data_7ZQE # _entry.id 7ZQE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.362 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7ZQE pdb_00007zqe 10.2210/pdb7zqe/pdb WWPDB D_1292121108 ? ? EMDB EMD-14872 ? ? # _pdbx_database_related.db_name EMDB _pdbx_database_related.details 'Dimeric PSI of Chlamydomonas reinhardtii at 2.74 A resolution' _pdbx_database_related.db_id EMD-14872 _pdbx_database_related.content_type 'associated EM volume' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7ZQE _pdbx_database_status.recvd_initial_deposition_date 2022-04-29 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Naschberger, A.' 1 0000-0002-7275-5459 'Amunts, A.' 2 0000-0002-5302-1740 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Nat.Plants _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2055-0278 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 8 _citation.language ? _citation.page_first 1191 _citation.page_last 1201 _citation.title 'Algal photosystem I dimer and high-resolution model of PSI-plastocyanin complex.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41477-022-01253-4 _citation.pdbx_database_id_PubMed 36229605 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Naschberger, A.' 1 ? primary 'Mosebach, L.' 2 ? primary 'Tobiasson, V.' 3 ? primary 'Kuhlgert, S.' 4 ? primary 'Scholz, M.' 5 ? primary 'Perez-Boerema, A.' 6 ? primary 'Ho, T.T.H.' 7 ? primary 'Vidal-Meireles, A.' 8 ? primary 'Takahashi, Y.' 9 ? primary 'Hippler, M.' 10 ? primary 'Amunts, A.' 11 0000-0002-5302-1740 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 7ZQE _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.00 _cell.length_a_esd ? _cell.length_b 1.00 _cell.length_b_esd ? _cell.length_c 1.00 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 7ZQE _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat 'Plastocyanin, chloroplastic' 14889.784 1 ? ? ? ? 2 non-polymer syn 'COPPER (II) ION' 63.546 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name PC6-2 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKATLRAPASRASAVRPVASLKAAAQRVASVAGVSVASLALTLAAHADATVKLGADSGALEFVPKTLTIKSGETVNFVNN AGFPHNIVFDEDAIPSGVNADAISRDDYLNAPGETYSVKLTAAGEYGYYCEPHQGAGMVGKIIVQ ; _entity_poly.pdbx_seq_one_letter_code_can ;MKATLRAPASRASAVRPVASLKAAAQRVASVAGVSVASLALTLAAHADATVKLGADSGALEFVPKTLTIKSGETVNFVNN AGFPHNIVFDEDAIPSGVNADAISRDDYLNAPGETYSVKLTAAGEYGYYCEPHQGAGMVGKIIVQ ; _entity_poly.pdbx_strand_id M _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 ALA n 1 4 THR n 1 5 LEU n 1 6 ARG n 1 7 ALA n 1 8 PRO n 1 9 ALA n 1 10 SER n 1 11 ARG n 1 12 ALA n 1 13 SER n 1 14 ALA n 1 15 VAL n 1 16 ARG n 1 17 PRO n 1 18 VAL n 1 19 ALA n 1 20 SER n 1 21 LEU n 1 22 LYS n 1 23 ALA n 1 24 ALA n 1 25 ALA n 1 26 GLN n 1 27 ARG n 1 28 VAL n 1 29 ALA n 1 30 SER n 1 31 VAL n 1 32 ALA n 1 33 GLY n 1 34 VAL n 1 35 SER n 1 36 VAL n 1 37 ALA n 1 38 SER n 1 39 LEU n 1 40 ALA n 1 41 LEU n 1 42 THR n 1 43 LEU n 1 44 ALA n 1 45 ALA n 1 46 HIS n 1 47 ALA n 1 48 ASP n 1 49 ALA n 