data_7ZNV # _entry.id 7ZNV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.385 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7ZNV pdb_00007znv 10.2210/pdb7znv/pdb WWPDB D_1292122569 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-03-01 2 'Structure model' 1 1 2024-02-07 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7ZNV _pdbx_database_status.recvd_initial_deposition_date 2022-04-22 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email gideon.grogan@york.ac.uk _pdbx_contact_author.name_first Gideon _pdbx_contact_author.name_last Grogan _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-1383-7056 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Robinson, W.X.Q.' 1 ? 'Mielke, T.' 2 ? 'Grogan, G.' 3 0000-0003-1383-7056 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country GE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Chembiochem _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1439-7633 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 24 _citation.language ? _citation.page_first e202200558 _citation.page_last e202200558 _citation.title ;Comparing the Catalytic and Structural Characteristics of a 'Short' Unspecific Peroxygenase (UPO) Expressed in Pichia pastoris and Escherichia coli. ; _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/cbic.202200558 _citation.pdbx_database_id_PubMed 36374006 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Robinson, W.X.Q.' 1 ? primary 'Mielke, T.' 2 ? primary 'Melling, B.' 3 ? primary 'Cuetos, A.' 4 ? primary 'Parkin, A.' 5 ? primary 'Unsworth, W.P.' 6 ? primary 'Cartwright, J.' 7 ? primary 'Grogan, G.' 8 0000-0003-1383-7056 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'artificial unspecific peroxygenase' 26476.498 1 1.11.2.1 ? ? ? 2 branched man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401 1 ? ? ? ? 3 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487 1 ? ? ? ? 4 non-polymer syn 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208 1 ? ? ? ? 5 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 6 water nat water 18.015 373 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SQDIVDFSQHPWKAPGPNDLRSPCPGLNTLANHGFLPRNGRNITIPMIVQAGFDGYNVQPDILILAAKVGLLTSPEPDTF TLDDLKLHGTIEHDASLSREDFALGDNLHFNEAIFNTLANSNPGSDVYNITSAGQVLKDRLADSLARNPNVTNTGKEFTI RTLESAFYLSVMGNATTGEAPKNFVQIFFREERLPIEEGWKRSTTPITSDTLNPIAGQISEASNWKPNPDQCPWIVLSPN L ; _entity_poly.pdbx_seq_one_letter_code_can ;SQDIVDFSQHPWKAPGPNDLRSPCPGLNTLANHGFLPRNGRNITIPMIVQAGFDGYNVQPDILILAAKVGLLTSPEPDTF TLDDLKLHGTIEHDASLSREDFALGDNLHFNEAIFNTLANSNPGSDVYNITSAGQVLKDRLADSLARNPNVTNTGKEFTI RTLESAFYLSVMGNATTGEAPKNFVQIFFREERLPIEEGWKRSTTPITSDTLNPIAGQISEASNWKPNPDQCPWIVLSPN L ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'PROTOPORPHYRIN IX CONTAINING FE' HEM 4 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 5 'MAGNESIUM ION' MG 6 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 GLN n 1 3 ASP n 1 4 ILE n 1 5 VAL n 1 6 ASP n 1 7 PHE n 1 8 SER n 1 9 GLN n 1 10 HIS n 1 11 PRO n 1 12 TRP n 1 13 LYS n 1 14 ALA n 1 15 PRO n 1 16 GLY n 1 17 PRO n 1 18 ASN n 1 19 ASP n 1 20 LEU n 1 21 ARG n 1 22 SER n 1 23 PRO n 1 24 CYS n 1 25 PRO n 1 26 GLY n 1 27 LEU n 1 28 ASN n 1 29 THR n 1 30 LEU n 1 31 ALA n 1 32 ASN n 1 33 HIS n 1 34 GLY n 1 35 PHE n 1 36 LEU n 1 37 PRO n 1 38 ARG n 1 39 ASN n 1 40 GLY n 1 41 ARG n 1 42 ASN n 1 43 ILE n 1 44 THR n 1 45 ILE n 1 46 PRO n 1 47 MET n 1 48 ILE n 1 49 VAL n 1 50 GLN n 1 51 ALA n 1 52 GLY n 1 53 PHE n 1 54 ASP n 1 55 GLY n 1 56 TYR n 1 57 ASN n 1 58 VAL n 1 59 GLN n 1 60 PRO n 1 61 ASP n 1 62 ILE n 1 63 LEU n 1 64 ILE n 1 65 LEU n 1 66 ALA n 1 67 ALA n 1 68 LYS n 1 69 VAL n 1 70 GLY n 1 71 LEU n 1 72 LEU n 1 73 THR n 1 74 SER n 1 75 PRO n 1 76 GLU n 1 77 PRO n 1 78 ASP n 1 79 THR n 1 80 PHE n 1 81 THR n 1 82 LEU n 1 83 ASP n 1 84 ASP n 1 85 LEU n 1 86 LYS n 1 87 LEU n 1 88 HIS n 1 89 GLY n 1 90 THR n 1 91 ILE n 1 92 GLU n 1 93 HIS n 1 94 ASP n 1 95 ALA n 1 96 SER n 1 97 LEU n 1 98 SER n 1 99 ARG n 1 100 GLU n 1 101 ASP n 1 102 PHE n 1 103 ALA n 1 104 LEU n 1 105 GLY n 1 106 ASP n 1 107 ASN n 1 108 LEU n 1 109 HIS n 1 110 PHE n 1 111 ASN n 1 112 GLU n 1 113 ALA n 1 114 ILE n 1 115 PHE n 1 116 ASN n 1 117 THR n 1 118 LEU n 1 119 ALA n 1 120 ASN n 1 121 SER n 1 122 ASN n 1 123 PRO n 1 124 GLY n 1 125 SER n 1 126 ASP n 1 127 VAL n 1 128 TYR n 1 129 ASN n 1 130 ILE n 1 131 THR n 1 132 SER n 1 133 ALA n 1 134 GLY n 1 135 GLN n 1 136 VAL n 1 137 LEU n 1 138 LYS n 1 139 ASP n 1 140 ARG n 1 141 LEU n 1 142 ALA n 1 143 ASP n 1 144 SER n 1 145 LEU n 1 146 ALA n 1 147 ARG n 1 148 ASN n 1 149 PRO n 1 150 ASN n 1 151 VAL n 1 152 THR n 1 153 ASN n 1 154 THR n 1 155 GLY n 1 156 LYS n 1 157 GLU n 1 158 PHE n 1 159 THR n 1 160 ILE n 1 161 ARG n 1 162 THR n 1 163 LEU n 1 164 GLU n 1 165 SER n 1 166 ALA n 1 167 PHE n 1 168 TYR n 1 169 LEU n 1 170 SER n 1 171 VAL n 1 172 MET n 1 173 GLY n 1 174 ASN n 1 175 ALA n 1 176 THR n 1 177 THR n 1 178 GLY n 1 179 GLU n 1 180 ALA n 1 181 PRO n 1 182 LYS n 1 183 ASN n 1 184 PHE n 1 185 VAL n 1 186 GLN n 1 187 ILE n 1 188 PHE n 1 189 PHE n 1 190 ARG n 1 191 GLU n 1 192 GLU n 1 193 ARG n 1 194 LEU n 1 195 PRO n 1 196 ILE n 1 197 GLU n 1 198 GLU n 1 199 GLY n 1 200 TRP n 1 201 LYS n 1 202 ARG n 1 203 SER n 1 204 THR n 1 205 THR n 1 206 PRO n 1 207 ILE n 1 208 THR n 1 209 SER n 1 210 ASP n 1 211 THR n 1 212 LEU n 1 213 ASN n 1 214 PRO n 1 215 ILE n 1 216 ALA n 1 217 GLY n 1 218 GLN n 1 219 ILE n 1 220 SER n 1 221 GLU n 1 222 ALA n 1 223 SER n 1 224 ASN n 1 225 TRP n 1 226 LYS n 1 227 PRO n 1 228 ASN n 1 229 PRO n 1 230 ASP n 1 231 GLN n 1 232 CYS n 1 233 PRO n 1 234 TRP n 1 235 ILE n 1 236 VAL n 1 237 LEU n 1 238 SER n 1 239 PRO n 1 240 ASN n 1 241 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 241 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Marasmius rotula' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 182057 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Komagataella pastoris' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 4922 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_branch.entity_id 2 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 DGlcpNAcb1-4DGlcpNAcb1-ROH 'Glycam Condensed Sequence' GMML 1.0 2 2 'WURCS=2.0/1,2,1/[a2122h-1b_1-5_2*NCC/3=O]/1-1/a4-b1' WURCS PDB2Glycan 1.1.0 3 2 '[][D-1-deoxy-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}}' LINUCS PDB-CARE ? # _pdbx_entity_branch_link.link_id 1 _pdbx_entity_branch_link.entity_id 2 _pdbx_entity_branch_link.entity_branch_list_num_1 2 _pdbx_entity_branch_link.comp_id_1 NAG _pdbx_entity_branch_link.atom_id_1 C1 _pdbx_entity_branch_link.leaving_atom_id_1 O1 _pdbx_entity_branch_link.entity_branch_list_num_2 1 _pdbx_entity_branch_link.comp_id_2 NAG _pdbx_entity_branch_link.atom_id_2 O4 _pdbx_entity_branch_link.leaving_atom_id_2 HO4 _pdbx_entity_branch_link.value_order sing _pdbx_entity_branch_link.