data_7ZSM # _entry.id 7ZSM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.385 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7ZSM pdb_00007zsm 10.2210/pdb7zsm/pdb WWPDB D_1292122874 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-05-17 2 'Structure model' 1 1 2023-05-24 3 'Structure model' 1 2 2023-06-07 4 'Structure model' 1 3 2024-02-07 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 3 'Structure model' '_citation.journal_volume' 11 3 'Structure model' '_citation.page_first' 12 3 'Structure model' '_citation.page_last' 13 3 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7ZSM _pdbx_database_status.recvd_initial_deposition_date 2022-05-07 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 3 _pdbx_contact_author.email pavlina.rezacova@uochb.cas.cz _pdbx_contact_author.name_first Rezacova _pdbx_contact_author.name_last Pavlina _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-9626-346X # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Djukic, S.' 1 0000-0002-0010-3400 'Pachl, P.' 2 0000-0001-9215-9817 'Rezacova, P.' 3 0000-0001-9626-346X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 66 _citation.language ? _citation.page_first 6652 _citation.page_last 6681 _citation.title 'Design, Synthesis, Biological Evaluation, and Crystallographic Study of Novel Purine Nucleoside Phosphorylase Inhibitors.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.2c02097 _citation.pdbx_database_id_PubMed 37134237 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Skacel, J.' 1 ? primary 'Djukic, S.' 2 ? primary 'Baszczynski, O.' 3 ? primary 'Kalcic, F.' 4 ? primary 'Bilek, T.' 5 ? primary 'Chalupsky, K.' 6 ? primary 'Kozak, J.' 7 ? primary 'Dvorakova, A.' 8 ? primary ;Tloust'ova, E. ; 9 ? primary ;Kral'ova, Z. ; 10 ? primary 'Smidkova, M.' 11 ? primary 'Voldrich, J.' 12 ? primary 'Rumlova, M.' 13 ? primary 'Pachl, P.' 14 ? primary 'Brynda, J.' 15 ? primary 'Vuckova, T.' 16 ? primary 'Fabry, M.' 17 ? primary 'Snasel, J.' 18 ? primary 'Pichova, I.' 19 ? primary 'Rezacova, P.' 20 ? primary 'Mertlikova-Kaiserova, H.' 21 ? primary 'Janeba, Z.' 22 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Purine nucleoside phosphorylase' 32154.854 1 2.4.2.1 ? ? ? 2 non-polymer syn '[(~{E})-2-[4-methoxy-2-[(4-oxidanylidene-3,5-dihydropyrrolo[3,2-d]pyrimidin-7-yl)sulfanyl]phenyl]ethenyl]phosphonic acid' 379.328 1 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 4 non-polymer syn 'CHLORIDE ION' 35.453 3 ? ? ? ? 5 water nat water 18.015 28 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PNP,Inosine phosphorylase,Inosine-guanosine phosphorylase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVM MQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFP AMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSL ITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS ; _entity_poly.pdbx_seq_one_letter_code_can ;MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVM MQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFP AMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSL ITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '[(~{E})-2-[4-methoxy-2-[(4-oxidanylidene-3,5-dihydropyrrolo[3,2-d]pyrimidin-7-yl)sulfanyl]phenyl]ethenyl]phosphonic acid' JU9 3 'SULFATE ION' SO4 4 'CHLORIDE ION' CL 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 ASN n 1 4 GLY n 1 5 TYR n 1 6 THR n 1 7 TYR n 1 8 GLU n 1 9 ASP n 1 10 TYR n 1 11 LYS n 1 12 ASN n 1 13 THR n 1 14 ALA n 1 15 GLU n 1 16 TRP n 1 17 LEU n 1 18 LEU n 1 19 SER n 1 20 HIS n 1 21 THR n 1 22 LYS n 1 23 HIS n 1 24 ARG n 1 25 PRO n 1 26 GLN n 1 27 VAL n 1 28 ALA n 1 29 ILE n 1 30 ILE n 1 31 CYS n 1 32 GLY n 1 33 SER n 1 34 GLY n 1 35 LEU n 1 36 GLY n 1 37 GLY n 1 38 LEU n 1 39 THR n 1 40 ASP n 1 41 LYS n 1 42 LEU n 1 43 THR n 1 44 GLN n 1 45 ALA n 1 46 GLN n 1 47 ILE n 1 48 PHE n 1 49 ASP n 1 50 TYR n 1 51 GLY n 1 52 GLU n 1 53 ILE n 1 54 PRO n 1 55 ASN n 1 56 PHE n 1 57 PRO n 1 58 ARG n 1 59 SER n 1 60 THR n 1 61 VAL n 1 62 PRO n 1 63 GLY n 1 64 HIS n 1 65 ALA n 1 66 GLY n 1 67 ARG n 1 68 LEU n 1 69 VAL n 1 70 PHE n 1 71 GLY n 1 72 PHE n 1 73 LEU n 1 74 ASN n 1 75 GLY n 1 76 ARG n 1 77 ALA n 1 78 CYS n 1 79 VAL n 1 80 MET n 1 81 MET n 1 82 GLN n 1 83 GLY n 1 84 ARG n 1 85 PHE n 1 86 HIS n 1 87 MET n 1 88 TYR n 1 89 GLU n 1 90 GLY n 1 91 TYR n 1 92 PRO n 1 93 LEU n 1 94 TRP n 1 95 LYS n 1 96 VAL n 1 97 THR n 1 98 PHE n 1 99 PRO n 1 100 VAL n 1 101 ARG n 1 102 VAL n 1 103 PHE n 1 104 HIS n 1 105 LEU n 1 106 LEU n 1 107 GLY n 1 108 VAL n 1 