0000-0002-5971-6666 primary 'Lee, C.S.' 3 ? primary 'Lee, J.H.' 4 0000-0002-4831-2228 primary 'Park, H.H.' 5 0000-0001-9928-0847 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Thiol disulfide reductase thioredoxin' 16736.248 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? 3 water nat water 18.015 217 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Thioredoxin,Thioredoxin 2,Thioredoxin TrxC' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMMIIVCASCDAKNRVPEEKLTAQPSCGQCHQPLLPLEPIELNEQNFSNYITNSDLPILIDLWAEWCGPCKMMAPHFA QVAKQNPRVIFAKINTEESPRLSQAFNVRSIPTLVLMNKTTEVARMSGALRAPELQQWLDQQLQTNFGS ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMMIIVCASCDAKNRVPEEKLTAQPSCGQCHQPLLPLEPIELNEQNFSNYITNSDLPILIDLWAEWCGPCKMMAPHFA QVAKQNPRVIFAKINTEESPRLSQAFNVRSIPTLVLMNKTTEVARMSGALRAPELQQWLDQQLQTNFGS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 MET n 1 6 ILE n 1 7 ILE n 1 8 VAL n 1 9 CYS n 1 10 ALA n 1 11 SER n 1 12 CYS n 1 13 ASP n 1 14 ALA n 1 15 LYS n 1 16 ASN n 1 17 ARG n 1 18 VAL n 1 19 PRO n 1 20 GLU n 1 21 GLU n 1 22 LYS n 1 23 LEU n 1 24 THR n 1 25 ALA n 1 26 GLN n 1 27 PRO n 1 28 SER n 1 29 CYS n 1 30 GLY n 1 31 GLN n 1 32 CYS n 1 33 HIS n 1 34 GLN n 1 35 PRO n 1 36 LEU n 1 37 LEU n 1 38 PRO n 1 39 LEU n 1 40 GLU n 1 41 PRO n 1 42 ILE n 1 43 GLU n 1 44 LEU n 1 45 ASN n 1 46 GLU n 1 47 GLN n 1 48 ASN n 1 49 PHE n 1 50 SER n 1 51 ASN n 1 52 TYR n 1 53 ILE n 1 54 THR n 1 55 ASN n 1 56 SER n 1 57 ASP n 1 58 LEU n 1 59 PRO n 1 60 ILE n 1 61 LEU n 1 62 ILE n 1 63 ASP n 1 64 LEU n 1 65 TRP n 1 66 ALA n 1 67 GLU n 1 68 TRP n 1 69 CYS n 1 70 GLY n 1 71 PRO n 1 72 CYS n 1 73 LYS n 1 74 MET n 1 75 MET n 1 76 ALA n 1 77 PRO n 1 78 HIS n 1 79 PHE n 1 80 ALA n 1 81 GLN n 1 82 VAL n 1 83 ALA n 1 84 LYS n 1 85 GLN n 1 86 ASN n 1 87 PRO n 1 88 ARG n 1 89 VAL n 1 90 ILE n 1 91 PHE n 1 92 ALA n 1 93 LYS n 1 94 ILE n 1 95 ASN n 1 96 THR n 1 97 GLU n 1 98 GLU n 1 99 SER n 1 100 PRO n 1 101 ARG n 1 102 LEU n 1 103 SER n 1 104 GLN n 1 105 ALA n 1 106 PHE n 1 107 ASN n 1 108 VAL n 1 109 ARG n 1 110 SER n 1 111 ILE n 1 112 PRO n 1 113 THR n 1 114 LEU n 1 115 VAL n 1 116 LEU n 1 117 MET n 1 118 ASN n 1 119 LYS n 1 120 THR n 1 121 THR n 1 122 GLU n 1 123 VAL n 1 124 ALA n 1 125 ARG n 1 126 MET n 1 127 SER n 1 128 GLY n 1 129 ALA n 1 130 LEU n 1 131 ARG n 1 132 ALA n 1 133 PRO n 1 134 GLU n 1 135 LEU n 1 136 GLN n 1 137 GLN n 1 138 TRP n 1 139 LEU n 1 140 ASP n 1 141 GLN n 1 142 GLN n 1 143 LEU n 1 144 GLN n 1 145 THR n 1 146 ASN n 1 147 PHE n 1 148 GLY n 1 149 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 149 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ;trxC, AYR68_15440, B7L45_02985, BAA1790NC_0521, BS065_02615, CBL15_02595, CTZ19_02595, D8O08_003970, DLI71_14475, DLI72_02635, E2532_03525, E2533_03310, E2534_07555, E2535_02615, E2536_10370, E2538_07040, E2539_06760, E2540_11860, E2541_06480, EA720_013275, FDN00_17805, FE003_02610, IAG11_14015 ; _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Acinetobacter baumannii' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 470 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -3 -3 GLY GLY A . n A 1 2 SER 2 -2 -2 SER SER A . n A 1 3 HIS 3 -1 -1 HIS HIS A . n A 1 4 MET 4 0 0 MET MET A . n A 1 5 MET 5 1 1 MET MET A . n A 1 6 ILE 6 2 2 ILE ILE A . n A 1 7 ILE 7 3 3 ILE ILE A . n A 1 8 VAL 8 4 4 VAL VAL A . n A 1 