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEM non-polymer . 'PROTOPORPHYRIN IX CONTAINING FE' HEME 'C34 H32 Fe N4 O4' 616.487 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE ; 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 ? ? ? A . n A 1 2 GLN 2 2 ? ? ? A . n A 1 3 ASP 3 3 ? ? ? A . n A 1 4 ILE 4 4 ? ? ? A . n A 1 5 VAL 5 5 ? ? ? A . n A 1 6 ASP 6 6 ? ? ? A . n A 1 7 PHE 7 7 ? ? ? A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 HIS 10 10 10 HIS HIS A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 TRP 12 12 12 TRP TRP A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 CYS 24 24 24 CYS CYS A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 HIS 33 33 33 HIS HIS A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 ASN 39 39 39 ASN ASN A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 MET 47 47 47 MET MET A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 PHE 80 80 80 PHE PHE A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 HIS 88 88 88 HIS HIS A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 HIS 93 93 93 HIS HIS A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 SER 98 98 98 SER SER A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 ASP 101 101 101 ASP ASP A . n A 1 102 PHE 102 102 102 PHE PHE A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 ASP 106 106 106 ASP ASP A . n A 1 107 ASN 107 107 107 ASN ASN A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 HIS 109 109 109 HIS HIS A . n A 1 110 PHE 110 110 110 PHE PHE A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 ILE 114 114 114 ILE ILE A . n A 1 115 PHE 115 115 115 PHE PHE A . n A 1 116 ASN 116 116 116 ASN ASN A . n A 1 117 THR 117 117 117 THR THR A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 ASN 120 120 120 ASN ASN A . n A 1 121 SER 121 121 121 SER SER A . n A 1 122 ASN 122 122 122 ASN ASN A . n A 1 123 PRO 123 123 123 PRO PRO A . n A 1 124 GLY 124 124 124 GLY GLY A . n A 1 125 SER 125 125 125 SER SER A . n A 1 126 ASP 126 126 126 ASP ASP A . n A 1 127 VAL 127 127 127 VAL VAL A . n A 1 128 TYR 128 128 128 TYR TYR A . n A 1 129 ASN 129 129 129 ASN ASN A . n A 1 130 ILE 130 130 130 ILE ILE A . n A 1 131 THR 131 131 131 THR THR A . n A 1 132 SER 132 132 132 SER SER A . n A 1 133 ALA 133 133 133 ALA ALA A . n A 1 134 GLY 134 134 134 GLY GLY A . n A 1 135 GLN 135 135 135 GLN GLN A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 LYS 138 138 138 LYS LYS A . n A 1 139 ASP 139 139 139 ASP ASP A . n A 1 140 ARG 140 140 140 ARG ARG A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 ALA 142 142 142 ALA ALA A . n A 1 143 ASP 143 143 143 ASP ASP A . n A 1 144 SER 144 144 144 SER SER A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 ARG 147 147 147 ARG ARG A . n A 1 148 ASN 148 148 148 ASN ASN A . n A 1 149 PRO 149 149 149 PRO PRO A . n A 1 150 ASN 150 150 150 ASN ASN A . n A 1 151 VAL 151 151 151 VAL VAL A . n A 1 152 THR 152 152 152 THR THR A . n A 1 153 ASN 153 153 153 ASN ASN A . n A 1 154 THR 154 154 154 THR THR A . n A 1 155 GLY 155 155 155 GLY GLY A . n A 1 156 LYS 156 156 156 LYS LYS A . n A 1 157 GLU 157 157 157 GLU GLU A . n A 1 158 PHE 158 158 158 PHE PHE A . n A 1 159 THR 159 159 159 THR THR A . n A 1 160 ILE 160 160 160 ILE ILE A . n A 1 161 ARG 161 161 161 ARG ARG A . n A 1 162 THR 162 162 162 THR THR A . n A 1 163 LEU 163 163 163 LEU LEU A . n A 1 164 GLU 164 164 164 GLU GLU A . n A 1 165 SER 165 165 165 SER SER A . n A 1 166 ALA 166 166 166 ALA ALA A . n A 1 167 PHE 167 167 167 PHE PHE A . n A 1 168 TYR 168 168 168 TYR TYR A . n A 1 169 LEU 169 169 169 LEU LEU A . n A 1 170 SER 170 170 170 SER SER A . n A 1 171 VAL 171 171 171 VAL VAL A . n A 1 172 MET 172 172 172 MET MET A . n A 1 173 GLY 173 173 173 GLY GLY A . n A 1 174 ASN 174 174 174 ASN ASN A . n A 1 175 ALA 175 175 175 ALA ALA A . n A 1 176 THR 176 176 176 THR THR A . n A 1 177 THR 177 177 177 THR THR A . n A 1 178 GLY 178 178 178 GLY GLY A . n A 1 179 GLU 179 179 179 GLU GLU A . n A 1 180 ALA 180 180 180 ALA ALA A . n A 1 181 PRO 181 181 181 PRO PRO A . n A 1 182 LYS 182 182 182 LYS LYS A . n A 1 183 ASN 183 183 183 ASN ASN A . n A 1 184 PHE 184 184 184 PHE PHE A . n A 1 185 VAL 185 185 185 VAL VAL A . n A 1 186 GLN 186 186 186 GLN GLN A . n A 1 187 ILE 187 187 187 ILE ILE A . n A 1 188 PHE 188 188 188 PHE PHE A . n A 1 189 PHE 189 189 189 PHE PHE A . n A 1 190 ARG 190 190 190 ARG ARG A . n A 1 191 GLU 191 191 191 GLU GLU A . n A 1 192 GLU 192 192 192 GLU GLU A . n A 1 193 ARG 193 193 193 ARG ARG A . n A 1 194 LEU 194 194 194 LEU LEU A . n A 1 195 PRO 195 195 195 PRO PRO A . n A 1 196 ILE 196 196 196 ILE ILE A . n A 1 197 GLU 197 197 197 GLU GLU A . n A 1 198 GLU 198 198 198 GLU GLU A . n A 1 199 GLY 199 199 199 GLY GLY A . n A 1 200 TRP 200 200 200 TRP TRP A . n A 1 201 LYS 201 201 201 LYS LYS A . n A 1 202 ARG 202 202 202 ARG ARG A . n A 1 203 SER 203 203 203 SER SER A . n A 1 204 THR 204 204 204 THR THR A . n A 1 205 THR 205 205 205 THR THR A . n A 1 206 PRO 206 206 206 PRO PRO A . n A 1 207 ILE 207 207 207 ILE ILE A . n A 1 208 THR 208 208 208 THR THR A . n A 1 209 SER 209 209 209 SER SER A . n A 1 210 ASP 210 210 210 ASP ASP A . n A 1 211 THR 211 211 211 THR THR A . n A 1 212 LEU 212 212 212 LEU LEU A . n A 1 213 ASN 213 213 213 ASN ASN A . n A 1 214 PRO 214 214 214 PRO PRO A . n A 1 215 ILE 215 215 215 ILE ILE A . n A 1 216 ALA 216 216 216 ALA ALA A . n A 1 217 GLY 217 217 217 GLY GLY A . n A 1 218 GLN 218 218 218 GLN GLN A . n A 1 219 ILE 219 219 219 ILE ILE A . n A 1 220 SER 220 220 220 SER SER A . n A 1 221 GLU 221 221 221 GLU GLU A . n A 1 222 ALA 222 222 222 ALA ALA A . n A 1 223 SER 223 223 223 SER SER A . n A 1 224 ASN 224 224 224 ASN ASN A . n A 1 225 TRP 225 225 225 TRP TRP A . n A 1 226 LYS 226 226 226 LYS LYS A . n A 1 227 PRO 227 227 227 PRO PRO A . n A 1 228 ASN 228 228 228 ASN ASN A . n A 1 229 PRO 229 229 229 PRO PRO A . n A 1 230 ASP 230 230 230 ASP ASP A . n A 1 231 GLN 231 231 231 GLN GLN A . n A 1 232 CYS 232 232 232 CYS CYS A . n A 1 233 PRO 233 233 233 PRO PRO A . n A 1 234 TRP 234 234 234 TRP TRP A . n A 1 235 ILE 235 235 235 ILE ILE A . n A 1 236 VAL 236 236 236 VAL VAL A . n A 1 237 LEU 237 237 237 LEU LEU A . n A 1 238 SER 238 238 238 SER SER A . n A 1 239 PRO 239 239 239 PRO PRO A . n A 1 240 ASN 240 240 240 ASN ASN A . n A 1 241 LEU 241 241 241 LEU LEU A . n # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 