1 50 THR n 1 51 VAL n 1 52 LYS n 1 53 LEU n 1 54 GLY n 1 55 ALA n 1 56 ASP n 1 57 SER n 1 58 GLY n 1 59 ALA n 1 60 LEU n 1 61 GLU n 1 62 PHE n 1 63 VAL n 1 64 PRO n 1 65 LYS n 1 66 THR n 1 67 LEU n 1 68 THR n 1 69 ILE n 1 70 LYS n 1 71 SER n 1 72 GLY n 1 73 GLU n 1 74 THR n 1 75 VAL n 1 76 ASN n 1 77 PHE n 1 78 VAL n 1 79 ASN n 1 80 ASN n 1 81 ALA n 1 82 GLY n 1 83 PHE n 1 84 PRO n 1 85 HIS n 1 86 ASN n 1 87 ILE n 1 88 VAL n 1 89 PHE n 1 90 ASP n 1 91 GLU n 1 92 ASP n 1 93 ALA n 1 94 ILE n 1 95 PRO n 1 96 SER n 1 97 GLY n 1 98 VAL n 1 99 ASN n 1 100 ALA n 1 101 ASP n 1 102 ALA n 1 103 ILE n 1 104 SER n 1 105 ARG n 1 106 ASP n 1 107 ASP n 1 108 TYR n 1 109 LEU n 1 110 ASN n 1 111 ALA n 1 112 PRO n 1 113 GLY n 1 114 GLU n 1 115 THR n 1 116 TYR n 1 117 SER n 1 118 VAL n 1 119 LYS n 1 120 LEU n 1 121 THR n 1 122 ALA n 1 123 ALA n 1 124 GLY n 1 125 GLU n 1 126 TYR n 1 127 GLY n 1 128 TYR n 1 129 TYR n 1 130 CYS n 1 131 GLU n 1 132 PRO n 1 133 HIS n 1 134 GLN n 1 135 GLY n 1 136 ALA n 1 137 GLY n 1 138 MET n 1 139 VAL n 1 140 GLY n 1 141 LYS n 1 142 ILE n 1 143 ILE n 1 144 VAL n 1 145 GLN n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num 1 _entity_src_nat.pdbx_end_seq_num 145 _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Chlamydomonas reinhardtii' _entity_src_nat.pdbx_ncbi_taxonomy_id 3055 _entity_src_nat.genus ? _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PLAS_CHLRE _struct_ref.pdbx_db_accession P18068 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKATLRAPASRASAVRPVASLKAAAQRVASVAGVSVASLALTLAAHADATVKLGADSGALEFVPKTLTIKSGETVNFVNN AGFPHNIVFDEDAIPSGVNADAISRDDYLNAPGETYSVKLTAAGEYGYYCEPHQGAGMVGKIIVQ ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7ZQE _struct_ref_seq.pdbx_strand_id M _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 145 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P18068 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 145 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -46 _struct_ref_seq.pdbx_auth_seq_align_end 98 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CU non-polymer . 'COPPER (II) ION' ? 'Cu 2' 63.546 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7ZQE _exptl.crystals_number ? _exptl.details ? _exptl.method 'ELECTRON MICROSCOPY' _exptl.method_details ? # _struct.entry_id 7ZQE _struct.title 'Plastocyanin bound to PSI of Chlamydomonas reinhardtii' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7ZQE _struct_keywords.text 'Photosynthesis, green algae, dimeric PSI' _struct_keywords.pdbx_keywords PHOTOSYNTHESIS # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id GLU _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 131 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 137 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLU _struct_conf.beg_auth_asym_id M _struct_conf.beg_auth_seq_id 84 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id M _struct_conf.end_auth_seq_id 90 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 85 ND1 ? ? ? 