9 CYS 9 5 5 CYS CYS A . n A 1 10 ALA 10 6 6 ALA ALA A . n A 1 11 SER 11 7 7 SER SER A . n A 1 12 CYS 12 8 8 CYS CYS A . n A 1 13 ASP 13 9 9 ASP ASP A . n A 1 14 ALA 14 10 10 ALA ALA A . n A 1 15 LYS 15 11 11 LYS LYS A . n A 1 16 ASN 16 12 12 ASN ASN A . n A 1 17 ARG 17 13 13 ARG ARG A . n A 1 18 VAL 18 14 14 VAL VAL A . n A 1 19 PRO 19 15 15 PRO PRO A . n A 1 20 GLU 20 16 16 GLU GLU A . n A 1 21 GLU 21 17 17 GLU GLU A . n A 1 22 LYS 22 18 18 LYS LYS A . n A 1 23 LEU 23 19 19 LEU LEU A . n A 1 24 THR 24 20 20 THR THR A . n A 1 25 ALA 25 21 21 ALA ALA A . n A 1 26 GLN 26 22 22 GLN GLN A . n A 1 27 PRO 27 23 23 PRO PRO A . n A 1 28 SER 28 24 24 SER SER A . n A 1 29 CYS 29 25 25 CYS CYS A . n A 1 30 GLY 30 26 26 GLY GLY A . n A 1 31 GLN 31 27 27 GLN GLN A . n A 1 32 CYS 32 28 28 CYS CYS A . n A 1 33 HIS 33 29 29 HIS HIS A . n A 1 34 GLN 34 30 30 GLN GLN A . n A 1 35 PRO 35 31 31 PRO PRO A . n A 1 36 LEU 36 32 32 LEU LEU A . n A 1 37 LEU 37 33 33 LEU LEU A . n A 1 38 PRO 38 34 34 PRO PRO A . n A 1 39 LEU 39 35 35 LEU LEU A . n A 1 40 GLU 40 36 36 GLU GLU A . n A 1 41 PRO 41 37 37 PRO PRO A . n A 1 42 ILE 42 38 38 ILE ILE A . n A 1 43 GLU 43 39 39 GLU GLU A . n A 1 44 LEU 44 40 40 LEU LEU A . n A 1 45 ASN 45 41 41 ASN ASN A . n A 1 46 GLU 46 42 42 GLU GLU A . n A 1 47 GLN 47 43 43 GLN GLN A . n A 1 48 ASN 48 44 44 ASN ASN A . n A 1 49 PHE 49 45 45 PHE PHE A . n A 1 50 SER 50 46 46 SER SER A . n A 1 51 ASN 51 47 47 ASN ASN A . n A 1 52 TYR 52 48 48 TYR TYR A . n A 1 53 ILE 53 49 49 ILE ILE A . n A 1 54 THR 54 50 50 THR THR A . n A 1 55 ASN 55 51 51 ASN ASN A . n A 1 56 SER 56 52 52 SER SER A . n A 1 57 ASP 57 53 53 ASP ASP A . n A 1 58 LEU 58 54 54 LEU LEU A . n A 1 59 PRO 59 55 55 PRO PRO A . n A 1 60 ILE 60 56 56 ILE ILE A . n A 1 61 LEU 61 57 57 LEU LEU A . n A 1 62 ILE 62 58 58 ILE ILE A . n A 1 63 ASP 63 59 59 ASP ASP A . n A 1 64 LEU 64 60 60 LEU LEU A . n A 1 65 TRP 65 61 61 TRP TRP A . n A 1 66 ALA 66 62 62 ALA ALA A . n A 1 67 GLU 67 63 63 GLU GLU A . n A 1 68 TRP 68 64 64 TRP TRP A . n A 1 69 CYS 69 65 65 CYS CYS A . n A 1 70 GLY 70 66 66 GLY GLY A . n A 1 71 PRO 71 67 67 PRO PRO A . n A 1 72 CYS 72 68 68 CYS CYS A . n A 1 73 LYS 73 69 69 LYS LYS A . n A 1 74 MET 74 70 70 MET MET A . n A 1 75 MET 75 71 71 MET MET A . n A 1 76 ALA 76 72 72 ALA ALA A . n A 1 77 PRO 77 73 73 PRO PRO A . n A 1 78 HIS 78 74 74 HIS HIS A . n A 1 79 PHE 79 75 75 PHE PHE A . n A 1 80 ALA 80 76 76 ALA ALA A . n A 1 81 GLN 81 77 77 GLN GLN A . n A 1 82 VAL 82 78 78 VAL VAL A . n A 1 83 ALA 83 79 79 ALA ALA A . n A 1 84 LYS 84 80 80 LYS LYS A . n A 1 85 GLN 85 81 81 GLN GLN A . n A 1 86 ASN 86 82 82 ASN ASN A . n A 1 87 PRO 87 83 83 PRO PRO A . n A 1 88 ARG 88 84 84 ARG ARG A . n A 1 89 VAL 89 85 85 VAL VAL A . n A 1 90 ILE 90 86 86 ILE ILE A . n A 1 91 PHE 91 87 87 PHE PHE A . n A 1 92 ALA 92 88 88 ALA ALA A . n A 1 93 LYS 93 89 89 LYS LYS A . n A 1 94 ILE 94 90 90 ILE ILE A . n A 1 95 ASN 95 91 91 ASN ASN A . n A 1 96 THR 96 92 92 THR THR A . n A 1 97 GLU 97 93 93 GLU GLU A . n A 1 98 GLU 98 94 94 GLU GLU A . n A 1 99 SER 99 95 95 SER SER A . n A 1 100 PRO 100 96 96 PRO PRO A . n A 1 101 ARG 101 97 97 ARG ARG A . n A 1 102 LEU 102 98 98 LEU LEU A . n A 1 103 SER 103 99 99 SER SER A . n A 1 104 GLN 104 100 100 GLN GLN A . n A 1 105 ALA 105 101 101 ALA ALA A . n A 1 106 PHE 106 102 102 PHE PHE A . n A 1 107 ASN 107 103 103 ASN ASN A . n A 1 108 VAL 108 104 104 VAL VAL A . n A 1 109 ARG 109 105 105 ARG ARG A . n A 1 110 SER 110 106 106 SER SER A . n A 1 111 ILE 111 107 107 ILE ILE A . n A 1 112 PRO 112 108 108 PRO PRO A . n A 1 113 THR 113 109 109 THR THR A . n A 1 114 LEU 114 110 110 LEU LEU A . n A 1 115 VAL 115 111 111 VAL VAL A . n A 1 116 LEU 116 112 112 LEU LEU A . n A 1 117 MET 117 113 113 MET MET A . n A 1 118 ASN 118 114 114 ASN ASN A . n A 1 119 LYS 119 115 115 LYS LYS A . n A 1 120 THR 120 116 116 THR THR A . n A 1 121 THR 121 117 117 THR THR A . n A 1 122 GLU 122 118 118 GLU GLU A . n A 1 123 VAL 123 119 119 VAL VAL A . n A 1 124 ALA 124 120 120 ALA ALA A . n A 1 125 ARG 125 121 121 ARG ARG A . n A 1 126 MET 126 122 122 MET MET A . n A 1 127 SER 127 123 123 SER SER A . n A 1 128 GLY 128 124 124 GLY GLY A . n A 1 129 ALA 129 125 125 ALA ALA A . n A 1 130 LEU 130 126 126 LEU LEU A . n A 1 131 ARG 131 127 127 ARG ARG A . n A 1 132 ALA 132 128 128 ALA ALA A . n A 1 133 PRO 133 129 129 PRO PRO A . n A 1 134 GLU 134 130 130 GLU GLU A . n A 1 135 LEU 135 131 131 LEU LEU A . n A 1 136 GLN 136 132 132 GLN GLN A . n A 1 137 GLN 137 133 133 GLN GLN A . n A 1 138 TRP 138 134 134 TRP TRP A . n A 1 139 LEU 139 135 135 LEU LEU A . n A 1 140 ASP 140 136 136 ASP ASP A . n A 1 141 GLN 141 137 137 GLN GLN A . n A 1 142 GLN 142 138 138 GLN GLN A . n A 1 143 LEU 143 139 139 LEU LEU A . n A 1 144 GLN 144 140 ? ? ? A . n A 1 145 THR 145 141 ? ? ? A . n A 1 146 ASN 146 142 ? ? ? A . n A 1 147 PHE 147 143 ? ? ? A . n A 1 148 GLY 148 144 ? ? ? A . n A 1 149 SER 149 145 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id ZN _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id ZN _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 197 ZN ZN A . C 2 ZN 1 202 297 ZN ZN A . D 3 HOH 1 301 196 HOH HOH A . D 3 HOH 2 302 73 HOH HOH A . D 3 HOH 3 303 94 HOH HOH A . D 3 HOH 4 304 57 HOH HOH A . D 3 HOH 5 305 67 HOH HOH A . D 3 HOH 6 306 178 HOH HOH A . D 3 HOH 7 307 140 HOH HOH A . D 3 HOH 8 308 34 HOH HOH A . D 3 HOH 9 309 56 HOH HOH A . D 3 HOH 10 310 147 HOH HOH A . D 3 HOH 11 311 185 HOH HOH A . D 3 HOH 12 312 85 HOH HOH A . D 3 HOH 13 313 174 HOH HOH A . D 3 HOH 14 314 37 HOH HOH A . D 3 HOH 15 315 82 HOH HOH A . D 3 HOH 16 316 118 HOH HOH A . D 3 HOH 17 317 193 HOH HOH A . D 3 HOH 18 318 179 HOH HOH A . D 3 HOH 19 319 60 HOH HOH A . D 3 HOH 20 320 6 HOH HOH A . D 3 HOH 21 321 58 HOH HOH A . D 3 HOH 22 322 12 HOH HOH A . D 3 HOH 23 323 119 HOH HOH A . D 3 HOH 24 324 91 HOH HOH A . D 3 HOH 25 325 95 HOH HOH A . D 3 HOH 26 326 127 HOH HOH A . D 3 HOH 27 327 84 HOH HOH A . D 3 HOH 28 328 41 HOH HOH A . D 3 HOH 29 329 48 HOH HOH A . D 3 HOH 30 330 104 HOH HOH A . D 3 HOH 31 331 106 HOH HOH A . D 3 HOH 32 332 36 HOH HOH A . D 3 HOH 33 333 131 HOH HOH A . D 3 HOH 34 334 1 HOH HOH A . D 3 HOH 35 335 66 HOH HOH A . D 3 HOH 36 336 180 HOH HOH A . D 3 HOH 37 337 3 HOH HOH A . D 3 HOH 38 338 108 HOH HOH A . D 3 HOH 39 339 81 HOH HOH A . D 3 HOH 40 340 44 HOH HOH A . D 3 HOH 41 341 71 HOH HOH A . D 3 HOH 42 342 16 HOH HOH A . D 3 HOH 43 343 45 HOH HOH A . D 3 HOH 44 344 8 HOH HOH A . D 3 HOH 45 345 76 HOH HOH A . D 3 HOH 46 346 168 HOH HOH A . D 3 HOH 47 347 201 HOH HOH A . D 3 HOH 48 348 177 HOH HOH A . D 3 HOH 49 349 152 HOH HOH A . D 3 HOH 50 350 59 HOH HOH A . D 3 HOH 51 351 195 