109 ASP n 1 110 THR n 1 111 LEU n 1 112 VAL n 1 113 VAL n 1 114 THR n 1 115 ASN n 1 116 ALA n 1 117 ALA n 1 118 GLY n 1 119 GLY n 1 120 LEU n 1 121 ASN n 1 122 PRO n 1 123 LYS n 1 124 PHE n 1 125 GLU n 1 126 VAL n 1 127 GLY n 1 128 ASP n 1 129 ILE n 1 130 MET n 1 131 LEU n 1 132 ILE n 1 133 ARG n 1 134 ASP n 1 135 HIS n 1 136 ILE n 1 137 ASN n 1 138 LEU n 1 139 PRO n 1 140 GLY n 1 141 PHE n 1 142 SER n 1 143 GLY n 1 144 GLN n 1 145 ASN n 1 146 PRO n 1 147 LEU n 1 148 ARG n 1 149 GLY n 1 150 PRO n 1 151 ASN n 1 152 ASP n 1 153 GLU n 1 154 ARG n 1 155 PHE n 1 156 GLY n 1 157 ASP n 1 158 ARG n 1 159 PHE n 1 160 PRO n 1 161 ALA n 1 162 MET n 1 163 SER n 1 164 ASP n 1 165 ALA n 1 166 TYR n 1 167 ASP n 1 168 ARG n 1 169 THR n 1 170 MET n 1 171 ARG n 1 172 GLN n 1 173 ARG n 1 174 ALA n 1 175 LEU n 1 176 SER n 1 177 THR n 1 178 TRP n 1 179 LYS n 1 180 GLN n 1 181 MET n 1 182 GLY n 1 183 GLU n 1 184 GLN n 1 185 ARG n 1 186 GLU n 1 187 LEU n 1 188 GLN n 1 189 GLU n 1 190 GLY n 1 191 THR n 1 192 TYR n 1 193 VAL n 1 194 MET n 1 195 VAL n 1 196 ALA n 1 197 GLY n 1 198 PRO n 1 199 SER n 1 200 PHE n 1 201 GLU n 1 202 THR n 1 203 VAL n 1 204 ALA n 1 205 GLU n 1 206 CYS n 1 207 ARG n 1 208 VAL n 1 209 LEU n 1 210 GLN n 1 211 LYS n 1 212 LEU n 1 213 GLY n 1 214 ALA n 1 215 ASP n 1 216 ALA n 1 217 VAL n 1 218 GLY n 1 219 MET n 1 220 SER n 1 221 THR n 1 222 VAL n 1 223 PRO n 1 224 GLU n 1 225 VAL n 1 226 ILE n 1 227 VAL n 1 228 ALA n 1 229 ARG n 1 230 HIS n 1 231 CYS n 1 232 GLY n 1 233 LEU n 1 234 ARG n 1 235 VAL n 1 236 PHE n 1 237 GLY n 1 238 PHE n 1 239 SER n 1 240 LEU n 1 241 ILE n 1 242 THR n 1 243 ASN n 1 244 LYS n 1 245 VAL n 1 246 ILE n 1 247 MET n 1 248 ASP n 1 249 TYR n 1 250 GLU n 1 251 SER n 1 252 LEU n 1 253 GLU n 1 254 LYS n 1 255 ALA n 1 256 ASN n 1 257 HIS n 1 258 GLU n 1 259 GLU n 1 260 VAL n 1 261 LEU n 1 262 ALA n 1 263 ALA n 1 264 GLY n 1 265 LYS n 1 266 GLN n 1 267 ALA n 1 268 ALA n 1 269 GLN n 1 270 LYS n 1 271 LEU n 1 272 GLU n 1 273 GLN n 1 274 PHE n 1 275 VAL n 1 276 SER n 1 277 ILE n 1 278 LEU n 1 279 MET n 1 280 ALA n 1 281 SER n 1 282 ILE n 1 283 PRO n 1 284 LEU n 1 285 PRO n 1 286 ASP n 1 287 LYS n 1 288 ALA n 1 289 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 289 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'PNP, NP' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 JU9 non-polymer . '[(~{E})-2-[4-methoxy-2-[(4-oxidanylidene-3,5-dihydropyrrolo[3,2-d]pyrimidin-7-yl)sulfanyl]phenyl]ethenyl]phosphonic acid' ? 'C15 H14 N3 O5 P S' 379.328 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLU 2 2 ? ? ? A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 TYR 5 5 5 TYR TYR A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 TRP 16 16 16 TRP TRP A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 HIS 20 20 20 HIS HIS A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 HIS 23 23 23 HIS HIS A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 PHE 56 56 56 PHE PHE A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 CYS 78 78 78 CYS CYS A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 MET 80 80 80 MET MET A . n A 1 81 MET 81 81 81 MET MET A . n A 1 82 GLN 82 82 82 GLN GLN A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 PHE 85 85 85 PHE PHE A . n A 1 86 HIS 86 86 86 HIS HIS A . n A 1 87 MET 87 87 87 MET MET A . n A 1 88 TYR 88 88 88 TYR TYR A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 TYR 91 91 91 TYR TYR A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 TRP 94 94 94 TRP TRP A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 PHE 98 98 98 PHE PHE A . n A 1 99 PRO 99 99 99 PRO PRO A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 ARG 101 101 101 ARG ARG A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 PHE 103 103 103 PHE PHE A . n A 1 104 HIS 104 104 104 HIS HIS A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 ASP 109 109 109 ASP ASP A . n A 1 110 THR 110 110 110 THR THR A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 VAL 113 113 113 VAL VAL A . n A 1 114 THR 114 114 114 THR THR A . n A 1 115 ASN 115 115 115 ASN ASN A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 ASN 121 121 121 ASN ASN A . n A 1 122 PRO 122 122 122 PRO PRO A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 PHE 124 124 124 PHE PHE A . n A 1 125 GLU 125 125 125 GLU GLU A . n A 1 126 VAL 126 126 126 VAL VAL A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 ASP 128 128 128 ASP ASP A . n A 1 129 ILE 129 129 129 ILE ILE A . n A 1 130 MET 130 130 130 MET