1_555 B CU . CU ? ? M HIS 38 M CU 101 1_555 ? ? ? ? ? ? ? 2.077 ? ? metalc2 metalc ? ? A CYS 130 SG ? ? ? 1_555 B CU . CU ? ? M CYS 83 M CU 101 1_555 ? ? ? ? ? ? ? 2.472 ? ? metalc3 metalc ? ? A HIS 133 ND1 ? ? ? 1_555 B CU . CU ? ? M HIS 86 M CU 101 1_555 ? ? ? ? ? ? ? 2.076 ? ? metalc4 metalc ? ? A MET 138 SD ? ? ? 1_555 B CU . CU ? ? M MET 91 M CU 101 1_555 ? ? ? ? ? ? ? 2.304 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 VAL 63 A . ? VAL 16 M PRO 64 A ? PRO 17 M 1 0.50 2 PHE 83 A . ? PHE 36 M PRO 84 A ? PRO 37 M 1 14.36 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 62 ? VAL A 63 ? PHE M 15 VAL M 16 AA1 2 ALA A 49 ? LEU A 53 ? ALA M 2 LEU M 6 AA1 3 THR A 74 ? ASN A 79 ? THR M 27 ASN M 32 AA1 4 THR A 115 ? LYS A 119 ? THR M 68 LYS M 72 AA2 1 THR A 66 ? LYS A 70 ? THR M 19 LYS M 23 AA2 2 VAL A 139 ? GLN A 145 ? VAL M 92 GLN M 98 AA2 3 GLY A 124 ? TYR A 129 ? GLY M 77 TYR M 82 AA2 4 VAL A 88 ? PHE A 89 ? VAL M 41 PHE M 42 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O VAL A 63 ? O VAL M 16 N LYS A 52 ? N LYS M 5 AA1 2 3 N VAL A 51 ? N VAL M 4 O ASN A 76 ? O ASN M 29 AA1 3 4 N VAL A 75 ? N VAL M 28 O VAL A 118 ? O VAL M 71 AA2 1 2 N ILE A 69 ? N ILE M 22 O ILE A 143 ? O ILE M 96 AA2 2 3 O GLY A 140 ? O GLY M 93 N TYR A 128 ? N TYR M 81 AA2 3 4 O TYR A 129 ? O TYR M 82 N VAL A 88 ? N VAL M 41 # _atom_sites.entry_id 7ZQE _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CU H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -46 ? ? ? M . n A 1 2 LYS 2 -45 ? ? ? M . n A 1 3 ALA 3 -44 ? ? ? M . n A 1 4 THR 4 -43 ? ? ? M . n A 1 5 LEU 5 -42 ? ? ? M . n A 1 6 ARG 6 -41 ? ? ? M . n A 1 7 ALA 7 -40 ? ? ? M . n A 1 8 PRO 8 -39 ? ? ? M . n A 1 9 ALA 9 -38 ? ? ? M . n A 1 10 SER 10 -37 ? ? ? M . n A 1 11 ARG 11 -36 ? ? ? M . n A 1 12 ALA 12 -35 ? ? ? M . n A 1 13 SER 13 -34 ? ? ? M . n A 1 14 ALA 14 -33 ? ? ? M . n A 1 15 VAL 15 -32 ? ? ? M . n A 1 16 ARG 16 -31 ? ? ? M . n A 1 17 PRO 17 -30 ? ? ? M . n A 1 18 VAL 18 -29 ? ? ? M . n A 1 19 ALA 19 -28 ? ? ? M . n A 1 20 SER 20 -27 ? ? ? M . n A 1 21 LEU 21 -26 ? ? ? M . n A 1 22 LYS 22 -25 ? ? ? M . n A 1 23 ALA 23 -24 ? ? ? M . n A 1 24 ALA 24 -23 ? ? ? M . n A 1 25 ALA 25 -22 ? ? ? M . n A 1 26 GLN 26 -21 ? ? ? M . n A 1 27 ARG 27 -20 ? ? ? M . n A 1 28 VAL 28 -19 ? ? ? M . n A 1 29 ALA 29 -18 ? ? ? M . n A 1 30 SER 30 -17 ? ? ? M . n A 1 31 VAL 31 -16 ? ? ? M . n A 1 32 ALA 32 -15 ? ? ? M . n A 1 33 GLY 33 -14 ? ? ? M . n A 1 34 VAL 34 -13 ? ? ? M . n A 1 35 SER 35 -12 ? ? ? M . n A 1 36 VAL 36 -11 ? ? ? M . n A 1 37 ALA 37 -10 ? ? ? M . n A 1 38 SER 38 -9 ? ? ? M . n A 1 39 LEU 39 -8 ? ? ? M . n A 1 40 ALA 40 -7 ? ? ? M . n A 1 41 LEU 41 -6 ? ? ? M . n A 1 42 THR 42 -5 ? ? ? M . n A 1 43 LEU 43 -4 ? ? ? M . n A 1 44 ALA 44 -3 ? ? ? M . n A 1 45 ALA 45 -2 ? ? ? M . n A 1 46 HIS 46 -1 ? ? ? M . n A 1 47 ALA 47 0 ? ? ? M . n A 1 48 ASP 48 1 1 ASP ASP M . n A 1 49 ALA 49 2 2 ALA ALA M . n A 1 50 THR 50 3 3 THR THR M . n A 1 51 VAL 51 4 4 VAL VAL M . n A 1 52 