NAG 1 B NAG 1 A NAG 401 n B 2 NAG 2 B NAG 2 A NAG 501 n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 HEM 1 301 301 HEM HEM A . D 4 NAG 1 302 601 NAG NAG A . E 5 MG 1 303 1 MG MG A . F 6 HOH 1 401 363 HOH HOH A . F 6 HOH 2 402 293 HOH HOH A . F 6 HOH 3 403 174 HOH HOH A . F 6 HOH 4 404 227 HOH HOH A . F 6 HOH 5 405 273 HOH HOH A . F 6 HOH 6 406 274 HOH HOH A . F 6 HOH 7 407 361 HOH HOH A . F 6 HOH 8 408 374 HOH HOH A . F 6 HOH 9 409 117 HOH HOH A . F 6 HOH 10 410 288 HOH HOH A . F 6 HOH 11 411 231 HOH HOH A . F 6 HOH 12 412 323 HOH HOH A . F 6 HOH 13 413 34 HOH HOH A . F 6 HOH 14 414 185 HOH HOH A . F 6 HOH 15 415 207 HOH HOH A . F 6 HOH 16 416 62 HOH HOH A . F 6 HOH 17 417 179 HOH HOH A . F 6 HOH 18 418 271 HOH HOH A . F 6 HOH 19 419 8 HOH HOH A . F 6 HOH 20 420 46 HOH HOH A . F 6 HOH 21 421 154 HOH HOH A . F 6 HOH 22 422 169 HOH HOH A . F 6 HOH 23 423 240 HOH HOH A . F 6 HOH 24 424 229 HOH HOH A . F 6 HOH 25 425 307 HOH HOH A . F 6 HOH 26 426 145 HOH HOH A . F 6 HOH 27 427 84 HOH HOH A . F 6 HOH 28 428 346 HOH HOH A . F 6 HOH 29 429 360 HOH HOH A . F 6 HOH 30 430 104 HOH HOH A . F 6 HOH 31 431 268 HOH HOH A . F 6 HOH 32 432 20 HOH HOH A . F 6 HOH 33 433 109 HOH HOH A . F 6 HOH 34 434 354 HOH HOH A . F 6 HOH 35 435 118 HOH HOH A . F 6 HOH 36 436 335 HOH HOH A . F 6 HOH 37 437 232 HOH HOH A . F 6 HOH 38 438 234 HOH HOH A . F 6 HOH 39 439 156 HOH HOH A . F 6 HOH 40 440 108 HOH HOH A . F 6 HOH 41 441 252 HOH HOH A . F 6 HOH 42 442 302 HOH HOH A . F 6 HOH 43 443 124 HOH HOH A . F 6 HOH 44 444 381 HOH HOH A . F 6 HOH 45 445 80 HOH HOH A . F 6 HOH 46 446 44 HOH HOH A . F 6 HOH 47 447 113 HOH HOH A . F 6 HOH 48 448 86 HOH HOH A . F 6 HOH 49 449 214 HOH HOH A . F 6 HOH 50 450 283 HOH HOH A . F 6 HOH 51 451 102 HOH HOH A . F 6 HOH 52 452 250 HOH HOH A . F 6 HOH 53 453 312 HOH HOH A . F 6 HOH 54 454 203 HOH HOH A . F 6 HOH 55 455 92 HOH HOH A . F 6 HOH 56 456 3 HOH HOH A . F 6 HOH 57 457 94 HOH HOH A . F 6 HOH 58 458 78 HOH HOH A . F 6 HOH 59 459 15 HOH HOH A . F 6 HOH 60 460 40 HOH HOH A . F 6 HOH 61 461 98 HOH HOH A . F 6 HOH 62 462 221 HOH HOH A . F 6 HOH 63 463 182 HOH HOH A . F 6 HOH 64 464 167 HOH HOH A . F 6 HOH 65 465 56 HOH HOH A . F 6 HOH 66 466 66 HOH HOH A . F 6 HOH 67 467 105 HOH HOH A . F 6 HOH 68 468 5 HOH HOH A . F 6 HOH 69 469 220 HOH HOH A . F 6 HOH 70 470 251 HOH HOH A . F 6 HOH 71 471 255 HOH HOH A . F 6 HOH 72 472 52 HOH HOH A . F 6 HOH 73 473 25 HOH HOH A . F 6 HOH 74 474 194 HOH HOH A . F 6 HOH 75 475 299 HOH HOH A . F 6 HOH 76 476 308 HOH HOH A . F 6 HOH 77 477 36 HOH HOH A . F 6 HOH 78 478 148 HOH HOH A . F 6 HOH 79 479 164 HOH HOH A . F 6 HOH 80 480 10 HOH HOH A . F 6 HOH 81 481 32 HOH HOH A . F 6 HOH 82 482 4 HOH HOH A . F 6 HOH 83 483 11 HOH HOH A . F 6 HOH 84 484 68 HOH HOH A . F 6 HOH 85 485 69 HOH HOH A . F 6 HOH 86 486 31 HOH HOH A . F 6 HOH 87 487 81 HOH HOH A . F 6 HOH 88 488 53 HOH HOH A . F 6 HOH 89 489 115 HOH HOH A . F 6 HOH 90 490 93 HOH HOH A . F 6 HOH 91 491 224 HOH HOH A . F 6 HOH 92 492 9 HOH HOH A . F 6 HOH 93 493 64 HOH HOH A . F 6 HOH 94 494 236 HOH HOH A . F 6 HOH 95 495 128 HOH HOH A . F 6 HOH 96 496 318 HOH HOH A . F 6 HOH 97 497 37 HOH HOH A . F 6 HOH 98 498 27 HOH HOH A . F 6 HOH 99 499 395 HOH HOH A . F 6 HOH 100 500 17 HOH HOH A . F 6 HOH 101 501 137 HOH HOH A . F 6 HOH 102 502 65 HOH HOH A . F 6 HOH 103 503 1 HOH HOH A . F 6 HOH 104 504 126 HOH HOH A . F 6 HOH 105 505 301 HOH HOH A . F 6 HOH 106 506 339 HOH HOH A . F 6 HOH 107 507 175 HOH HOH A . F 6 HOH 108 508 55 HOH HOH A . F 6 HOH 109 509 90 HOH HOH A . F 6 HOH 110 510 217 HOH HOH A . F 6 HOH 111 511 7 HOH HOH A . F 6 HOH 112 512 12 HOH HOH A . F 6 HOH 113 513 45 HOH HOH A . F 6 HOH 114 514 43 HOH HOH A . F 6 HOH 115 515 99 HOH HOH A . F 6 HOH 116 516 35 HOH HOH A . F 6 HOH 117 517 14 HOH HOH A . F 6 HOH 118 518 71 HOH HOH A . F 6 HOH 119 519 172 HOH HOH A . F 6 HOH 120 520 176 HOH HOH A . F 6 HOH 121 521 129 HOH HOH A . F 6 HOH 122 522 30 HOH HOH A . F 6 HOH 123 523 385 HOH HOH A . F 6 HOH 124 524 21 HOH HOH A . F 6 HOH 125 525 79 HOH HOH A . F 6 HOH 126 526 158 HOH HOH A . F 6 HOH 127 527 73 HOH HOH A . F 6 HOH 128 528 23 HOH HOH A . F 6 HOH 129 529 41 HOH HOH A . F 6 HOH 130 530 76 HOH HOH A . F 6 HOH 131 531 316 HOH HOH A . F 6 HOH 132 532 130 HOH HOH A . F 6 HOH 133 533 146 HOH HOH A . F 6 HOH 134 534 253 HOH HOH A . F 6 HOH 135 535 6 HOH HOH A . F 6 HOH 136 536 178 HOH HOH A . F 6 HOH 137 537 74 HOH HOH A . F 6 HOH 138 538 209 HOH HOH A . F 6 HOH 139 539 198 HOH HOH A . F 6 HOH 140 540 121 HOH HOH A . F 6 HOH 141 541 249 HOH HOH A . F 6 HOH 142 542 33 HOH HOH A . F 6 HOH 143 543 160 HOH HOH A . F 6 HOH 144 544 13 HOH HOH A . F 6 HOH 145 545 159 HOH HOH A . F 6 HOH 146 546 228 HOH HOH A . F 6 HOH 147 547 208 HOH HOH A . F 6 HOH 148 548 29 HOH HOH A . F 6 HOH 149 549 254 HOH HOH A . F 6 HOH 150 550 261 HOH HOH A . F 6 HOH 151 551 100 HOH HOH A . F 6 HOH 152 552 54 HOH HOH A . F 6 HOH 153 553 103 HOH HOH A . F 6 HOH 154 554 310 HOH HOH A . F 6 HOH 155 555 352 HOH HOH A . F 6 HOH 156 556 89 HOH HOH A . F 6 HOH 157 557 192 HOH HOH A . F 6 HOH 158 558 157 HOH HOH A . F 6 HOH 159 559 70 HOH HOH A . F 6 HOH 160 560 141 HOH HOH A . F 6 HOH 161 561 48 HOH HOH A . F 6 HOH 162 562 396 HOH HOH A . F 6 HOH 163 563 223 HOH HOH A . F 6 HOH 164 564 49 HOH HOH A . F 6 HOH 165 565 131 HOH HOH A . F 6 HOH 166 566 47 HOH HOH A . F 6 HOH 167 567 50 HOH HOH A . F 6 HOH 168 568 378 HOH HOH A . F 6 HOH 169 569 263 HOH HOH A . F 6 HOH 170 570 246 HOH HOH A . F 6 HOH 171 571 18 HOH HOH A . F 6 HOH 172 572 162 HOH HOH A . F 6 HOH 173 573 63 HOH HOH A . F 6 HOH 174 574 373 HOH HOH A . F 6 HOH 175 575 189 HOH HOH A . F 6 HOH 176 576 315 HOH HOH A . F 6 HOH 177 577 58 HOH HOH A . F 6 HOH 178 578 135 HOH HOH A . F 6 HOH 179 579 88 HOH HOH A . F 6 HOH 180 580 2 HOH HOH A . F 6 HOH 181 581 193 HOH HOH A . F 6 HOH 182 582 143 HOH HOH A . F 6 HOH 183 583 136 HOH HOH A . F 6 HOH 184 584 225 HOH HOH A . F 6 HOH 185 585 38 HOH HOH A . F 6 HOH 186 586 106 HOH HOH A . F 6 HOH 187 587 122 HOH HOH A . F 6 HOH 188 588 114 HOH HOH A . F 6 HOH 189 589 142 HOH HOH A . F 6 HOH 190 590 120 HOH HOH A . F 6 HOH 191 591 19 HOH HOH A . F 6 HOH 192 592 186 HOH HOH A . F 6 HOH 193 593 295 HOH HOH A . F 6 HOH 194 594 262 HOH HOH A . F 6 HOH 195 595 134 HOH HOH A . F 6 HOH 196 596 325 HOH HOH A . F 6 HOH 197 597 82 HOH HOH A . F 6 HOH 198 598 197 HOH HOH A . F 6 HOH 199 599 190 HOH HOH A . F 6 HOH 200 600 16 HOH HOH A . F 6 HOH 201 601 394 HOH HOH A . F 6 HOH 202 602 116 HOH HOH A . F 6 HOH 203 603 188 HOH HOH A . F 6 HOH 204 604 24 HOH HOH A . F 6 HOH 205 605 61 HOH HOH A . F 6 HOH 206 606 127 HOH HOH A . F 6 HOH 