MET A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 ILE 132 132 132 ILE ILE A . n A 1 133 ARG 133 133 133 ARG ARG A . n A 1 134 ASP 134 134 134 ASP ASP A . n A 1 135 HIS 135 135 135 HIS HIS A . n A 1 136 ILE 136 136 136 ILE ILE A . n A 1 137 ASN 137 137 137 ASN ASN A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 PRO 139 139 139 PRO PRO A . n A 1 140 GLY 140 140 140 GLY GLY A . n A 1 141 PHE 141 141 141 PHE PHE A . n A 1 142 SER 142 142 142 SER SER A . n A 1 143 GLY 143 143 143 GLY GLY A . n A 1 144 GLN 144 144 144 GLN GLN A . n A 1 145 ASN 145 145 145 ASN ASN A . n A 1 146 PRO 146 146 146 PRO PRO A . n A 1 147 LEU 147 147 147 LEU LEU A . n A 1 148 ARG 148 148 148 ARG ARG A . n A 1 149 GLY 149 149 149 GLY GLY A . n A 1 150 PRO 150 150 150 PRO PRO A . n A 1 151 ASN 151 151 151 ASN ASN A . n A 1 152 ASP 152 152 152 ASP ASP A . n A 1 153 GLU 153 153 153 GLU GLU A . n A 1 154 ARG 154 154 154 ARG ARG A . n A 1 155 PHE 155 155 155 PHE PHE A . n A 1 156 GLY 156 156 156 GLY GLY A . n A 1 157 ASP 157 157 157 ASP ASP A . n A 1 158 ARG 158 158 158 ARG ARG A . n A 1 159 PHE 159 159 159 PHE PHE A . n A 1 160 PRO 160 160 160 PRO PRO A . n A 1 161 ALA 161 161 161 ALA ALA A . n A 1 162 MET 162 162 162 MET MET A . n A 1 163 SER 163 163 163 SER SER A . n A 1 164 ASP 164 164 164 ASP ASP A . n A 1 165 ALA 165 165 165 ALA ALA A . n A 1 166 TYR 166 166 166 TYR TYR A . n A 1 167 ASP 167 167 167 ASP ASP A . n A 1 168 ARG 168 168 168 ARG ARG A . n A 1 169 THR 169 169 169 THR THR A . n A 1 170 MET 170 170 170 MET MET A . n A 1 171 ARG 171 171 171 ARG ARG A . n A 1 172 GLN 172 172 172 GLN GLN A . n A 1 173 ARG 173 173 173 ARG ARG A . n A 1 174 ALA 174 174 174 ALA ALA A . n A 1 175 LEU 175 175 175 LEU LEU A . n A 1 176 SER 176 176 176 SER SER A . n A 1 177 THR 177 177 177 THR THR A . n A 1 178 TRP 178 178 178 TRP TRP A . n A 1 179 LYS 179 179 179 LYS LYS A . n A 1 180 GLN 180 180 180 GLN GLN A . n A 1 181 MET 181 181 181 MET MET A . n A 1 182 GLY 182 182 182 GLY GLY A . n A 1 183 GLU 183 183 183 GLU GLU A . n A 1 184 GLN 184 184 184 GLN GLN A . n A 1 185 ARG 185 185 185 ARG ARG A . n A 1 186 GLU 186 186 186 GLU GLU A . n A 1 187 LEU 187 187 187 LEU LEU A . n A 1 188 GLN 188 188 188 GLN GLN A . n A 1 189 GLU 189 189 189 GLU GLU A . n A 1 190 GLY 190 190 190 GLY GLY A . n A 1 191 THR 191 191 191 THR THR A . n A 1 192 TYR 192 192 192 TYR TYR A . n A 1 193 VAL 193 193 193 VAL VAL A . n A 1 194 MET 194 194 194 MET MET A . n A 1 195 VAL 195 195 195 VAL VAL A . n A 1 196 ALA 196 196 196 ALA ALA A . n A 1 197 GLY 197 197 197 GLY GLY A . n A 1 198 PRO 198 198 198 PRO PRO A . n A 1 199 SER 199 199 199 SER SER A . n A 1 200 PHE 200 200 200 PHE PHE A . n A 1 201 GLU 201 201 201 GLU GLU A . n A 1 202 THR 202 202 202 THR THR A . n A 1 203 VAL 203 203 203 VAL VAL A . n A 1 204 ALA 204 204 204 ALA ALA A . n A 1 205 GLU 205 205 205 GLU GLU A . n A 1 206 CYS 206 206 206 CYS CYS A . n A 1 207 ARG 207 207 207 ARG ARG A . n A 1 208 VAL 208 208 208 VAL VAL A . n A 1 209 LEU 209 209 209 LEU LEU A . n A 1 210 GLN 210 210 210 GLN GLN A . n A 1 211 LYS 211 211 211 LYS LYS A . n A 1 212 LEU 212 212 212 LEU LEU A . n A 1 213 GLY 213 213 213 GLY GLY A . n A 1 214 ALA 214 214 214 ALA ALA A . n A 1 215 ASP 215 215 215 ASP ASP A . n A 1 216 ALA 216 216 216 ALA ALA A . n A 1 217 VAL 217 217 217 VAL VAL A . n A 1 218 GLY 218 218 218 GLY GLY A . n A 1 219 MET 219 219 219 MET MET A . n A 1 220 SER 220 220 220 SER SER A . n A 1 221 THR 221 221 221 THR THR A . n A 1 222 VAL 222 222 222 VAL VAL A . n A 1 223 PRO 223 223 223 PRO PRO A . n A 1 224 GLU 224 224 224 GLU GLU A . n A 1 225 VAL 225 225 225 VAL VAL A . n A 1 226 ILE 226 226 226 ILE ILE A . n A 1 227 VAL 227 227 227 VAL VAL A . n A 1 228 ALA 228 228 228 ALA ALA A . n A 1 229 ARG 229 229 229 ARG ARG A . n A 1 230 HIS 230 230 230 HIS HIS A . n A 1 231 CYS 231 231 231 CYS CYS A . n A 1 232 GLY 232 232 232 GLY GLY A . n A 1 233 LEU 233 233 233 LEU LEU A . n A 1 234 ARG 234 234 234 ARG ARG A . n A 1 235 VAL 235 235 235 VAL VAL A . n A 1 236 PHE 236 236 236 PHE PHE A . n A 1 237 GLY 237 237 237 GLY GLY A . n A 1 238 PHE 238 238 238 PHE PHE A . n A 1 239 SER 239 239 239 SER SER A . n A 1 240 LEU 240 240 240 LEU LEU A . n A 1 241 ILE 241 241 241 ILE ILE A . n A 1 242 THR 242 242 242 THR THR A . n A 1 243 ASN 243 243 243 ASN ASN A . n A 1 244 LYS 244 244 244 LYS LYS A . n A 1 245 VAL 245 245 245 VAL VAL A . n A 1 246 ILE 246 246 246 ILE ILE A . n A 1 247 MET 247 247 247 MET MET A . n A 1 248 ASP 248 248 248 ASP ASP A . n A 1 