LYS 52 5 5 LYS LYS M . n A 1 53 LEU 53 6 6 LEU LEU M . n A 1 54 GLY 54 7 7 GLY GLY M . n A 1 55 ALA 55 8 8 ALA ALA M . n A 1 56 ASP 56 9 9 ASP ASP M . n A 1 57 SER 57 10 10 SER SER M . n A 1 58 GLY 58 11 11 GLY GLY M . n A 1 59 ALA 59 12 12 ALA ALA M . n A 1 60 LEU 60 13 13 LEU LEU M . n A 1 61 GLU 61 14 14 GLU GLU M . n A 1 62 PHE 62 15 15 PHE PHE M . n A 1 63 VAL 63 16 16 VAL VAL M . n A 1 64 PRO 64 17 17 PRO PRO M . n A 1 65 LYS 65 18 18 LYS LYS M . n A 1 66 THR 66 19 19 THR THR M . n A 1 67 LEU 67 20 20 LEU LEU M . n A 1 68 THR 68 21 21 THR THR M . n A 1 69 ILE 69 22 22 ILE ILE M . n A 1 70 LYS 70 23 23 LYS LYS M . n A 1 71 SER 71 24 24 SER SER M . n A 1 72 GLY 72 25 25 GLY GLY M . n A 1 73 GLU 73 26 26 GLU GLU M . n A 1 74 THR 74 27 27 THR THR M . n A 1 75 VAL 75 28 28 VAL VAL M . n A 1 76 ASN 76 29 29 ASN ASN M . n A 1 77 PHE 77 30 30 PHE PHE M . n A 1 78 VAL 78 31 31 VAL VAL M . n A 1 79 ASN 79 32 32 ASN ASN M . n A 1 80 ASN 80 33 33 ASN ASN M . n A 1 81 ALA 81 34 34 ALA ALA M . n A 1 82 GLY 82 35 35 GLY GLY M . n A 1 83 PHE 83 36 36 PHE PHE M . n A 1 84 PRO 84 37 37 PRO PRO M . n A 1 85 HIS 85 38 38 HIS HIS M . n A 1 86 ASN 86 39 39 ASN ASN M . n A 1 87 ILE 87 40 40 ILE ILE M . n A 1 88 VAL 88 41 41 VAL VAL M . n A 1 89 PHE 89 42 42 PHE PHE M . n A 1 90 ASP 90 43 43 ASP ASP M . n A 1 91 GLU 91 44 44 GLU GLU M . n A 1 92 ASP 92 45 45 ASP ASP M . n A 1 93 ALA 93 46 46 ALA ALA M . n A 1 94 ILE 94 47 47 ILE ILE M . n A 1 95 PRO 95 48 48 PRO PRO M . n A 1 96 SER 96 49 49 SER SER M . n A 1 97 GLY 97 50 50 GLY GLY M . n A 1 98 VAL 98 51 51 VAL VAL M . n A 1 99 ASN 99 52 52 ASN ASN M . n A 1 100 ALA 100 53 53 ALA ALA M . n A 1 101 ASP 101 54 54 ASP ASP M . n A 1 102 ALA 102 55 55 ALA ALA M . n A 1 103 ILE 103 56 56 ILE ILE M . n A 1 104 SER 104 57 57 SER SER M . n A 1 105 ARG 105 58 58 ARG ARG M . n A 1 106 ASP 106 59 59 ASP ASP M . n A 1 107 ASP 107 60 60 ASP ASP M . n A 1 108 TYR 108 61 61 TYR TYR M . n A 1 109 LEU 109 62 62 LEU LEU M . n A 1 110 ASN 110 63 63 ASN ASN M . n A 1 111 ALA 111 64 64 ALA ALA M . n A 1 112 PRO 112 65 65 PRO PRO M . n A 1 113 GLY 113 66 66 GLY GLY M . n A 1 114 GLU 114 67 67 GLU GLU M . n A 1 115 THR 115 68 68 THR THR M . n A 1 116 TYR 116 69 69 TYR TYR M . n A 1 117 SER 117 70 70 SER SER M . n A 1 118 VAL 118 71 71 VAL VAL M . n A 1 119 LYS 119 72 72 LYS LYS M . n A 1 120 LEU 120 73 73 LEU LEU M . n A 1 121 THR 121 74 74 THR THR M . n A 1 122 ALA 122 75 75 ALA ALA M . n A 1 123 ALA 123 76 76 ALA ALA M . n A 1 124 GLY 124 77 77 GLY GLY M . n A 1 125 GLU 125 78 78 GLU GLU M . n A 1 126 TYR 126 79 79 TYR TYR M . n A 1 127 GLY 127 80 80 GLY GLY M . n A 1 128 TYR 128 81 81 TYR TYR M . n A 1 129 TYR 129 82 82 TYR TYR M . n A 1 130 CYS 130 83 83 CYS CYS M . n A 1 131 GLU 131 84 84 GLU GLU M . n A 1 132 PRO 132 85 85 PRO PRO M . n A 1 133 HIS 133 86 86 HIS HIS M . n A 1 134 GLN 134 87 87 GLN GLN M . n A 1 135 GLY 135 88 88 GLY GLY M . n A 1 136 ALA 136 89 89 ALA ALA M . n A 1 137 GLY 137 90 90 GLY GLY M . n A 1 138 MET 138 91 91 MET MET M . n A 1 139 VAL 139 92 92 VAL VAL M . n A 1 140 GLY 140 93 93 GLY GLY M . n A 1 141 LYS 141 94 94 LYS LYS M . n A 1 142 ILE 142 95 95 ILE ILE M . n A 1 143 ILE 143 96 96 ILE ILE M . n A 1 144 VAL 144 97 97 VAL VAL M . n A 1 145 GLN 145 98 98 GLN GLN M . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email amunts@scilifelab.se _pdbx_contact_author.name_first Alexey _pdbx_contact_author.name_last Amunts _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-5302-1740 # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id CU _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 101 _pdbx_nonpoly_scheme.auth_seq_num 1 _pdbx_nonpoly_scheme.pdb_mon_id CU _pdbx_nonpoly_scheme.auth_mon_id CU _pdbx_nonpoly_scheme.pdb_strand_id M _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 ND1 ? A HIS 85 ? M HIS 38 ? 1_555 CU ? B CU . ? M CU 101 ? 1_555 SG ? A CYS 130 ? M CYS 83 ? 1_555 112.5 ? 2 ND1 ? A HIS 85 ? M HIS 38 ? 1_555 CU ? B CU . ? M CU 101 ? 1_555 ND1 ? A HIS 133 ? M HIS 86 ? 1_555 115.3 ? 3 SG ? A CYS 130 ? M CYS 83 ? 1_555 CU ? B CU . ? M CU 101 ? 1_555 ND1 ? A HIS 133 ? M HIS 86 ? 1_555 122.8 ? 4 ND1 ? A HIS 85 ? M HIS 38 ? 1_555 CU ? B CU . ? M CU 101 ? 1_555 SD ? A MET 138 ? M MET 91 ? 1_555 115.6 ? 5 SG ? A CYS 130 ? M CYS 83 ? 1_555 CU ? B CU . ? M CU 101 ? 1_555 SD ? A MET 138 ? M MET 91 ? 1_555 95.2 ? 6 ND1 ? A HIS 133 ? M HIS 86 ? 1_555 CU ? B CU . ? M CU 101 ? 1_555 SD ? A MET 138 ? M MET 91 ? 1_555 91.1 ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2022-11-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_entry_details.entry_id 7ZQE _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _em_3d_fitting.entry_id 7ZQE _em_3d_fitting.id 1 _em_3d_fitting.details ? _em_3d_fitting.overall_b_value ? _em_3d_fitting.ref_protocol ? _em_3d_fitting.ref_space ? _em_3d_fitting.target_criteria ? _em_3d_fitting.method ? # _em_3d_reconstruction.entry_id 7ZQE _em_3d_reconstruction.id 1 _em_3d_reconstruction.algorithm ? _em_3d_reconstruction.details ? _em_3d_reconstruction.refinement_type ? _em_3d_reconstruction.image_processing_id 1 _em_3d_reconstruction.num_class_averages ? _em_3d_reconstruction.num_particles 66080 _em_3d_reconstruction.resolution 2.55 _em_3d_reconstruction.resolution_method 'FSC 0.143 CUT-OFF' _em_3d_reconstruction.symmetry_type POINT _em_3d_reconstruction.method ? _em_3d_reconstruction.nominal_pixel_size ? _em_3d_reconstruction.actual_pixel_size ? _em_3d_reconstruction.magnification_calibration ? # _em_buffer.id 1 _em_buffer.details ? _em_buffer.pH 7.5 _em_buffer.specimen_id 1 _em_buffer.name ? # _em_entity_assembly.id 1 _em_entity_assembly.parent_id 0 _em_entity_assembly.details ? _em_entity_assembly.name 'Photosystem I dimer of Chlamydomonas reinhardtii' _em_entity_assembly.source NATURAL _em_entity_assembly.type 'ORGANELLE OR CELLULAR COMPONENT' _em_entity_assembly.entity_id_list 1 _em_entity_assembly.synonym ? _em_entity_assembly.oligomeric_details ? # _em_imaging.id 1 _em_imaging.entry_id 7ZQE _em_imaging.accelerating_voltage 300 _em_imaging.alignment_procedure ? _em_imaging.c2_aperture_diameter ? _em_imaging.calibrated_defocus_max ? _em_imaging.calibrated_defocus_min ? _em_imaging.calibrated_magnification ? _em_imaging.cryogen ? _em_imaging.details ? _em_imaging.electron_source 'FIELD EMISSION GUN' _em_imaging.illumination_mode 'FLOOD BEAM' _em_imaging.microscope_model 'FEI TITAN KRIOS' _em_imaging.mode 'BRIGHT FIELD' _em_imaging.nominal_cs ? _em_imaging.nominal_defocus_max 5000 _em_imaging.nominal_defocus_min 1000 _em_imaging.nominal_magnification ? _em_imaging.recording_temperature_maximum ? _em_imaging.recording_temperature_minimum ? _em_imaging.residual_tilt ? _em_imaging.specimen_holder_model ? _em_imaging.specimen_id 1 _em_imaging.citation_id ? _em_imaging.date ? _em_imaging.temperature ? _em_imaging.tilt_angle_min ? _em_imaging.tilt_angle_max ? _em_imaging.astigmatism ? _em_imaging.detector_distance ? _em_imaging.electron_beam_tilt_params ? _em_imaging.specimen_holder_type ? # _em_vitrification.id 1 _em_vitrification.specimen_id 1 _em_vitrification.chamber_temperature ? _em_vitrification.cryogen_name ETHANE _em_vitrification.details ? _em_vitrification.humidity ? _em_vitrification.instrument ? _em_vitrification.entry_id 7ZQE _em_vitrification.citation_id ? _em_vitrification.method ? _em_vitrification.temp ? _em_vitrification.time_resolved_state ? # _em_experiment.entry_id 7ZQE _em_experiment.id 1 _em_experiment.aggregation_state PARTICLE _em_experiment.reconstruction_method 'SINGLE PARTICLE' _em_experiment.entity_assembly_id 1 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 M MET -46 ? A MET 1 2 1 Y 1 M LYS -45 ? A LYS 2 3 1 Y 1 M ALA -44 ? A ALA 3 4 1 Y 1 M THR -43 ? A THR 4 5 1 Y 1 M LEU -42 ? A LEU 5 6 1 Y 1 M ARG -41 ? A ARG 6 7 1 Y 1 M ALA -40 ? A ALA 7 8 1 Y 1 M PRO -39 ? A PRO 8 9 1 Y 1 M ALA -38 ? A ALA 9 10 1 Y 1 M SER -37 ? A SER 10 11 1 Y 1 M ARG -36 ? A ARG 11 12 1 Y 1 M ALA -35 ? A ALA 12 13 1 Y 1 M SER -34 ? A SER 13 14 1 Y 1 M ALA -33 ? A ALA 14 15 1 Y 1 M VAL -32 ? A VAL 15 16 1 Y 1 M ARG -31 ? A ARG 16 17 1 Y 1 M PRO -30 ? A PRO 17 18 1 Y 1 M VAL -29 ? A VAL 18 19 1 Y 1 M ALA -28 ? A ALA 19 20 1 Y 1 M SER -27 ? A SER 20 21 1 Y 1 M LEU -26 ? A LEU 21 22 1 Y 1 M LYS -25 ? A LYS 22 23 1 Y 1 M ALA -24 ? A ALA 23 24 1 Y 1 M ALA -23 ? A ALA 24 25 1 Y 1 M ALA -22 ? A ALA 25 26 1 Y 1 M GLN -21 ? A GLN 26 27 1 Y 1 M ARG -20 ? A ARG 27 28 1 Y 1 M VAL -19 ? A VAL 28 29 1 Y 1 M ALA -18 ? A ALA 29 30 1 Y 1 M SER -17 ? A SER 30 31 1 Y 1 M VAL -16 ? A VAL 31 32 1 Y 1 M ALA -15 ? A ALA 32 33 1 Y 1 M GLY -14 ? A GLY 33 34 1 Y 1 M VAL -13 ? A VAL 34 35 1 Y 1 M SER -12 ? A SER 35 36 1 Y 1 M VAL -11 ? A VAL 36 37 1 Y 1 M ALA -10 ? A ALA 37 38 1 Y 1 M SER -9 ? A SER 38 39 1 Y 1 M LEU -8 ? A LEU 39 40 1 Y 1 M ALA -7 ? A ALA 40 41 1 Y 1 M LEU -6 ? A LEU 41 42 1 Y 1 M THR -5 ? A THR 42 43 1 Y 1 M LEU -4 ? A LEU 43 44 1 Y 1 M ALA -3 ? A ALA 44 45 1 Y 1 M ALA -2 ? A ALA 45 46 1 Y 1 M HIS -1 ? A HIS 