207 607 388 HOH HOH A . F 6 HOH 208 608 22 HOH HOH A . F 6 HOH 209 609 51 HOH HOH A . F 6 HOH 210 610 183 HOH HOH A . F 6 HOH 211 611 91 HOH HOH A . F 6 HOH 212 612 359 HOH HOH A . F 6 HOH 213 613 60 HOH HOH A . F 6 HOH 214 614 330 HOH HOH A . F 6 HOH 215 615 269 HOH HOH A . F 6 HOH 216 616 191 HOH HOH A . F 6 HOH 217 617 375 HOH HOH A . F 6 HOH 218 618 97 HOH HOH A . F 6 HOH 219 619 139 HOH HOH A . F 6 HOH 220 620 150 HOH HOH A . F 6 HOH 221 621 320 HOH HOH A . F 6 HOH 222 622 313 HOH HOH A . F 6 HOH 223 623 87 HOH HOH A . F 6 HOH 224 624 152 HOH HOH A . F 6 HOH 225 625 123 HOH HOH A . F 6 HOH 226 626 370 HOH HOH A . F 6 HOH 227 627 151 HOH HOH A . F 6 HOH 228 628 284 HOH HOH A . F 6 HOH 229 629 350 HOH HOH A . F 6 HOH 230 630 380 HOH HOH A . F 6 HOH 231 631 345 HOH HOH A . F 6 HOH 232 632 242 HOH HOH A . F 6 HOH 233 633 304 HOH HOH A . F 6 HOH 234 634 328 HOH HOH A . F 6 HOH 235 635 331 HOH HOH A . F 6 HOH 236 636 216 HOH HOH A . F 6 HOH 237 637 306 HOH HOH A . F 6 HOH 238 638 57 HOH HOH A . F 6 HOH 239 639 77 HOH HOH A . F 6 HOH 240 640 287 HOH HOH A . F 6 HOH 241 641 321 HOH HOH A . F 6 HOH 242 642 264 HOH HOH A . F 6 HOH 243 643 389 HOH HOH A . F 6 HOH 244 644 83 HOH HOH A . F 6 HOH 245 645 210 HOH HOH A . F 6 HOH 246 646 75 HOH HOH A . F 6 HOH 247 647 362 HOH HOH A . F 6 HOH 248 648 165 HOH HOH A . F 6 HOH 249 649 377 HOH HOH A . F 6 HOH 250 650 212 HOH HOH A . F 6 HOH 251 651 101 HOH HOH A . F 6 HOH 252 652 353 HOH HOH A . F 6 HOH 253 653 96 HOH HOH A . F 6 HOH 254 654 144 HOH HOH A . F 6 HOH 255 655 338 HOH HOH A . F 6 HOH 256 656 163 HOH HOH A . F 6 HOH 257 657 85 HOH HOH A . F 6 HOH 258 658 125 HOH HOH A . F 6 HOH 259 659 138 HOH HOH A . F 6 HOH 260 660 349 HOH HOH A . F 6 HOH 261 661 241 HOH HOH A . F 6 HOH 262 662 245 HOH HOH A . F 6 HOH 263 663 202 HOH HOH A . F 6 HOH 264 664 181 HOH HOH A . F 6 HOH 265 665 391 HOH HOH A . F 6 HOH 266 666 309 HOH HOH A . F 6 HOH 267 667 340 HOH HOH A . F 6 HOH 268 668 387 HOH HOH A . F 6 HOH 269 669 292 HOH HOH A . F 6 HOH 270 670 107 HOH HOH A . F 6 HOH 271 671 222 HOH HOH A . F 6 HOH 272 672 355 HOH HOH A . F 6 HOH 273 673 258 HOH HOH A . F 6 HOH 274 674 300 HOH HOH A . F 6 HOH 275 675 211 HOH HOH A . F 6 HOH 276 676 155 HOH HOH A . F 6 HOH 277 677 314 HOH HOH A . F 6 HOH 278 678 119 HOH HOH A . F 6 HOH 279 679 244 HOH HOH A . F 6 HOH 280 680 282 HOH HOH A . F 6 HOH 281 681 247 HOH HOH A . F 6 HOH 282 682 67 HOH HOH A . F 6 HOH 283 683 233 HOH HOH A . F 6 HOH 284 684 196 HOH HOH A . F 6 HOH 285 685 187 HOH HOH A . F 6 HOH 286 686 213 HOH HOH A . F 6 HOH 287 687 112 HOH HOH A . F 6 HOH 288 688 200 HOH HOH A . F 6 HOH 289 689 272 HOH HOH A . F 6 HOH 290 690 348 HOH HOH A . F 6 HOH 291 691 305 HOH HOH A . F 6 HOH 292 692 161 HOH HOH A . F 6 HOH 293 693 383 HOH HOH A . F 6 HOH 294 694 28 HOH HOH A . F 6 HOH 295 695 39 HOH HOH A . F 6 HOH 296 696 367 HOH HOH A . F 6 HOH 297 697 393 HOH HOH A . F 6 HOH 298 698 324 HOH HOH A . F 6 HOH 299 699 226 HOH HOH A . F 6 HOH 300 700 337 HOH HOH A . F 6 HOH 301 701 149 HOH HOH A . F 6 HOH 302 702 95 HOH HOH A . F 6 HOH 303 703 256 HOH HOH A . F 6 HOH 304 704 59 HOH HOH A . F 6 HOH 305 705 133 HOH HOH A . F 6 HOH 306 706 199 HOH HOH A . F 6 HOH 307 707 171 HOH HOH A . F 6 HOH 308 708 239 HOH HOH A . F 6 HOH 309 709 382 HOH HOH A . F 6 HOH 310 710 351 HOH HOH A . F 6 HOH 311 711 195 HOH HOH A . F 6 HOH 312 712 257 HOH HOH A . F 6 HOH 313 713 218 HOH HOH A . F 6 HOH 314 714 333 HOH HOH A . F 6 HOH 315 715 238 HOH HOH A . F 6 HOH 316 716 259 HOH HOH A . F 6 HOH 317 717 173 HOH HOH A . F 6 HOH 318 718 42 HOH HOH A . F 6 HOH 319 719 281 HOH HOH A . F 6 HOH 320 720 365 HOH HOH A . F 6 HOH 321 721 180 HOH HOH A . F 6 HOH 322 722 278 HOH HOH A . F 6 HOH 323 723 184 HOH HOH A . F 6 HOH 324 724 177 HOH HOH A . F 6 HOH 325 725 243 HOH HOH A . F 6 HOH 326 726 296 HOH HOH A . F 6 HOH 327 727 280 HOH HOH A . F 6 HOH 328 728 347 HOH HOH A . F 6 HOH 329 729 285 HOH HOH A . F 6 HOH 330 730 336 HOH HOH A . F 6 HOH 331 731 368 HOH HOH A . F 6 HOH 332 732 168 HOH HOH A . F 6 HOH 333 733 204 HOH HOH A . F 6 HOH 334 734 343 HOH HOH A . F 6 HOH 335 735 153 HOH HOH A . F 6 HOH 336 736 265 HOH HOH A . F 6 HOH 337 737 357 HOH HOH A . F 6 HOH 338 738 303 HOH HOH A . F 6 HOH 339 739 372 HOH HOH A . F 6 HOH 340 740 332 HOH HOH A . F 6 HOH 341 741 111 HOH HOH A . F 6 HOH 342 742 286 HOH HOH A . F 6 HOH 343 743 237 HOH HOH A . F 6 HOH 344 744 170 HOH HOH A . F 6 HOH 345 745 201 HOH HOH A . F 6 HOH 346 746 356 HOH HOH A . F 6 HOH 347 747 319 HOH HOH A . F 6 HOH 348 748 366 HOH HOH A . F 6 HOH 349 749 248 HOH HOH A . F 6 HOH 350 750 205 HOH HOH A . F 6 HOH 351 751 215 HOH HOH A . F 6 HOH 352 752 140 HOH HOH A . F 6 HOH 353 753 326 HOH HOH A . F 6 HOH 354 754 267 HOH HOH A . F 6 HOH 355 755 276 HOH HOH A . F 6 HOH 356 756 334 HOH HOH A . F 6 HOH 357 757 166 HOH HOH A . F 6 HOH 358 758 322 HOH HOH A . F 6 HOH 359 759 311 HOH HOH A . F 6 HOH 360 760 358 HOH HOH A . F 6 HOH 361 761 392 HOH HOH A . F 6 HOH 362 762 147 HOH HOH A . F 6 HOH 363 763 291 HOH HOH A . F 6 HOH 364 764 219 HOH HOH A . F 6 HOH 365 765 235 HOH HOH A . F 6 HOH 366 766 379 HOH HOH A . F 6 HOH 367 767 260 HOH HOH A . F 6 HOH 368 768 369 HOH HOH A . F 6 HOH 369 769 386 HOH HOH A . F 6 HOH 370 770 110 HOH HOH A . F 6 HOH 371 771 390 HOH HOH A . F 6 HOH 372 772 376 HOH HOH A . F 6 HOH 373 773 384 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 9 ? CG ? A GLN 9 CG 2 1 Y 1 A GLN 9 ? CD ? A GLN 9 CD 3 1 Y 1 A GLN 9 ? OE1 ? A GLN 9 OE1 4 1 Y 1 A GLN 9 ? NE2 ? A GLN 9 NE2 5 1 Y 1 A LYS 226 ? NZ ? A LYS 226 NZ 6 1 Y 1 A ASN 240 ? CG ? A ASN 240 CG 7 1 Y 1 A ASN 240 ? OD1 ? A ASN 240 OD1 8 1 Y 1 A ASN 240 ? ND2 ? A ASN 240 ND2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7ZNV _cell.details ? _cell.formula_units_Z ? _cell.length_a 50.851 _cell.length_a_esd ? _cell.length_b 74.168 _cell.length_b_esd ? _cell.length_c 154.535 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7ZNV _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7ZNV _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.75 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 55.30 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.15 M KSCN, 25% (w/v) PEG 2000 MME' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 120 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-05-04 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.915870 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.915870 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04-1 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate 11 _reflns.entry_id 7ZNV _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.21 _reflns.d_resolution_low 77.27 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 89172 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.7 _reflns.pdbx_Rmerge_I_obs 0.04 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 23.6 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.02 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.00 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.21 _reflns_shell.d_res_low 1.23 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.8 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 4348 _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.43 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.28 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.92 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 0.9500 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] -0.0000 _refine.aniso_B[2][2] -0.0800 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] -0.8700 _refine.B_iso_max 60.600 _refine.B_iso_mean 14.5800 _refine.B_iso_min 7.960 _refine.correlation_coeff_Fo_to_Fc 0.9760 _refine.correlation_coeff_Fo_to_Fc_free 0.9690 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7ZNV _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.2100 _refine.ls_d_res_low 77.2700 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 84702 _refine.ls_number_reflns_R_free 4405 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9100 _refine.ls_percent_reflns_R_free 4.9000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1494 _refine.ls_R_factor_R_free 0.1650 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1485 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5FUJ _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.0320 _refine.pdbx_overall_ESU_R_Free 0.0340 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 0.4580 _refine.overall_SU_ML 0.0210 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.2100 _refine_hist.d_res_low 77.2700 _refine_hist.number_atoms_solvent 379 _refine_hist.number_atoms_total 2267 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 234 _refine_hist.pdbx_B_iso_mean_ligand 19.80 _refine_hist.pdbx_B_iso_mean_solvent 27.45 _refine_hist.pdbx_number_atoms_protein 1802 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 86 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.019 0.013 2014 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.015 1842 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 2.151 1.718 2791 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.625 1.623 4268 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.794 5.000 256 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 31.967 23.762 101 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 11.741 15.000 300 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 18.988 15.000 10 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.124 0.200 276 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.016 0.020 2337 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.015 0.020 456 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.2100 _refine_ls_shell.d_res_low 1.2410 _refine_ls_shell.number_reflns_all 6509 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 340 _refine_ls_shell.number_reflns_R_work 6169 _refine_ls_shell.percent_reflns_obs 99.8600 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2250 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.2110 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7ZNV _struct.title 'Artificial Unspecific Peroxygenase expressed in Pichia pastoris at 1.21 Angstrom resolution' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7ZNV _struct_keywords.text 'Heme, peroxygenase, UPO, OXIDOREDUCTASE' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 6 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 7ZNV _struct_ref.pdbx_db_accession 7ZNV _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7ZNV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 241 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 7ZNV _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 241 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 241 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5600 ? 1 MORE -71 ? 1 'SSA (A^2)' 20080 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 3_554 -x,y,-z-1/2 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -77.2675000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 CYS A 24 ? HIS A 33 ? CYS A 24 HIS A 33 1 ? 10 HELX_P HELX_P2 AA2 THR A 44 ? ASN A 57 ? THR A 44 ASN A 57 1 ? 14 HELX_P HELX_P3 AA3 GLN A 59 ? LEU A 72 ? GLN A 59 LEU A 72 1 ? 14 HELX_P HELX_P4 AA4 LEU A 82 ? LEU A 87 ? LEU A 82 LEU A 87 5 ? 6 HELX_P HELX_P5 AA5 ASN A 111 ? ASN A 120 ? ASN A 111 ASN A 120 1 ? 10 HELX_P HELX_P6 AA6 ASN A 129 ? ASN A 148 ? ASN A 129 ASN A 148 1 ? 20 HELX_P HELX_P7 AA7 THR A 154 ? GLY A 173 ? THR A 154 GLY A 173 1 ? 20 HELX_P HELX_P8 AA8 LYS A 182 ? GLU A 192 ? LYS A 182 GLU A 192 1 ? 11 HELX_P HELX_P9 AA9 THR A 208 ? ALA A 222 ? THR A 208 ALA A 222 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 232 SG ? ? ? 1_555 A CYS 232 SG ? ? A CYS 232 A CYS 232 3_554 ? ? ? ? ? ? ? 2.178 ? ? covale1 covale one ? A ASN 129 ND2 ? ? ? 1_555 B NAG . C1 ? ? A ASN 129 B NAG 1 1_555 ? ? ? ? ? ? ? 1.410 ? N-Glycosylation covale2 covale one ? A ASN 174 ND2 ? ? ? 1_555 D NAG . C1 ? ? A ASN 174 A NAG 302 1_555 ? ? ? ? ? ? ? 1.462 ? N-Glycosylation covale3 covale both ? B NAG . O4 ? ? ? 1_555 B NAG . C1 ? ? B NAG 1 B NAG 2 1_555 ? ? ? ? ? ? ? 1.451 ? ? metalc1 metalc ? ? A CYS 24 SG ? ? ? 1_555 C HEM . FE ? ? A CYS 24 A HEM 301 1_555 ? ? ? ? ? ? ? 2.340 ? ? metalc2 metalc ? ? A GLU 92 OE2 ? ? ? 1_555 E MG . MG ? ? A GLU 92 A MG 303 1_555 ? ? ? ? ? ? ? 2.061 ? ? metalc3 metalc ? ? A HIS 93 O ? ? ? 1_555 E MG . MG ? ? A HIS 93 A MG 303 1_555 ? ? ? ? ? ? ? 2.123 ? ? metalc4 metalc ? ? A SER 96 OG ? ? ? 1_555 E MG . MG ? ? A SER 96 A MG 303 1_555 ? ? ? ? ? ? ? 2.135 ? ? metalc5 metalc ? ? C HEM . O1D ? ? ? 1_555 E MG . MG ? ? A HEM 301 A MG 303 1_555 ? ? ? ? ? ? ? 2.113 ? ? metalc6 metalc ? ? C HEM . FE ? ? ? 1_555 F HOH . O ? ? A HEM 301 A HOH 441 1_555 ? ? ? ? ? ? ? 2.004 ? ? metalc7 metalc ? ? E MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 303 A HOH 511 1_555 ? ? ? ? ? ? ? 2.086 ? ? metalc8 metalc ? ? E MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 303 A HOH 535 1_555 ? ? ? ? ? ? ? 2.073 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 24 ? A CYS 24 ? 1_555 FE ? C HEM . ? A HEM 301 ? 1_555 NA ? C HEM . ? A HEM 301 ? 1_555 88.0 ? 2 SG ? A CYS 24 ? A CYS 24 ? 1_555 FE ? C HEM . ? A HEM 301 ? 1_555 NB ? C HEM . ? A HEM 301 ? 