249 TYR 249 249 249 TYR TYR A . n A 1 250 GLU 250 250 250 GLU GLU A . n A 1 251 SER 251 251 251 SER SER A . n A 1 252 LEU 252 252 252 LEU LEU A . n A 1 253 GLU 253 253 253 GLU GLU A . n A 1 254 LYS 254 254 254 LYS LYS A . n A 1 255 ALA 255 255 255 ALA ALA A . n A 1 256 ASN 256 256 256 ASN ASN A . n A 1 257 HIS 257 257 257 HIS HIS A . n A 1 258 GLU 258 258 258 GLU GLU A . n A 1 259 GLU 259 259 259 GLU GLU A . n A 1 260 VAL 260 260 260 VAL VAL A . n A 1 261 LEU 261 261 261 LEU LEU A . n A 1 262 ALA 262 262 262 ALA ALA A . n A 1 263 ALA 263 263 263 ALA ALA A . n A 1 264 GLY 264 264 264 GLY GLY A . n A 1 265 LYS 265 265 265 LYS LYS A . n A 1 266 GLN 266 266 266 GLN GLN A . n A 1 267 ALA 267 267 267 ALA ALA A . n A 1 268 ALA 268 268 268 ALA ALA A . n A 1 269 GLN 269 269 269 GLN GLN A . n A 1 270 LYS 270 270 270 LYS LYS A . n A 1 271 LEU 271 271 271 LEU LEU A . n A 1 272 GLU 272 272 272 GLU GLU A . n A 1 273 GLN 273 273 273 GLN GLN A . n A 1 274 PHE 274 274 274 PHE PHE A . n A 1 275 VAL 275 275 275 VAL VAL A . n A 1 276 SER 276 276 276 SER SER A . n A 1 277 ILE 277 277 277 ILE ILE A . n A 1 278 LEU 278 278 278 LEU LEU A . n A 1 279 MET 279 279 279 MET MET A . n A 1 280 ALA 280 280 280 ALA ALA A . n A 1 281 SER 281 281 281 SER SER A . n A 1 282 ILE 282 282 282 ILE ILE A . n A 1 283 PRO 283 283 283 PRO PRO A . n A 1 284 LEU 284 284 284 LEU LEU A . n A 1 285 PRO 285 285 ? ? ? A . n A 1 286 ASP 286 286 ? ? ? A . n A 1 287 LYS 287 287 ? ? ? A . n A 1 288 ALA 288 288 ? ? ? A . n A 1 289 SER 289 289 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 JU9 1 301 301 JU9 LIG A . C 3 SO4 1 302 1 SO4 SO4 A . D 3 SO4 1 303 2 SO4 SO4 A . E 4 CL 1 304 1 CL CL A . F 4 CL 1 305 2 CL CL A . G 4 CL 1 306 3 CL CL A . H 5 HOH 1 401 15 HOH HOH A . H 5 HOH 2 402 5 HOH HOH A . H 5 HOH 3 403 20 HOH HOH A . H 5 HOH 4 404 19 HOH HOH A . H 5 HOH 5 405 25 HOH HOH A . H 5 HOH 6 406 21 HOH HOH A . H 5 HOH 7 407 8 HOH HOH A . H 5 HOH 8 408 16 HOH HOH A . H 5 HOH 9 409 13 HOH HOH A . H 5 HOH 10 410 14 HOH HOH A . H 5 HOH 11 411 22 HOH HOH A . H 5 HOH 12 412 26 HOH HOH A . H 5 HOH 13 413 24 HOH HOH A . H 5 HOH 14 414 12 HOH HOH A . H 5 HOH 15 415 27 HOH HOH A . H 5 HOH 16 416 17 HOH HOH A . H 5 HOH 17 417 1 HOH HOH A . H 5 HOH 18 418 18 HOH HOH A . H 5 HOH 19 419 28 HOH HOH A . H 5 HOH 20 420 23 HOH HOH A . H 5 HOH 21 421 4 HOH HOH A . H 5 HOH 22 422 6 HOH HOH A . H 5 HOH 23 423 9 HOH HOH A . H 5 HOH 24 424 7 HOH HOH A . H 5 HOH 25 425 10 HOH HOH A . H 5 HOH 26 426 11 HOH HOH A . H 5 HOH 27 427 3 HOH HOH A . H 5 HOH 28 428 2 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 11 ? CG ? A LYS 11 CG 2 1 Y 1 A LYS 11 ? CD ? A LYS 11 CD 3 1 Y 1 A LYS 11 ? CE ? A LYS 11 CE 4 1 Y 1 A LYS 11 ? NZ ? A LYS 11 NZ 5 1 Y 1 A LYS 22 ? CG ? A LYS 22 CG 6 1 Y 1 A LYS 22 ? CD ? A LYS 22 CD 7 1 Y 1 A LYS 22 ? CE ? A LYS 22 CE 8 1 Y 1 A LYS 22 ? NZ ? A LYS 22 NZ 9 1 Y 1 A ARG 67 ? CG ? A ARG 67 CG 10 1 Y 1 A ARG 67 ? CD ? A ARG 67 CD 11 1 Y 1 A ARG 67 ? NE ? A ARG 67 NE 12 1 Y 1 A ARG 67 ? CZ ? A ARG 67 CZ 13 1 Y 1 A ARG 67 ? NH1 ? A ARG 67 NH1 14 1 Y 1 A ARG 67 ? NH2 ? A ARG 67 NH2 15 1 Y 1 A LYS 123 ? CG ? A LYS 123 CG 16 1 Y 1 A LYS 123 ? CD ? A LYS 123 CD 17 1 Y 1 A LYS 123 ? CE ? A LYS 123 CE 18 1 Y 1 A LYS 123 ? NZ ? A LYS 123 NZ 19 1 Y 1 A ARG 168 ? CG ? A ARG 168 CG 20 1 Y 1 A ARG 168 ? CD ? A ARG 168 CD 21 1 Y 1 A ARG 168 ? NE ? A ARG 168 NE 22 1 Y 1 A ARG 168 ? CZ ? A ARG 168 CZ 23 1 Y 1 A ARG 168 ? NH1 ? A ARG 168 NH1 24 1 Y 1 A ARG 168 ? NH2 ? A ARG 168 NH2 25 1 Y 1 A LYS 179 ? CG ? A LYS 179 CG 26 1 Y 1 A LYS 179 ? CD ? A LYS 179 CD 27 1 Y 1 A LYS 179 ? CE ? A LYS 179 CE 28 1 Y 1 A LYS 179 ? NZ ? A LYS 179 NZ 29 1 Y 1 A GLN 184 ? CG ? A GLN 184 CG 30 1 Y 1 A GLN 184 ? CD ? A GLN 184 CD 31 1 Y 1 A GLN 184 ? OE1 ? A GLN 184 OE1 32 1 Y 1 A GLN 184 ? NE2 ? A GLN 184 NE2 33 1 Y 1 A GLU 186 ? CG ? A GLU 186 CG 34 1 Y 1 A GLU 186 ? CD ? A GLU 186 CD 35 1 Y 1 A GLU 186 ? OE1 ? A GLU 186 OE1 36 1 Y 1 A GLU 186 ? OE2 ? A GLU 186 OE2 37 1 Y 1 A LYS 211 ? CG ? A LYS 211 CG 38 1 Y 1 A LYS 211 ? CD ? A LYS 211 CD 39 1 Y 1 A LYS 211 ? CE ? A LYS 211 CE 40 1 Y 1 A LYS 211 ? NZ ? A LYS 211 NZ 41 1 Y 1 A LEU 252 ? CG ? A LEU 252 CG 42 1 Y 1 A LEU 252 ? CD1 ? A LEU 252 CD1 43 1 Y 1 A LEU 252 ? CD2 ? A LEU 252 CD2 44 1 Y 1 A LYS 254 ? CG ? A LYS 254 CG 45 1 Y 1 A LYS 254 ? CD ? A LYS 254 CD 46 1 Y 1 A LYS 254 ? CE ? A LYS 254 CE 47 1 Y 1 A LYS 254 ? NZ ? A LYS 254 NZ 48 1 Y 1 A GLU 258 ? CG ? A GLU 258 CG 49 1 Y 1 A GLU 258 ? CD ? A GLU 258 CD 50 1 Y 1 A GLU 258 ? OE1 ? A GLU 258 