46 47 1 Y 1 M ALA 0 ? A ALA 47 # _em_ctf_correction.id 1 _em_ctf_correction.em_image_processing_id 1 _em_ctf_correction.type 'PHASE FLIPPING ONLY' _em_ctf_correction.details ? # _em_entity_assembly_molwt.entity_assembly_id 1 _em_entity_assembly_molwt.id 1 _em_entity_assembly_molwt.experimental_flag YES _em_entity_assembly_molwt.units MEGADALTONS _em_entity_assembly_molwt.value 0.7 # _em_entity_assembly_naturalsource.id 2 _em_entity_assembly_naturalsource.entity_assembly_id 1 _em_entity_assembly_naturalsource.cell ? _em_entity_assembly_naturalsource.cellular_location ? _em_entity_assembly_naturalsource.ncbi_tax_id 3055 _em_entity_assembly_naturalsource.organ ? _em_entity_assembly_naturalsource.organelle ? _em_entity_assembly_naturalsource.organism 'Chlamydomonas reinhardtii' _em_entity_assembly_naturalsource.strain ? _em_entity_assembly_naturalsource.tissue ? # _em_image_processing.id 1 _em_image_processing.image_recording_id 1 _em_image_processing.details ? # _em_image_recording.id 1 _em_image_recording.imaging_id 1 _em_image_recording.avg_electron_dose_per_image 45.8 _em_image_recording.average_exposure_time ? _em_image_recording.details ? _em_image_recording.detector_mode ? _em_image_recording.film_or_detector_model 'GATAN K3 BIOQUANTUM (6k x 4k)' _em_image_recording.num_diffraction_images ? _em_image_recording.num_grids_imaged ? _em_image_recording.num_real_images ? _em_image_recording.avg_electron_dose_per_subtomogram ? # loop_ _em_software.id _em_software.category _em_software.details _em_software.name _em_software.version _em_software.image_processing_id _em_software.fitting_id _em_software.imaging_id 1 'PARTICLE SELECTION' ? ? ? 1 ? ? 2 'IMAGE ACQUISITION' ? ? ? ? ? 1 3 MASKING ? ? ? ? ? ? 4 'CTF CORRECTION' ? ? ? 1 ? ? 5 'LAYERLINE INDEXING' ? ? ? ? ? ? 6 'DIFFRACTION INDEXING' ? ? ? ? ? ? 7 'MODEL FITTING' ? ? ? ? ? ? 8 'MODEL REFINEMENT' ? ? ? ? ? ? 9 OTHER ? ? ? ? ? ? 10 'INITIAL EULER ASSIGNMENT' ? ? ? 1 ? ? 11 'FINAL EULER ASSIGNMENT' ? ? ? 1 ? ? 12 CLASSIFICATION ? ? ? 1 ? ? 13 RECONSTRUCTION ? ? ? 1 ? ? # _em_specimen.id 1 _em_specimen.experiment_id 1 _em_specimen.concentration ? _em_specimen.details ? _em_specimen.embedding_applied NO _em_specimen.shadowing_applied NO _em_specimen.staining_applied NO _em_specimen.vitrification_applied YES # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'The Swedish Foundation for Strategic Research' Sweden ARC19-0051 1 'Knut and Alice Wallenberg Foundation' Sweden 2018.0080 2 'German Federal Ministry for Education and Research' Germany 'NRW 28 313-WO44A' 3 'German-Israeli Foundation for Research and Development' Germany 'G-1483- 207/2018' 4 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id CU _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id CU _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'COPPER (II) ION' _pdbx_entity_nonpoly.comp_id CU # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'electron microscopy' _pdbx_struct_assembly_auth_evidence.details ? #