HOH HOH A . D 3 HOH 52 352 160 HOH HOH A . D 3 HOH 53 353 55 HOH HOH A . D 3 HOH 54 354 14 HOH HOH A . D 3 HOH 55 355 205 HOH HOH A . D 3 HOH 56 356 113 HOH HOH A . D 3 HOH 57 357 23 HOH HOH A . D 3 HOH 58 358 65 HOH HOH A . D 3 HOH 59 359 209 HOH HOH A . D 3 HOH 60 360 5 HOH HOH A . D 3 HOH 61 361 21 HOH HOH A . D 3 HOH 62 362 158 HOH HOH A . D 3 HOH 63 363 151 HOH HOH A . D 3 HOH 64 364 103 HOH HOH A . D 3 HOH 65 365 9 HOH HOH A . D 3 HOH 66 366 134 HOH HOH A . D 3 HOH 67 367 4 HOH HOH A . D 3 HOH 68 368 70 HOH HOH A . D 3 HOH 69 369 43 HOH HOH A . D 3 HOH 70 370 159 HOH HOH A . D 3 HOH 71 371 22 HOH HOH A . D 3 HOH 72 372 101 HOH HOH A . D 3 HOH 73 373 28 HOH HOH A . D 3 HOH 74 374 78 HOH HOH A . D 3 HOH 75 375 40 HOH HOH A . D 3 HOH 76 376 2 HOH HOH A . D 3 HOH 77 377 20 HOH HOH A . D 3 HOH 78 378 18 HOH HOH A . D 3 HOH 79 379 31 HOH HOH A . D 3 HOH 80 380 137 HOH HOH A . D 3 HOH 81 381 38 HOH HOH A . D 3 HOH 82 382 190 HOH HOH A . D 3 HOH 83 383 109 HOH HOH A . D 3 HOH 84 384 93 HOH HOH A . D 3 HOH 85 385 161 HOH HOH A . D 3 HOH 86 386 30 HOH HOH A . D 3 HOH 87 387 88 HOH HOH A . D 3 HOH 88 388 19 HOH HOH A . D 3 HOH 89 389 13 HOH HOH A . D 3 HOH 90 390 164 HOH HOH A . D 3 HOH 91 391 80 HOH HOH A . D 3 HOH 92 392 61 HOH HOH A . D 3 HOH 93 393 96 HOH HOH A . D 3 HOH 94 394 50 HOH HOH A . D 3 HOH 95 395 62 HOH HOH A . D 3 HOH 96 396 136 HOH HOH A . D 3 HOH 97 397 146 HOH HOH A . D 3 HOH 98 398 15 HOH HOH A . D 3 HOH 99 399 72 HOH HOH A . D 3 HOH 100 400 156 HOH HOH A . D 3 HOH 101 401 126 HOH HOH A . D 3 HOH 102 402 139 HOH HOH A . D 3 HOH 103 403 10 HOH HOH A . D 3 HOH 104 404 114 HOH HOH A . D 3 HOH 105 405 11 HOH HOH A . D 3 HOH 106 406 102 HOH HOH A . D 3 HOH 107 407 24 HOH HOH A . D 3 HOH 108 408 200 HOH HOH A . D 3 HOH 109 409 52 HOH HOH A . D 3 HOH 110 410 17 HOH HOH A . D 3 HOH 111 411 123 HOH HOH A . D 3 HOH 112 412 111 HOH HOH A . D 3 HOH 113 413 35 HOH HOH A . D 3 HOH 114 414 87 HOH HOH A . D 3 HOH 115 415 97 HOH HOH A . D 3 HOH 116 416 47 HOH HOH A . D 3 HOH 117 417 169 HOH HOH A . D 3 HOH 118 418 99 HOH HOH A . D 3 HOH 119 419 128 HOH HOH A . D 3 HOH 120 420 25 HOH HOH A . D 3 HOH 121 421 153 HOH HOH A . D 3 HOH 122 422 68 HOH HOH A . D 3 HOH 123 423 33 HOH HOH A . D 3 HOH 124 424 181 HOH HOH A . D 3 HOH 125 425 42 HOH HOH A . D 3 HOH 126 426 115 HOH HOH A . D 3 HOH 127 427 49 HOH HOH A . D 3 HOH 128 428 7 HOH HOH A . D 3 HOH 129 429 27 HOH HOH A . D 3 HOH 130 430 64 HOH HOH A . D 3 HOH 131 431 26 HOH HOH A . D 3 HOH 132 432 79 HOH HOH A . D 3 HOH 133 433 63 HOH HOH A . D 3 HOH 134 434 133 HOH HOH A . D 3 HOH 135 435 90 HOH HOH A . D 3 HOH 136 436 215 HOH HOH A . D 3 HOH 137 437 122 HOH HOH A . D 3 HOH 138 438 145 HOH HOH A . D 3 HOH 139 439 212 HOH HOH A . D 3 HOH 140 440 54 HOH HOH A . D 3 HOH 141 441 32 HOH HOH A . D 3 HOH 142 442 173 HOH HOH A . D 3 HOH 143 443 166 HOH HOH A . D 3 HOH 144 444 154 HOH HOH A . D 3 HOH 145 445 214 HOH HOH A . D 3 HOH 146 446 39 HOH HOH A . D 3 HOH 147 447 192 HOH HOH A . D 3 HOH 148 448 216 HOH HOH A . D 3 HOH 149 449 182 HOH HOH A . D 3 HOH 150 450 129 HOH HOH A . D 3 HOH 151 451 176 HOH HOH A . D 3 HOH 152 452 206 HOH HOH A . D 3 HOH 153 453 204 HOH HOH A . D 3 HOH 154 454 163 HOH HOH A . D 3 HOH 155 455 75 HOH HOH A . D 3 HOH 156 456 202 HOH HOH A . D 3 HOH 157 457 208 HOH HOH A . D 3 HOH 158 458 148 HOH HOH A . D 3 HOH 