OE1 51 1 Y 1 A GLU 258 ? OE2 ? A GLU 258 OE2 52 1 Y 1 A LYS 265 ? CG ? A LYS 265 CG 53 1 Y 1 A LYS 265 ? CD ? A LYS 265 CD 54 1 Y 1 A LYS 265 ? CE ? A LYS 265 CE 55 1 Y 1 A LYS 265 ? NZ ? A LYS 265 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7ZSM _cell.details ? _cell.formula_units_Z ? _cell.length_a 142.530 _cell.length_a_esd ? _cell.length_b 142.530 _cell.length_b_esd ? _cell.length_c 164.300 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 18 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 7ZSM _symmetry.cell_setting ? _symmetry.Int_Tables_number 155 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'H 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7ZSM _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 4.99 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 75.37 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.5 MAmmonium sulphate, 1M Lithium sulphate, 0.1 M sodium citrate pH 5' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-05-12 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.918 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'BESSY BEAMLINE 14.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.918 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 14.1 _diffrn_source.pdbx_synchrotron_site BESSY # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7ZSM _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.65 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 18872 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 19 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 22.38 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # _reflns_shell.d_res_high 2.65 _reflns_shell.d_res_low 2.81 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2997 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.417 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 0.2000 _refine.aniso_B[1][2] 0.1000 _refine.aniso_B[1][3] -0.0000 _refine.aniso_B[2][2] 0.2000 _refine.aniso_B[2][3] -0.0000 _refine.aniso_B[3][3] -0.6400 _refine.B_iso_max 207.780 _refine.B_iso_mean 85.2680 _refine.B_iso_min 63.280 _refine.correlation_coeff_Fo_to_Fc 0.9580 _refine.correlation_coeff_Fo_to_Fc_free 0.9410 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7ZSM _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.6500 _refine.ls_d_res_low 49.3900 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 17927 _refine.ls_number_reflns_R_free 944 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.8900 _refine.ls_percent_reflns_R_free 5.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2188 _refine.ls_R_factor_R_free 0.2432 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2175 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3PHB _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.2900 _refine.pdbx_overall_ESU_R_Free 0.2300 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 11.8850 _refine.overall_SU_ML 0.2210 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.6500 _refine_hist.d_res_low 49.3900 _refine_hist.number_atoms_solvent 28 _refine_hist.number_atoms_total 2215 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 282 _refine_hist.pdbx_B_iso_mean_ligand 103.87 _refine_hist.pdbx_B_iso_mean_solvent 81.83 _refine_hist.pdbx_number_atoms_protein 2149 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 38 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.005 0.013 2235 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.015 2039 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.350 1.642 3041 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.298 1.571 4659 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.787 5.000 281 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 30.632 21.739 115 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 15.338 15.000 334 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 22.568 15.000 15 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.057 0.200 282 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 0.020 2583 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 542 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.65 _refine_ls_shell.d_res_low 2.7160 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 68 _refine_ls_shell.number_reflns_R_work 1289 _refine_ls_shell.percent_reflns_obs 99.4100 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.7880 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.6950 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7ZSM _struct.title 'human