1_555 83.4 ? 3 NA ? C HEM . ? A HEM 301 ? 1_555 FE ? C HEM . ? A HEM 301 ? 1_555 NB ? C HEM . ? A HEM 301 ? 1_555 88.9 ? 4 SG ? A CYS 24 ? A CYS 24 ? 1_555 FE ? C HEM . ? A HEM 301 ? 1_555 NC ? C HEM . ? A HEM 301 ? 1_555 89.8 ? 5 NA ? C HEM . ? A HEM 301 ? 1_555 FE ? C HEM . ? A HEM 301 ? 1_555 NC ? C HEM . ? A HEM 301 ? 1_555 176.8 ? 6 NB ? C HEM . ? A HEM 301 ? 1_555 FE ? C HEM . ? A HEM 301 ? 1_555 NC ? C HEM . ? A HEM 301 ? 1_555 88.4 ? 7 SG ? A CYS 24 ? A CYS 24 ? 1_555 FE ? C HEM . ? A HEM 301 ? 1_555 ND ? C HEM . ? A HEM 301 ? 1_555 94.5 ? 8 NA ? C HEM . ? A HEM 301 ? 1_555 FE ? C HEM . ? A HEM 301 ? 1_555 ND ? C HEM . ? A HEM 301 ? 1_555 91.9 ? 9 NB ? C HEM . ? A HEM 301 ? 1_555 FE ? C HEM . ? A HEM 301 ? 1_555 ND ? C HEM . ? A HEM 301 ? 1_555 177.6 ? 10 NC ? C HEM . ? A HEM 301 ? 1_555 FE ? C HEM . ? A HEM 301 ? 1_555 ND ? C HEM . ? A HEM 301 ? 1_555 90.6 ? 11 SG ? A CYS 24 ? A CYS 24 ? 1_555 FE ? C HEM . ? A HEM 301 ? 1_555 O ? F HOH . ? A HOH 441 ? 1_555 178.9 ? 12 NA ? C HEM . ? A HEM 301 ? 1_555 FE ? C HEM . ? A HEM 301 ? 1_555 O ? F HOH . ? A HOH 441 ? 1_555 91.3 ? 13 NB ? C HEM . ? A HEM 301 ? 1_555 FE ? C HEM . ? A HEM 301 ? 1_555 O ? F HOH . ? A HOH 441 ? 1_555 95.7 ? 14 NC ? C HEM . ? A HEM 301 ? 1_555 FE ? C HEM . ? A HEM 301 ? 1_555 O ? F HOH . ? A HOH 441 ? 1_555 90.8 ? 15 ND ? C HEM . ? A HEM 301 ? 1_555 FE ? C HEM . ? A HEM 301 ? 1_555 O ? F HOH . ? A HOH 441 ? 1_555 86.5 ? 16 OE2 ? A GLU 92 ? A GLU 92 ? 1_555 MG ? E MG . ? A MG 303 ? 1_555 O ? A HIS 93 ? A HIS 93 ? 1_555 84.0 ? 17 OE2 ? A GLU 92 ? A GLU 92 ? 1_555 MG ? E MG . ? A MG 303 ? 1_555 OG ? A SER 96 ? A SER 96 ? 1_555 176.6 ? 18 O ? A HIS 93 ? A HIS 93 ? 1_555 MG ? E MG . ? A MG 303 ? 1_555 OG ? A SER 96 ? A SER 96 ? 1_555 93.5 ? 19 OE2 ? A GLU 92 ? A GLU 92 ? 1_555 MG ? E MG . ? A MG 303 ? 1_555 O1D ? C HEM . ? A HEM 301 ? 1_555 99.9 ? 20 O ? A HIS 93 ? A HIS 93 ? 1_555 MG ? E MG . ? A MG 303 ? 1_555 O1D ? C HEM . ? A HEM 301 ? 1_555 87.0 ? 21 OG ? A SER 96 ? A SER 96 ? 1_555 MG ? E MG . ? A MG 303 ? 1_555 O1D ? C HEM . ? A HEM 301 ? 1_555 82.3 ? 22 OE2 ? A GLU 92 ? A GLU 92 ? 1_555 MG ? E MG . ? A MG 303 ? 1_555 O ? F HOH . ? A HOH 511 ? 1_555 89.2 ? 23 O ? A HIS 93 ? A HIS 93 ? 1_555 MG ? E MG . ? A MG 303 ? 1_555 O ? F HOH . ? A HOH 511 ? 1_555 89.9 ? 24 OG ? A SER 96 ? A SER 96 ? 1_555 MG ? E MG . ? A MG 303 ? 1_555 O ? F HOH . ? A HOH 511 ? 1_555 88.5 ? 25 O1D ? C HEM . ? A HEM 301 ? 1_555 MG ? E MG . ? A MG 303 ? 1_555 O ? F HOH . ? A HOH 511 ? 1_555 170.0 ? 26 OE2 ? A GLU 92 ? A GLU 92 ? 1_555 MG ? E MG . ? A MG 303 ? 1_555 O ? F HOH . ? A HOH 535 ? 1_555 90.0 ? 27 O ? A HIS 93 ? A HIS 93 ? 1_555 MG ? E MG . ? A MG 303 ? 1_555 O ? F HOH . ? A HOH 535 ? 1_555 173.0 ? 28 OG ? A SER 96 ? A SER 96 ? 1_555 MG ? E MG . ? A MG 303 ? 1_555 O ? F HOH . ? A HOH 535 ? 1_555 92.6 ? 29 O1D ? C HEM . ? A HEM 301 ? 1_555 MG ? E MG . ? A MG 303 ? 1_555 O ? F HOH . ? A HOH 535 ? 1_555 90.3 ? 30 O ? F HOH . ? A HOH 511 ? 1_555 MG ? E MG . ? A MG 303 ? 1_555 O ? F HOH . ? A HOH 535 ? 1_555 93.8 ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 127 ? TYR A 128 ? VAL A 127 TYR A 128 AA1 2 ALA A 180 ? PRO A 181 ? ALA A 180 PRO A 181 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id TYR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 128 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 128 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ALA _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 180 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ALA _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 180 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 ND2 A ASN 42 ? B O A HOH 401 ? ? 2.04 2 1 O A HOH 562 ? ? O A HOH 665 ? ? 2.14 3 1 O A HOH 596 ? ? O A HOH 626 ? ? 2.15 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 61 ? B -62.12 20.72 2 1 ILE A 62 ? ? -163.21 -32.10 3 1 ASP A 78 ? ? -146.29 15.46 4 1 THR A 90 ? ? -83.65 -76.09 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 580 ? F HOH . 2 1 A HOH 711 ? F HOH . # _pdbx_entry_details.entry_id 7ZNV _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 1 ? A SER 1 2 1 Y 1 A GLN 2 ? A GLN 2 3 1 Y 1 A ASP 3 ? A ASP 3 4 1 Y 1 A ILE 4 ? A ILE 4 5 1 Y 1 A VAL 5 ? A VAL 5 6 1 Y 1 A ASP 6 ? A ASP 6 7 1 Y 1 A PHE 7 ? A PHE 7 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HEM CHA C N N 137 HEM CHB C N N 138 HEM CHC C N N 139 HEM CHD C N N 140 HEM C1A C Y N 141 HEM C2A C Y N 142 HEM C3A C Y N 143 HEM C4A C Y N 144 HEM CMA C N N 145 HEM CAA C N N 146 HEM CBA C N N 147 HEM CGA C N N 148 HEM O1A O N N 149 HEM O2A O N N 150 HEM C1B C N N 151 HEM C2B C N N 152 HEM C3B C N N 153 HEM C4B C N N 154 HEM CMB C N N 155 HEM CAB C N N 156 HEM CBB C N N 157 HEM C1C C Y N 158 HEM C2C C Y N 159 HEM C3C C Y N 160 HEM C4C C Y N 161 HEM CMC C N N 162 HEM CAC C N N 163 HEM CBC C N N 164 HEM C1D C N N 165 HEM C2D C N N 166 HEM C3D C N N 167 HEM C4D C N N 168 HEM CMD C N N 169 HEM CAD C N N 170 HEM CBD C N N 171 HEM CGD C N N 172 HEM O1D O N N 173 HEM O2D O N N 174 HEM NA N Y N 175 HEM NB N N N 176 HEM NC N Y N 177 HEM ND N N N 178 HEM FE FE N N 179 HEM HHB H N N 180 HEM HHC H N N 181 HEM HHD H N N 182 HEM HMA H N N 183 HEM HMAA H N N 184 HEM HMAB H N N 185 HEM HAA H N N 186 HEM HAAA H N N 187 HEM HBA H N N 188 HEM HBAA H N N 189 HEM HMB H N N 190 HEM HMBA H N N 191 HEM HMBB H N N 192 HEM HAB H N N 193 HEM HBB H N N 194 HEM HBBA H N N 195 HEM HMC H N N 196 HEM HMCA H N N 197 HEM HMCB H N N 198 HEM HAC H N N 199 HEM HBC H N N 200 HEM HBCA H N N 201 HEM HMD H N N 202 HEM HMDA H N N 203 HEM HMDB H N N 204 HEM HAD H N N 205 HEM HADA H N N 206 HEM HBD H N N 207 HEM HBDA H N N 208 HEM H2A H N N 209 HEM H2D H N N 210 HEM HHA H N N 211 HIS N N N N 212 HIS CA C N S 213 HIS C C N N 214 HIS O O N N 215 HIS CB C N N 216 HIS CG C Y N 217 HIS ND1 N Y N 218 HIS CD2 C Y N 219 HIS CE1 C Y N 220 HIS NE2 N Y N 221 HIS OXT O N N 222 HIS H H N N 223 HIS H2 H N N 224 HIS HA H N N 225 HIS HB2 H N N 226 HIS HB3 H N N 227 HIS HD1 H N N 228 HIS HD2 H N N 229 HIS HE1 H N N 230 HIS HE2 H N N 231 HIS HXT H N N 232 HOH O O N N 233 HOH H1 H N N 234 HOH H2 H N N 235 ILE N N N N 236 ILE CA C N S 237 ILE C C N N 238 ILE O O N N 239 ILE CB C N S 240 ILE CG1 C N N 241 ILE CG2 C N N 242 ILE CD1 C N N 243 ILE OXT O N N 244 ILE H H N N 245 ILE H2 H N N 246 ILE HA H N N 247 ILE HB H N N 248 ILE HG12 H N N 249 ILE HG13 H N N 250 ILE HG21 H N N 251 ILE HG22 H N N 252 ILE HG23 H N N 253 ILE HD11 H N N 254 ILE HD12 H N N 255 ILE HD13 H N N 256 ILE HXT H N N 257 LEU N N N N 258 LEU CA C N S 259 LEU C C N N 260 LEU O O N N 261 LEU CB C N N 262 LEU CG C N N 263 LEU CD1 C N N 264 