159 459 210 HOH HOH A . D 3 HOH 160 460 89 HOH HOH A . D 3 HOH 161 461 121 HOH HOH A . D 3 HOH 162 462 125 HOH HOH A . D 3 HOH 163 463 149 HOH HOH A . D 3 HOH 164 464 197 HOH HOH A . D 3 HOH 165 465 171 HOH HOH A . D 3 HOH 166 466 130 HOH HOH A . D 3 HOH 167 467 162 HOH HOH A . D 3 HOH 168 468 150 HOH HOH A . D 3 HOH 169 469 194 HOH HOH A . D 3 HOH 170 470 184 HOH HOH A . D 3 HOH 171 471 165 HOH HOH A . D 3 HOH 172 472 86 HOH HOH A . D 3 HOH 173 473 142 HOH HOH A . D 3 HOH 174 474 46 HOH HOH A . D 3 HOH 175 475 141 HOH HOH A . D 3 HOH 176 476 124 HOH HOH A . D 3 HOH 177 477 199 HOH HOH A . D 3 HOH 178 478 116 HOH HOH A . D 3 HOH 179 479 77 HOH HOH A . D 3 HOH 180 480 183 HOH HOH A . D 3 HOH 181 481 74 HOH HOH A . D 3 HOH 182 482 110 HOH HOH A . D 3 HOH 183 483 144 HOH HOH A . D 3 HOH 184 484 175 HOH HOH A . D 3 HOH 185 485 191 HOH HOH A . D 3 HOH 186 486 187 HOH HOH A . D 3 HOH 187 487 213 HOH HOH A . D 3 HOH 188 488 167 HOH HOH A . D 3 HOH 189 489 69 HOH HOH A . D 3 HOH 190 490 155 HOH HOH A . D 3 HOH 191 491 100 HOH HOH A . D 3 HOH 192 492 51 HOH HOH A . D 3 HOH 193 493 170 HOH HOH A . D 3 HOH 194 494 120 HOH HOH A . D 3 HOH 195 495 135 HOH HOH A . D 3 HOH 196 496 138 HOH HOH A . D 3 HOH 197 497 211 HOH HOH A . D 3 HOH 198 498 105 HOH HOH A . D 3 HOH 199 499 112 HOH HOH A . D 3 HOH 200 500 172 HOH HOH A . D 3 HOH 201 501 203 HOH HOH A . D 3 HOH 202 502 157 HOH HOH A . D 3 HOH 203 503 98 HOH HOH A . D 3 HOH 204 504 83 HOH HOH A . D 3 HOH 205 505 117 HOH HOH A . D 3 HOH 206 506 92 HOH HOH A . D 3 HOH 207 507 217 HOH HOH A . D 3 HOH 208 508 189 HOH HOH A . D 3 HOH 209 509 107 HOH HOH A . D 3 HOH 210 510 53 HOH HOH A . D 3 HOH 211 511 186 HOH HOH A . D 3 HOH 212 512 29 HOH HOH A . D 3 HOH 213 513 132 HOH HOH A . D 3 HOH 214 514 207 HOH HOH A . D 3 HOH 215 515 143 HOH HOH A . D 3 HOH 216 516 198 HOH HOH A . D 3 HOH 217 517 188 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.13_2998 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7YSI _cell.details ? _cell.formula_units_Z ? _cell.length_a 34.590 _cell.length_a_esd ? _cell.length_b 55.010 _cell.length_b_esd ? _cell.length_c 78.090 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 7YSI _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7YSI _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.22 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 44.58 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M HEPES/NaOH pH 7.0, 15% PEG 20000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 125 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-03-01 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PAL/PLS BEAMLINE 5C (4A)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline '5C (4A)' _diffrn_source.pdbx_synchrotron_site PAL/PLS # _reflns.B_iso_Wilson_estimate 14.86 _reflns.entry_id 7YSI _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.202 _reflns.d_resolution_low 27.42 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 45597 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.64 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.7 _reflns.pdbx_Rmerge_I_obs 0.09366 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 15.42 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # _reflns_shell.d_res_high 1.202 _reflns_shell.d_res_low 27.42 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 