purine nucleoside phosphorylase in complex with JS-375' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7ZSM _struct_keywords.text 'PNP-inhibitor complex, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 4 ? G N N 4 ? H N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PNPH_HUMAN _struct_ref.pdbx_db_accession P00491 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVM MQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFP AMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSL ITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7ZSM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 289 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00491 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 289 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 289 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 8270 ? 1 MORE -122 ? 1 'SSA (A^2)' 30570 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -y,x-y,z -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -x+y,-x,z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 -0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 6 ? HIS A 20 ? THR A 6 HIS A 20 1 ? 15 HELX_P HELX_P2 AA2 LEU A 35 ? LEU A 42 ? LEU A 35 LEU A 42 5 ? 8 HELX_P HELX_P3 AA3 HIS A 86 ? GLY A 90 ? HIS A 86 GLY A 90 5 ? 5 HELX_P HELX_P4 AA4 PRO A 92 ? THR A 97 ? PRO A 92 THR A 97 1 ? 6 HELX_P HELX_P5 AA5 THR A 97 ? LEU A 106 ? THR A 97 LEU A 106 1 ? 10 HELX_P HELX_P6 AA6 LEU A 138 ? SER A 142 ? LEU A 138 SER A 142 1 ? 5 HELX_P HELX_P7 AA7 ASP A 167 ? GLY A 182 ? ASP A 167 GLY A 182 1 ? 16 HELX_P HELX_P8 AA8 THR A 202 ? LEU A 212 ? THR A 202 LEU A 212 1 ? 11 HELX_P HELX_P9 AA9 THR A 221 ? CYS A 231 ? THR A 221 CYS A 231 1 ? 11 HELX_P HELX_P10 AB1 ASN A 256 ? MET A 279 ? ASN A 256 MET A 279 1 ? 24 HELX_P HELX_P11 AB2 ALA A 280 ? ILE A 282 ? ALA A 280 ILE A 282 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLY _struct_mon_prot_cis.label_seq_id 197 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLY _struct_mon_prot_cis.auth_seq_id 197 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 198 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 198 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 8.14 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 10 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? anti-parallel AA1 7 8 ? parallel AA1 8 9 ? parallel AA1 9 10 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 43 ? ASP A 49 ? THR A 43 ASP A 49 AA1 2 ARG A 67 ? LEU A 73 ? ARG A 67 LEU A 73 AA1 3 ARG A 76 ? GLN A 82 ? ARG A 76 GLN A 82 AA1 4 VAL A 27 ? CYS A 31 ? VAL A 27 CYS A 31 AA1 5 THR A 110 ? GLY A 119 ? THR A 110 GLY A 119 AA1 6 ARG A 234 ? LYS A 244 ? ARG A 234 LYS A 244 AA1 7 ILE A 129 ? ASN A 137 ? ILE A 129 ASN A 137 AA1 8 GLN A 188 ? MET A 194 ? GLN A 188 MET A 194 AA1 9 ALA A 216 ? GLY A 218 ? ALA A 216 GLY A 218 AA1 10 THR A 110 ? GLY A 119 ? THR A 110 GLY A 119 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N PHE A 48 ? N PHE A 48 O LEU A 68 ? O LEU A 68 AA1 2 3 N VAL A 69 ? N VAL A 69 O MET A 80 ? O MET A 80 AA1 3 4 O MET A 81 ? O MET A 81 N CYS A 31 ? N CYS A 31 AA1 4 5 N ALA A 28 ? N ALA A 28 O VAL A 112 ? O VAL A 112 AA1 5 6 N GLY A 119 ? N GLY A 119 O ASN A 243 ? O ASN A 243 AA1 6 7 O GLY A 237 ? O GLY A 237 N ILE A 132 ? N ILE A 132 AA1 7 8 N ILE A 129 ? N ILE A 129 O GLN A 188 ? O GLN A 188 AA1 8 9 N VAL A 193 ? N VAL A 193 O ALA A 216 ? O ALA A 216 AA1 9 10 O VAL A 217 ? O VAL A 217 N GLY A 118 ? N GLY A 118 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 33 ? ? -38.62 118.22 2 1 ASN A 55 ? ? 57.73 5.42 3 1 ALA A 117 ? ? -170.43 147.50 4 1 THR A 221 ? ? 72.56 -57.29 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id CL _pdbx_struct_special_symmetry.auth_seq_id 305 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id F _pdbx_struct_special_symmetry.label_comp_id CL _pdbx_struct_special_symmetry.label_seq_id . # _pdbx_entry_details.entry_id 7ZSM _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLU 2 ? A GLU 2 3 1 Y 1 A PRO 285 ? A PRO 285 4 1 Y 1 A ASP 286 ? A ASP 286 5 1 Y 1 A LYS 287 ? A LYS 287 6 1 Y 1 A ALA 288 ? A ALA 288 7 1 Y 1 A SER 289 ? A SER 289 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 JU9 N1 N Y N 184 JU9 N3 N N N 185 JU9 C4 C Y N 186 JU9 C5 C Y N 187 JU9 C6 C N N 188 JU9 C7 C N N 189 JU9 C8 C Y N 190 JU9 C10 C Y N 191 JU9 C13 C N N 192 JU9 C15 C Y N 193 JU9 C1 C N N 194 JU9 O1 O N N 195 JU9 C2 C Y N 196 JU9 C3 C Y N 197 JU9 P1 P N N 198 JU9 O2 O N N 199 JU9 O3 O N N 200 JU9 