LEU CD2 C N N 265 LEU OXT O N N 266 LEU H H N N 267 LEU H2 H N N 268 LEU HA H N N 269 LEU HB2 H N N 270 LEU HB3 H N N 271 LEU HG H N N 272 LEU HD11 H N N 273 LEU HD12 H N N 274 LEU HD13 H N N 275 LEU HD21 H N N 276 LEU HD22 H N N 277 LEU HD23 H N N 278 LEU HXT H N N 279 LYS N N N N 280 LYS CA C N S 281 LYS C C N N 282 LYS O O N N 283 LYS CB C N N 284 LYS CG C N N 285 LYS CD C N N 286 LYS CE C N N 287 LYS NZ N N N 288 LYS OXT O N N 289 LYS H H N N 290 LYS H2 H N N 291 LYS HA H N N 292 LYS HB2 H N N 293 LYS HB3 H N N 294 LYS HG2 H N N 295 LYS HG3 H N N 296 LYS HD2 H N N 297 LYS HD3 H N N 298 LYS HE2 H N N 299 LYS HE3 H N N 300 LYS HZ1 H N N 301 LYS HZ2 H N N 302 LYS HZ3 H N N 303 LYS HXT H N N 304 MET N N N N 305 MET CA C N S 306 MET C C N N 307 MET O O N N 308 MET CB C N N 309 MET CG C N N 310 MET SD S N N 311 MET CE C N N 312 MET OXT O N N 313 MET H H N N 314 MET H2 H N N 315 MET HA H N N 316 MET HB2 H N N 317 MET HB3 H N N 318 MET HG2 H N N 319 MET HG3 H N N 320 MET HE1 H N N 321 MET HE2 H N N 322 MET HE3 H N N 323 MET HXT H N N 324 MG MG MG N N 325 NAG C1 C N R 326 NAG C2 C N R 327 NAG C3 C N R 328 NAG C4 C N S 329 NAG C5 C N R 330 NAG C6 C N N 331 NAG C7 C N N 332 NAG C8 C N N 333 NAG N2 N N N 334 NAG O1 O N N 335 NAG O3 O N N 336 NAG O4 O N N 337 NAG O5 O N N 338 NAG O6 O N N 339 NAG O7 O N N 340 NAG H1 H N N 341 NAG H2 H N N 342 NAG H3 H N N 343 NAG H4 H N N 344 NAG H5 H N N 345 NAG H61 H N N 346 NAG H62 H N N 347 NAG H81 H N N 348 NAG H82 H N N 349 NAG H83 H N N 350 NAG HN2 H N N 351 NAG HO1 H N N 352 NAG HO3 H N N 353 NAG HO4 H N N 354 NAG HO6 H N N 355 PHE N N N N 356 PHE CA C N S 357 PHE C C N N 358 PHE O O N N 359 PHE CB C N N 360 PHE CG C Y N 361 PHE CD1 C Y N 362 PHE CD2 C Y N 363 PHE CE1 C Y N 364 PHE CE2 C Y N 365 PHE CZ C Y N 366 PHE OXT O N N 367 PHE H H N N 368 PHE H2 H N N 369 PHE HA H N N 370 PHE HB2 H N N 371 PHE HB3 H N N 372 PHE HD1 H N N 373 PHE HD2 H N N 374 PHE HE1 H N N 375 PHE HE2 H N N 376 PHE HZ H N N 377 PHE HXT H N N 378 PRO N N N N 379 PRO CA C N S 380 PRO C C N N 381 PRO O O N N 382 PRO CB C N N 383 PRO CG C N N 384 PRO CD C N N 385 PRO OXT O N N 386 PRO H H N N 387 PRO HA H N N 388 PRO HB2 H N N 389 PRO HB3 H N N 390 PRO HG2 H N N 391 PRO HG3 H N N 392 PRO HD2 H N N 393 PRO HD3 H N N 394 PRO HXT H N N 395 SER N N N N 396 SER CA C N S 397 SER C C N N 398 SER O O N N 399 SER CB C N N 400 SER OG O N N 401 SER OXT O N N 402 SER H H N N 403 SER H2 H N N 404 SER HA H N N 405 SER HB2 H N N 406 SER HB3 H N N 407 SER HG H N N 408 SER HXT H N N 409 THR N N N N 410 THR CA C N S 411 THR C C N N 412 THR O O N N 413 THR CB C N R 414 THR OG1 O N N 415 THR CG2 C N N 416 THR OXT O N N 417 THR H H N N 418 THR H2 H N N 419 THR HA H N N 420 THR HB H N N 421 THR HG1 H N N 422 THR HG21 H N N 423 THR HG22 H N N 424 THR HG23 H N N 425 THR HXT H N N 426 TRP N N N N 427 TRP CA C N S 428 TRP C C N N 429 TRP O O N N 430 TRP CB C N N 431 TRP CG C Y N 432 TRP CD1 C Y N 433 TRP CD2 C Y N 434 TRP NE1 N Y N 435 TRP CE2 C Y N 436 TRP CE3 C Y N 437 TRP CZ2 C Y N 438 TRP CZ3 C Y N 439 TRP CH2 C Y N 440 TRP OXT O N N 441 TRP H H N N 442 TRP H2 H N N 443 TRP HA H N N 444 TRP HB2 H N N 445 TRP HB3 H N N 446 TRP HD1 H N N 447 TRP HE1 H N N 448 TRP HE3 H N N 449 TRP HZ2 H N N 450 TRP HZ3 H N N 451 TRP HH2 H N N 452 TRP HXT H N N 453 TYR N N N N 454 TYR CA C N S 455 TYR C C N N 456 TYR O O N N 457 TYR CB C N N 458 TYR CG C Y N 459 TYR CD1 C Y N 460 TYR CD2 C Y N 461 TYR CE1 C Y N 462 TYR CE2 C Y N 463 TYR CZ C Y N 464 TYR OH O N N 465 TYR OXT O N N 466 TYR H H N N 467 TYR H2 H N N 468 TYR HA H N N 469 TYR HB2 H N N 470 TYR HB3 H N N 471 TYR HD1 H N N 472 TYR HD2 H N N 473 TYR HE1 H N N 474 TYR HE2 H N N 475 TYR HH H N N 476 TYR HXT H N N 477 VAL N N N N 478 VAL CA C N S 479 VAL C C N N 480 VAL O O N N 481 VAL CB C N N 482 VAL CG1 C N N 483 VAL CG2 C N N 484 VAL OXT O N N 485 VAL H H N N 486 VAL H2 H N N 487 VAL HA H N N 488 VAL HB H N N 489 VAL HG11 H N N 490 VAL HG12 H N N 491 VAL HG13 H N N 492 VAL HG21 H N N 493 VAL HG22 H N N 494 VAL HG23 H N N 495 VAL HXT H N N 496 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HEM CHA C1A sing N N 129 HEM CHA C4D doub N N 130 HEM CHA HHA sing N N 131 HEM CHB C4A sing N N 132 HEM CHB C1B doub N N 133 HEM CHB HHB sing N N 134 HEM CHC C4B sing N N 135 HEM CHC C1C doub N N 136 HEM CHC HHC sing N N 137 HEM CHD C4C doub N N 138 HEM CHD C1D sing N N 139 HEM CHD HHD sing N N 140 HEM C1A C2A doub Y N 141 HEM C1A NA sing Y N 142 HEM C2A C3A sing Y N 143 HEM C2A CAA sing N N 144 HEM C3A C4A doub Y N 145 HEM C3A CMA sing N N 146 HEM C4A NA sing Y N 147 HEM CMA HMA sing N N 148 HEM CMA HMAA sing N N 149 HEM CMA HMAB sing N N 150 HEM CAA CBA sing N N 151 HEM CAA HAA sing N N 152 HEM CAA HAAA sing N N 153 HEM CBA CGA sing N N 154 HEM CBA HBA sing N N 155 HEM CBA HBAA sing N N 156 HEM CGA O1A doub N N 157 HEM CGA O2A sing N N 158 HEM C1B C2B sing N N 159 HEM C1B NB sing N N 160 HEM C2B C3B doub N N 161 HEM C2B CMB sing N N 162 HEM C3B C4B sing N N 163 HEM C3B CAB sing N N 164 HEM C4B NB doub N N 165 HEM CMB HMB sing N N 166 HEM CMB HMBA sing N N 167 HEM CMB HMBB sing N N 168 HEM CAB CBB doub N N 169 HEM CAB HAB sing N N 170 HEM CBB HBB sing N N 171 HEM CBB HBBA sing N N 172 HEM C1C C2C sing Y N 173 HEM C1C NC sing Y N 174 HEM C2C C3C doub Y N 175 HEM C2C CMC sing N N 176 HEM C3C C4C sing Y N 177 HEM C3C CAC sing N N 178 HEM C4C NC sing Y N 179 HEM CMC HMC sing N N 180 HEM CMC HMCA sing N N 181 HEM CMC HMCB sing N N 182 HEM CAC CBC doub N N 183 HEM CAC HAC sing N N 184 HEM CBC HBC sing N N 185 HEM CBC HBCA sing N N 186 HEM C1D C2D sing N N 187 HEM C1D ND doub N N 188 HEM C2D C3D doub N N 189 HEM C2D CMD sing N N 190 HEM C3D C4D sing N N 191 HEM C3D CAD sing N N 192 HEM C4D ND sing N N 193 HEM CMD HMD sing N N 194 HEM CMD HMDA sing N N 195 HEM CMD HMDB sing N N 196 HEM CAD CBD sing N N 197 HEM CAD HAD sing N N 198 HEM CAD HADA sing N N 199 HEM CBD CGD sing N N 200 HEM CBD HBD sing N N 201 HEM CBD HBDA sing N N 202 HEM CGD O1D doub N N 203 HEM CGD O2D sing N N 204 HEM O2A H2A sing N N 205 HEM O2D H2D sing N N 206 HEM FE NA sing N N 207 HEM FE NB sing N N 208 HEM FE NC sing N N 209 HEM FE ND sing N N 210 HIS N CA sing N N 211 HIS N H sing N N 212 HIS N H2 sing N N 213 HIS CA C sing N N 214 HIS CA CB sing N N 215 HIS CA HA sing N N 216 HIS C O doub N N 217 HIS C OXT sing N N 218 HIS CB CG sing N N 219 HIS CB HB2 sing N N 220 HIS CB HB3 sing N N 221 HIS CG ND1 sing Y N 222 HIS CG CD2 doub Y N 223 HIS ND1 CE1 doub Y N 224 HIS ND1 HD1 sing N N 225 HIS CD2 NE2 sing Y N 226 HIS CD2 HD2 sing N N 227 HIS CE1 NE2 sing Y N 228 HIS CE1 HE1 sing N N 229 HIS NE2 HE2 sing N N 230 