4106 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 2.435 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 50.490 _refine.B_iso_mean 19.4527 _refine.B_iso_min 9.910 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7YSI _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.2020 _refine.ls_d_res_low 27.4180 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 45583 _refine.ls_number_reflns_R_free 2280 _refine.ls_number_reflns_R_work 43303 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.6300 _refine.ls_percent_reflns_R_free 5.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1755 _refine.ls_R_factor_R_free 0.1875 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1749 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.360 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3p2a _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 19.7800 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1900 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.2020 _refine_hist.d_res_low 27.4180 _refine_hist.number_atoms_solvent 217 _refine_hist.number_atoms_total 1341 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 143 _refine_hist.pdbx_B_iso_mean_ligand 12.35 _refine_hist.pdbx_B_iso_mean_solvent 26.92 _refine_hist.pdbx_number_atoms_protein 1122 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.202 1.2281 . . 124 2354 85.0000 . . . 0.4177 0.0000 0.4786 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.2281 1.2566 . . 136 2598 95.0000 . . . 0.4255 0.0000 0.4115 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.2566 1.2881 . . 139 2635 96.0000 . . . 0.3337 0.0000 0.3201 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.2881 1.3229 . . 140 2661 96.0000 . . . 0.2964 0.0000 0.2568 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.3229 1.3618 . . 140 2650 97.0000 . . . 0.2140 0.0000 0.2206 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.3618 1.4058 . . 143 2710 97.0000 . . . 0.2415 0.0000 0.2043 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.4058 1.4560 . . 140 2659 97.0000 . . . 0.1864 0.0000 0.1950 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.4560 1.5143 . . 142 2710 97.0000 . . . 0.2153 0.0000 0.2012 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.5143 1.5832 . . 142 2687 97.0000 . . . 0.1769 0.0000 0.1685 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.5832 1.6667 . . 143 2729 98.0000 . . . 0.1602 0.0000 0.1638 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.6667 1.7711 . . 144 2736 98.0000 . . . 0.1722 0.0000 0.1594 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7711 1.9078 . . 146 2774 98.0000 . . . 0.1664 0.0000 0.1604 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9078 2.0997 . . 146 2765 99.0000 . . . 0.1774 0.0000 0.1614 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0997 2.4034 . . 148 2817 99.0000 . . . 0.1604 0.0000 0.1523 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4034 3.0274 . . 149 2820 99.0000 . . . 0.2010 0.0000 0.1647 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0274 27.4180 . . 158 2998 100.0000 . . . 