O4 O N N 201 JU9 S1 S N N 202 JU9 C9 C Y N 203 JU9 C11 C Y N 204 JU9 C12 C N N 205 JU9 O5 O N N 206 JU9 N2 N N N 207 JU9 C14 C Y N 208 JU9 H1 H N N 209 JU9 H2 H N N 210 JU9 H3 H N N 211 JU9 H4 H N N 212 JU9 H5 H N N 213 JU9 H6 H N N 214 JU9 H7 H N N 215 JU9 H8 H N N 216 JU9 H9 H N N 217 JU9 H10 H N N 218 JU9 H11 H N N 219 JU9 H12 H N N 220 JU9 H13 H N N 221 JU9 H14 H N N 222 LEU N N N N 223 LEU CA C N S 224 LEU C C N N 225 LEU O O N N 226 LEU CB C N N 227 LEU CG C N N 228 LEU CD1 C N N 229 LEU CD2 C N N 230 LEU OXT O N N 231 LEU H H N N 232 LEU H2 H N N 233 LEU HA H N N 234 LEU HB2 H N N 235 LEU HB3 H N N 236 LEU HG H N N 237 LEU HD11 H N N 238 LEU HD12 H N N 239 LEU HD13 H N N 240 LEU HD21 H N N 241 LEU HD22 H N N 242 LEU HD23 H N N 243 LEU HXT H N N 244 LYS N N N N 245 LYS CA C N S 246 LYS C C N N 247 LYS O O N N 248 LYS CB C N N 249 LYS CG C N N 250 LYS CD C N N 251 LYS CE C N N 252 LYS NZ N N N 253 LYS OXT O N N 254 LYS H H N N 255 LYS H2 H N N 256 LYS HA H N N 257 LYS HB2 H N N 258 LYS HB3 H N N 259 LYS HG2 H N N 260 LYS HG3 H N N 261 LYS HD2 H N N 262 LYS HD3 H N N 263 LYS HE2 H N N 264 LYS HE3 H N N 265 LYS HZ1 H N N 266 LYS HZ2 H N N 267 LYS HZ3 H N N 268 LYS HXT H N N 269 MET N N N N 270 MET CA C N S 271 MET C C N N 272 MET O O N N 273 MET CB C N N 274 MET CG C N N 275 MET SD S N N 276 MET CE C N N 277 MET OXT O N N 278 MET H H N N 279 MET H2 H N N 280 MET HA H N N 281 MET HB2 H N N 282 MET HB3 H N N 283 MET HG2 H N N 284 MET HG3 H N N 285 MET HE1 H N N 286 MET HE2 H N N 287 MET HE3 H N N 288 MET HXT H N N 289 PHE N N N N 290 PHE CA C N S 291 PHE C C N N 292 PHE O O N N 293 PHE CB C N N 294 PHE CG C Y N 295 PHE CD1 C Y N 296 PHE CD2 C Y N 297 PHE CE1 C Y N 298 PHE CE2 C Y N 299 PHE CZ C Y N 300 PHE OXT O N N 301 PHE H H N N 302 PHE H2 H N N 303 PHE HA H N N 304 PHE HB2 H N N 305 PHE HB3 H N N 306 PHE HD1 H N N 307 PHE HD2 H N N 308 PHE HE1 H N N 309 PHE HE2 H N N 310 PHE HZ H N N 311 PHE HXT H N N 312 PRO N N N N 313 PRO CA C N S 314 PRO C C N N 315 PRO O O N N 316 PRO CB C N N 317 PRO CG C N N 318 PRO CD C N N 319 PRO OXT O N N 320 PRO H H N N 321 PRO HA H N N 322 PRO HB2 H N N 323 PRO HB3 H N N 324 PRO HG2 H N N 325 PRO HG3 H N N 326 PRO HD2 H N N 327 PRO HD3 H N N 328 PRO HXT H N N 329 SER N N N N 330 SER CA C N S 331 SER C C N N 332 SER O O N N 333 SER CB C N N 334 SER OG O N N 335 SER OXT O N N 336 SER H H N N 337 SER H2 H N N 338 SER HA H N N 339 SER HB2 H N N 340 SER HB3 H N N 341 SER HG H N N 342 SER HXT H N N 343 SO4 S S N N 344 SO4 O1 O N N 345 SO4 O2 O N N 346 SO4 O3 O N N 347 SO4 O4 O N N 348 THR N N N N 349 THR CA C N S 350 THR C C N N 351 THR O O N N 352 THR CB C N R 353 THR OG1 O N N 354 THR CG2 C N N 355 THR OXT O N N 356 THR H H N N 357 THR H2 H N N 358 THR HA H N N 359 THR HB H N N 360 THR HG1 H N N 361 THR HG21 H N N 362 THR HG22 H N N 363 THR HG23 H N N 364 THR HXT H N N 365 TRP N N N N 366 TRP CA C N S 367 TRP C C N N 368 TRP O O N N 369 TRP CB C N N 370 TRP CG C Y N 371 TRP CD1 C Y N 372 TRP CD2 C Y N 373 TRP NE1 N Y N 374 TRP CE2 C Y N 375 TRP CE3 C Y N 376 TRP CZ2 C Y N 377 TRP CZ3 C Y N 378 TRP CH2 C Y N 379 TRP OXT O N N 380 TRP H H N N 381 TRP H2 H N N 382 TRP HA H N N 383 TRP HB2 H N N 384 TRP HB3 H N N 385 TRP HD1 H N N 386 TRP HE1 H N N 387 TRP HE3 H N N 388 TRP HZ2 H N N 389 TRP HZ3 H N N 390 TRP HH2 H N N 391 TRP HXT H N N 392 TYR N N N N 393 TYR CA C N S 394 TYR C C N N 395 TYR O O N N 396 TYR CB C N N 397 TYR CG C Y N 398 TYR CD1 C Y N 399 TYR CD2 C Y N 400 TYR CE1 C Y N 401 TYR CE2 C Y N 402 TYR CZ C Y N 403 TYR OH O N N 404 TYR OXT O N N 405 TYR H H N N 406 TYR H2 H N N 407 TYR HA H N N 408 TYR HB2 H N N 409 TYR HB3 H N N 410 TYR HD1 H N N 411 TYR HD2 H N N 412 TYR HE1 H N N 413 TYR HE2 H N N 414 TYR HH H N N 415 TYR HXT H N N 416 VAL N N N N 417 VAL CA C N S 418 VAL C C N N 419 VAL O O N N 420 VAL CB C N N 421 VAL CG1 C N N 422 VAL CG2 C N N 423 VAL OXT O N N 424 VAL H H N N 425 VAL H2 H N N 426 VAL HA H N N 427 VAL HB H N N 428 VAL HG11 H N N 429 VAL HG12 H N N 430 VAL HG13 H N N 431 VAL HG21 H N N 432 VAL HG22 H N N 433 VAL HG23 H N N 434 VAL HXT H N N 435 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 JU9 O4 P1 doub N N 173 JU9 C7 P1 sing N N 174 JU9 C7 C6 doub N E 175 JU9 C4 C3 doub Y N 176 JU9 C4 C5 sing Y N 177 JU9 C3 C2 sing Y N 178 JU9 P1 O2 sing N N 179 JU9 P1 O3 sing N N 180 JU9 C6 C5 sing N N 181 JU9 C5 C8 doub Y N 182 JU9 C2 O1 sing N N 183 JU9 C2 C15 doub Y N 184 JU9 O1 C1 sing N N 185 JU9 C8 C15 sing Y N 186 JU9 C8 S1 sing N N 187 JU9 S1 C9 sing N N 188 