HIS OXT HXT sing N N 231 HOH O H1 sing N N 232 HOH O H2 sing N N 233 ILE N CA sing N N 234 ILE N H sing N N 235 ILE N H2 sing N N 236 ILE CA C sing N N 237 ILE CA CB sing N N 238 ILE CA HA sing N N 239 ILE C O doub N N 240 ILE C OXT sing N N 241 ILE CB CG1 sing N N 242 ILE CB CG2 sing N N 243 ILE CB HB sing N N 244 ILE CG1 CD1 sing N N 245 ILE CG1 HG12 sing N N 246 ILE CG1 HG13 sing N N 247 ILE CG2 HG21 sing N N 248 ILE CG2 HG22 sing N N 249 ILE CG2 HG23 sing N N 250 ILE CD1 HD11 sing N N 251 ILE CD1 HD12 sing N N 252 ILE CD1 HD13 sing N N 253 ILE OXT HXT sing N N 254 LEU N CA sing N N 255 LEU N H sing N N 256 LEU N H2 sing N N 257 LEU CA C sing N N 258 LEU CA CB sing N N 259 LEU CA HA sing N N 260 LEU C O doub N N 261 LEU C OXT sing N N 262 LEU CB CG sing N N 263 LEU CB HB2 sing N N 264 LEU CB HB3 sing N N 265 LEU CG CD1 sing N N 266 LEU CG CD2 sing N N 267 LEU CG HG sing N N 268 LEU CD1 HD11 sing N N 269 LEU CD1 HD12 sing N N 270 LEU CD1 HD13 sing N N 271 LEU CD2 HD21 sing N N 272 LEU CD2 HD22 sing N N 273 LEU CD2 HD23 sing N N 274 LEU OXT HXT sing N N 275 LYS N CA sing N N 276 LYS N H sing N N 277 LYS N H2 sing N N 278 LYS CA C sing N N 279 LYS CA CB sing N N 280 LYS CA HA sing N N 281 LYS C O doub N N 282 LYS C OXT sing N N 283 LYS CB CG sing N N 284 LYS CB HB2 sing N N 285 LYS CB HB3 sing N N 286 LYS CG CD sing N N 287 LYS CG HG2 sing N N 288 LYS CG HG3 sing N N 289 LYS CD CE sing N N 290 LYS CD HD2 sing N N 291 LYS CD HD3 sing N N 292 LYS CE NZ sing N N 293 LYS CE HE2 sing N N 294 LYS CE HE3 sing N N 295 LYS NZ HZ1 sing N N 296 LYS NZ HZ2 sing N N 297 LYS NZ HZ3 sing N N 298 LYS OXT HXT sing N N 299 MET N CA sing N N 300 MET N H sing N N 301 MET N H2 sing N N 302 MET CA C sing N N 303 MET CA CB sing N N 304 MET CA HA sing N N 305 MET C O doub N N 306 MET C OXT sing N N 307 MET CB CG sing N N 308 MET CB HB2 sing N N 309 MET CB HB3 sing N N 310 MET CG SD sing N N 311 MET CG HG2 sing N N 312 MET CG HG3 sing N N 313 MET SD CE sing N N 314 MET CE HE1 sing N N 315 MET CE HE2 sing N N 316 MET CE HE3 sing N N 317 MET OXT HXT sing N N 318 NAG C1 C2 sing N N 319 NAG C1 O1 sing N N 320 NAG C1 O5 sing N N 321 NAG C1 H1 sing N N 322 NAG C2 C3 sing N N 323 NAG C2 N2 sing N N 324 NAG C2 H2 sing N N 325 NAG C3 C4 sing N N 326 NAG C3 O3 sing N N 327 NAG C3 H3 sing N N 328 NAG C4 C5 sing N N 329 NAG C4 O4 sing N N 330 NAG C4 H4 sing N N 331 NAG C5 C6 sing N N 332 NAG C5 O5 sing N N 333 NAG C5 H5 sing N N 334 NAG C6 O6 sing N N 335 NAG C6 H61 sing N N 336 NAG C6 H62 sing N N 337 NAG C7 C8 sing N N 338 NAG C7 N2 sing N N 339 NAG C7 O7 doub N N 340 NAG C8 H81 sing N N 341 NAG C8 H82 sing N N 342 NAG C8 H83 sing N N 343 NAG N2 HN2 sing N N 344 NAG O1 HO1 sing N N 345 NAG O3 HO3 sing N N 346 NAG O4 HO4 sing N N 347 NAG O6 HO6 sing N N 348 PHE N CA sing N N 349 PHE N H sing N N 350 PHE N H2 sing N N 351 PHE CA C sing N N 352 PHE CA CB sing N N 353 PHE CA HA sing N N 354 PHE C O doub N N 355 PHE C OXT sing N N 356 PHE CB CG sing N N 357 PHE CB HB2 sing N N 358 PHE CB HB3 sing N N 359 PHE CG CD1 doub Y N 360 PHE CG CD2 sing Y N 361 PHE CD1 CE1 sing Y N 362 PHE CD1 HD1 sing N N 363 PHE CD2 CE2 doub Y N 364 PHE CD2 HD2 sing N N 365 PHE CE1 CZ doub Y N 366 PHE CE1 HE1 sing N N 367 PHE CE2 CZ sing Y N 368 PHE CE2 HE2 sing N N 369 PHE CZ HZ sing N N 370 PHE OXT HXT sing N N 371 PRO N CA sing N N 372 PRO N CD sing N N 373 PRO N H sing N N 374 PRO CA C sing N N 375 PRO CA CB sing N N 376 PRO CA HA sing N N 377 PRO C O doub N N 378 PRO C OXT sing N N 379 PRO CB CG sing N N 380 PRO CB HB2 sing N N 381 PRO CB HB3 sing N N 382 PRO CG CD sing N N 383 PRO CG HG2 sing N N 384 PRO CG HG3 sing N N 385 PRO CD HD2 sing N N 386 PRO CD HD3 sing N N 387 PRO OXT HXT sing N N 388 SER N CA sing N N 389 SER N H sing N N 390 SER N H2 sing N N 391 SER CA C sing N N 392 SER CA CB sing N N 393 SER CA HA sing N N 394 SER C O doub N N 395 SER C OXT sing N N 396 SER CB OG sing N N 397 SER CB HB2 sing N N 398 SER CB HB3 sing N N 399 SER OG HG sing N N 400 SER OXT HXT sing N N 401 THR N CA sing N N 402 THR N H sing N N 403 THR N H2 sing N N 404 THR CA C sing N N 405 THR CA CB sing N N 406 THR CA HA sing N N 407 THR C O doub N N 408 THR C OXT sing N N 409 THR CB OG1 sing N N 410 THR CB CG2 sing N N 411 THR CB HB sing N N 412 THR OG1 HG1 sing N N 413 THR CG2 HG21 sing N N 414 THR CG2 HG22 sing N N 415 THR CG2 HG23 sing N N 416 THR OXT HXT sing N N 417 TRP N CA sing N N 418 TRP N H sing N N 419 TRP N H2 sing N N 420 TRP CA C sing N N 421 TRP CA CB sing N N 422 TRP CA HA sing N N 423 TRP C O doub N N 424 TRP C OXT sing N N 425 TRP CB CG sing N N 426 TRP CB HB2 sing N N 427 TRP CB HB3 sing N N 428 TRP CG CD1 doub Y N 429 TRP CG CD2 sing Y N 430 TRP CD1 NE1 sing Y N 431 TRP CD1 HD1 sing N N 432 TRP CD2 CE2 doub Y N 433 TRP CD2 CE3 sing Y N 434 TRP NE1 CE2 sing Y N 435 TRP NE1 HE1 sing N N 436 TRP CE2 CZ2 sing Y N 437 TRP CE3 CZ3 doub Y N 438 TRP CE3 HE3 sing N N 439 TRP CZ2 CH2 doub Y N 440 TRP CZ2 HZ2 sing N N 441 TRP CZ3 CH2 sing Y N 442 TRP CZ3 HZ3 sing N N 443 TRP CH2 HH2 sing N N 444 TRP OXT HXT sing N N 445 TYR N CA sing N N 446 TYR N H sing N N 447 TYR N H2 sing N N 448 TYR CA C sing N N 449 TYR CA CB sing N N 450 TYR CA HA sing N N 451 TYR C O doub N N 452 TYR C OXT sing N N 453 TYR CB CG sing N N 454 TYR CB HB2 sing N N 455 TYR CB HB3 sing N N 456 TYR CG CD1 doub Y N 457 TYR CG CD2 sing Y N 458 TYR CD1 CE1 sing Y N 459 TYR CD1 HD1 sing N N 460 TYR CD2 CE2 doub Y N 461 TYR CD2 HD2 sing N N 462 TYR CE1 CZ doub Y N 463 TYR CE1 HE1 sing N N 464 TYR CE2 CZ sing Y N 465 TYR CE2 HE2 sing N N 466 TYR CZ OH sing N N 467 TYR OH HH sing N N 468 TYR OXT HXT sing N N 469 VAL N CA sing N N 470 VAL N H sing N N 471 VAL N H2 sing N N 472 VAL CA C sing N N 473 VAL CA CB sing N N 474 VAL CA HA sing N N 475 VAL C O doub N N 476 VAL C OXT sing N N 477 VAL CB CG1 sing N N 478 VAL CB CG2 sing N N 479 VAL CB HB sing N N 480 VAL CG1 HG11 sing N N 481 VAL CG1 HG12 sing N N 482 VAL CG1 HG13 sing N N 483 VAL CG2 HG21 sing N N 484 VAL CG2 HG22 sing N N 485 VAL CG2 HG23 sing N N 486 VAL OXT HXT sing N N 487 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 NAG 1 n 2 NAG 2 n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id HEM _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id HEM _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5FUJ _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7ZNV _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.019665 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013483 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006471 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C FE MG N O S # loop_