0.1688 0.0000 0.1577 . . . . . . . . . . . # _struct.entry_id 7YSI _struct.title 'Crystal structure of thioredoxin 2' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7YSI _struct_keywords.text 'Trx2, thioredoxin2, oxidoreductase' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A219CD23_ACIBA _struct_ref.pdbx_db_accession A0A219CD23 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MIIVCASCDAKNRVPEEKLTAQPSCGQCHQPLLPLEPIELNEQNFSNYITNSDLPILIDLWAEWCGPCKMMAPHFAQVAK QNPRVIFAKINTEESPRLSQAFNVRSIPTLVLMNKTTEVARMSGALRAPELQQWLDQQLQTNFGS ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7YSI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 149 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A219CD23 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 145 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 145 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7YSI GLY A 1 ? UNP A0A219CD23 ? ? 'expression tag' -3 1 1 7YSI SER A 2 ? UNP A0A219CD23 ? ? 'expression tag' -2 2 1 7YSI HIS A 3 ? UNP A0A219CD23 ? ? 'expression tag' -1 3 1 7YSI MET A 4 ? UNP A0A219CD23 ? ? 'expression tag' 0 4 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 60 ? 1 MORE -17 ? 1 'SSA (A^2)' 7630 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'light scattering' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 21 ? GLN A 26 ? GLU A 17 GLN A 22 5 ? 6 HELX_P HELX_P2 AA2 ASN A 48 ? SER A 56 ? ASN A 44 SER A 52 1 ? 9 HELX_P HELX_P3 AA3 CYS A 69 ? GLN A 85 ? CYS A 65 GLN A 81 1 ? 17 HELX_P HELX_P4 AA4 SER A 99 ? PHE A 106 ? SER A 95 PHE A 102 1 ? 8 HELX_P HELX_P5 AA5 ARG A 131 ? LEU A 143 ? ARG A 127 LEU A 139 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 69 SG ? ? ? 1_555 A CYS 72 SG ? ? A CYS 65 A CYS 68 1_555 ? ? ? ? ? ? ? 2.990 ? ? metalc1 metalc ? ? A HIS 3 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS -1 A ZN 202 1_555 ? ? ? ? ? ? ? 2.074 ? ? metalc2 metalc ? ? A CYS 9 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 5 A ZN 201 1_555 ? ? ? ? ? ? ? 2.368 ? ? metalc3 metalc ? ? A CYS 12 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 8 A ZN 201 1_555 ? ? ? ? ? ? ? 2.289 ? ? metalc4 metalc ? ? A GLU 20 OE2 ? ? ? 1_555 C ZN . ZN ? ? A GLU 16 A ZN 202 1_555 ? ? ? ? ? ? ? 1.910 ? ? metalc5 metalc ? ? A CYS 29 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 25 A ZN 201 1_555 ? ? ? ? ? ? ? 2.327 ? ? metalc6 metalc ? ? A CYS 32 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 28 A ZN 201 1_555 ? ? ? ? ? ? ? 2.325 ? ? metalc7 metalc ? ? A HIS 33 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 29 A ZN 202 4_545 ? ? ? ? ? ? ? 1.998 ? ? metalc8 metalc ? ? A GLU 67 OE1 ? ? ? 1_555 C ZN . ZN ? ? A GLU 63 A ZN 202 2_554 ? ? ? ? ? ? ? 1.981 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 ND1 ? A HIS 3 ? A HIS -1 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 OE2 ? A GLU 20 ? A GLU 16 ? 1_555 108.3 ? 2 ND1 ? A HIS 3 ? A HIS -1 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 ND1 ? A HIS 33 ? A HIS 29 ? 1_555 88.2 ? 3 OE2 ? A GLU 20 ? A GLU 16 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 ND1 ? A HIS 33 ? A HIS 29 ? 1_555 29.1 ? 4 ND1 ? A HIS 3 ? A HIS -1 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 OE1 ? A GLU 67 ? A GLU 63 ? 1_555 136.2 ? 5 OE2 ? A GLU 20 ? A GLU 16 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 OE1 ? A GLU 67 ? A GLU 63 ? 1_555 46.5 ? 6 ND1 ? A HIS 33 ? A HIS 29 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 OE1 ? A GLU 67 ? A GLU 63 ? 1_555 52.4 ? 7 SG ? A CYS 9 ? A CYS 5 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 12 ? A CYS 8 ? 1_555 114.3 ? 8 SG ? A CYS 9 ? A CYS 5 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 29 ? A CYS 25 ? 1_555 107.6 ? 9 SG ? A CYS 12 ? A CYS 8 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 29 ? A CYS 25 ? 1_555 103.9 ? 10 SG ? A CYS 9 ? A CYS 5 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 32 ? A CYS 28 ? 1_555 100.7 ? 11 SG ? A CYS 12 ? A CYS 8 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 32 ? A CYS 28 ? 1_555 116.3 ? 12 SG ? A CYS 29 ? A CYS 25 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 32 ? A CYS 28 ? 1_555 114.1 ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 69 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 72 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 65 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 68 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ILE _struct_mon_prot_cis.label_seq_id 111 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ILE _struct_mon_prot_cis.auth_seq_id 107 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 112 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 108 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 1.48 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 MET A 4 ? VAL A 8 ? MET A 0 VAL A 4 AA1 2 LYS A 15 ? PRO A 19 ? LYS A 11 PRO A 15 AA2 1 ILE A 42 ? GLU A 43 ? ILE A 38 GLU A 39 AA2 2 ILE A 90 ? ASN A 95 ? ILE A 86 ASN A 91 AA2 3 ILE A 60 ? TRP A 65 ? ILE A 56 TRP A 61 AA2 4 THR A 113 ? ASN A 118 ? THR A 109 ASN A 114 AA2 5 THR A 121 ? SER A 127 ? THR A 117 SER A 123 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N MET A 5 ? N MET A 1 O VAL A 18 ? O VAL A 14 AA2 1 2 N ILE A 42 ? N ILE A 38 O LYS A 93 ? O LYS A 89 AA2 2 3 O ILE A 90 ? O ILE A 86 N LEU A 61 ? N LEU A 57 AA2 3 4 N ILE A 60 ? N ILE A 56 O MET A 117 ? O MET A 113 AA2 4 5 N LEU A 116 ? N LEU A 112 O VAL A 123 ? O VAL A 119 # _pdbx_entry_details.entry_id 7YSI _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 408 ? ? O A HOH 445 ? ? 1.92 2 1 O A HOH 442 ? ? O A HOH 497 ? ? 2.03 3 1 O A HOH 406 ? ? O A HOH 427 ? ? 2.09 4 1 O A HOH 453 ? ? O A HOH 459 ? ? 2.13 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 HD1 A HIS 29 ? ? 1_555 ZN A ZN 202 ? ? 4_545 1.14 2 1 O A HOH 301 ? ? 1_555 O A HOH 352 ? ? 3_544 1.92 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 105 ? ? -107.53 -100.75 2 1 THR A 116 ? ? 81.59 -5.75 # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 517 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 6.97 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLN 140 ? A GLN 144 2 1 Y 1 A THR 141 ? A THR 145 3 1 Y 1 A ASN 142 ? A ASN 146 4 1 Y 1 A PHE 143 ? A PHE 147 5 1 Y 1 A GLY 144 ? A GLY 148 6 1 Y 1 A SER 145 ? A SER 149 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 ZN ZN ZN N N 391 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization 'National Research Foundation (NRF, Korea)' _pdbx_audit_support.country 'Korea, Republic Of' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3P2A _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7YSI _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.028910 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018179 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012806 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S ZN # loop_