JU9 C9 C14 sing Y N 189 JU9 C9 C10 doub Y N 190 JU9 N3 C14 sing N N 191 JU9 N3 C13 doub N N 192 JU9 C14 C11 doub Y N 193 JU9 C13 N2 sing N N 194 JU9 C10 N1 sing Y N 195 JU9 C11 N1 sing Y N 196 JU9 C11 C12 sing N N 197 JU9 N2 C12 sing N N 198 JU9 C12 O5 doub N N 199 JU9 N1 H1 sing N N 200 JU9 C4 H2 sing N N 201 JU9 C6 H3 sing N N 202 JU9 C7 H4 sing N N 203 JU9 C10 H5 sing N N 204 JU9 C13 H6 sing N N 205 JU9 C15 H7 sing N N 206 JU9 C1 H8 sing N N 207 JU9 C1 H9 sing N N 208 JU9 C1 H10 sing N N 209 JU9 C3 H11 sing N N 210 JU9 O2 H12 sing N N 211 JU9 O3 H13 sing N N 212 JU9 N2 H14 sing N N 213 LEU N CA sing N N 214 LEU N H sing N N 215 LEU N H2 sing N N 216 LEU CA C sing N N 217 LEU CA CB sing N N 218 LEU CA HA sing N N 219 LEU C O doub N N 220 LEU C OXT sing N N 221 LEU CB CG sing N N 222 LEU CB HB2 sing N N 223 LEU CB HB3 sing N N 224 LEU CG CD1 sing N N 225 LEU CG CD2 sing N N 226 LEU CG HG sing N N 227 LEU CD1 HD11 sing N N 228 LEU CD1 HD12 sing N N 229 LEU CD1 HD13 sing N N 230 LEU CD2 HD21 sing N N 231 LEU CD2 HD22 sing N N 232 LEU CD2 HD23 sing N N 233 LEU OXT HXT sing N N 234 LYS N CA sing N N 235 LYS N H sing N N 236 LYS N H2 sing N N 237 LYS CA C sing N N 238 LYS CA CB sing N N 239 LYS CA HA sing N N 240 LYS C O doub N N 241 LYS C OXT sing N N 242 LYS CB CG sing N N 243 LYS CB HB2 sing N N 244 LYS CB HB3 sing N N 245 LYS CG CD sing N N 246 LYS CG HG2 sing N N 247 LYS CG HG3 sing N N 248 LYS CD CE sing N N 249 LYS CD HD2 sing N N 250 LYS CD HD3 sing N N 251 LYS CE NZ sing N N 252 LYS CE HE2 sing N N 253 LYS CE HE3 sing N N 254 LYS NZ HZ1 sing N N 255 LYS NZ HZ2 sing N N 256 LYS NZ HZ3 sing N N 257 LYS OXT HXT sing N N 258 MET N CA sing N N 259 MET N H sing N N 260 MET N H2 sing N N 261 MET CA C sing N N 262 MET CA CB sing N N 263 MET CA HA sing N N 264 MET C O doub N N 265 MET C OXT sing N N 266 MET CB CG sing N N 267 MET CB HB2 sing N N 268 MET CB HB3 sing N N 269 MET CG SD sing N N 270 MET CG HG2 sing N N 271 MET CG HG3 sing N N 272 MET SD CE sing N N 273 MET CE HE1 sing N N 274 MET CE HE2 sing N N 275 MET CE HE3 sing N N 276 MET OXT HXT sing N N 277 PHE N CA sing N N 278 PHE N H sing N N 279 PHE N H2 sing N N 280 PHE CA C sing N N 281 PHE CA CB sing N N 282 PHE CA HA sing N N 283 PHE C O doub N N 284 PHE C OXT sing N N 285 PHE CB CG sing N N 286 PHE CB HB2 sing N N 287 PHE CB HB3 sing N N 288 PHE CG CD1 doub Y N 289 PHE CG CD2 sing Y N 290 PHE CD1 CE1 sing Y N 291 PHE CD1 HD1 sing N N 292 PHE CD2 CE2 doub Y N 293 PHE CD2 HD2 sing N N 294 PHE CE1 CZ doub Y N 295 PHE CE1 HE1 sing N N 296 PHE CE2 CZ sing Y N 297 PHE CE2 HE2 sing N N 298 PHE CZ HZ sing N N 299 PHE OXT HXT sing N N 300 PRO N CA sing N N 301 PRO N CD sing N N 302 PRO N H sing N N 303 PRO CA C sing N N 304 PRO CA CB sing N N 305 PRO CA HA sing N N 306 PRO C O doub N N 307 PRO C OXT sing N N 308 PRO CB CG sing N N 309 PRO CB HB2 sing N N 310 PRO CB HB3 sing N N 311 PRO CG CD sing N N 312 PRO CG HG2 sing N N 313 PRO CG HG3 sing N N 314 PRO CD HD2 sing N N 315 PRO CD HD3 sing N N 316 PRO OXT HXT sing N N 317 SER N CA sing N N 318 SER N H sing N N 319 SER N H2 sing N N 320 SER CA C sing N N 321 SER CA CB sing N N 322 SER CA HA sing N N 323 SER C O doub N N 324 SER C OXT sing N N 325 SER CB OG sing N N 326 SER CB HB2 sing N N 327 SER CB HB3 sing N N 328 SER OG HG sing N N 329 SER OXT HXT sing N N 330 SO4 S O1 doub N N 331 SO4 S O2 doub N N 332 SO4 S O3 sing N N 333 SO4 S O4 sing N N 334 THR N CA sing N N 335 THR N H sing N N 336 THR N H2 sing N N 337 THR CA C sing N N 338 THR CA CB sing N N 339 THR CA HA sing N N 340 THR C O doub N N 341 THR C OXT sing N N 342 THR CB OG1 sing N N 343 THR CB CG2 sing N N 344 THR CB HB sing N N 345 THR OG1 HG1 sing N N 346 THR CG2 HG21 sing N N 347 THR CG2 HG22 sing N N 348 THR CG2 HG23 sing N N 349 THR OXT HXT sing N N 350 TRP N CA sing N N 351 TRP N H sing N N 352 TRP N H2 sing N N 353 TRP CA C sing N N 354 TRP CA CB sing N N 355 TRP CA HA sing N N 356 TRP C O doub N N 357 TRP C OXT sing N N 358 TRP CB CG sing N N 359 TRP CB HB2 sing N N 360 TRP CB HB3 sing N N 361 TRP CG CD1 doub Y N 362 TRP CG CD2 sing Y N 363 TRP CD1 NE1 sing Y N 364 TRP CD1 HD1 sing N N 365 TRP CD2 CE2 doub Y N 366 TRP CD2 CE3 sing Y N 367 TRP NE1 CE2 sing Y N 368 TRP NE1 HE1 sing N N 369 TRP CE2 CZ2 sing Y N 370 TRP CE3 CZ3 doub Y N 371 TRP CE3 HE3 sing N N 372 TRP CZ2 CH2 doub Y N 373 TRP CZ2 HZ2 sing N N 374 TRP CZ3 CH2 sing Y N 375 TRP CZ3 HZ3 sing N N 376 TRP CH2 HH2 sing N N 377 TRP OXT HXT sing N N 378 TYR N CA sing N N 379 TYR N H sing N N 380 TYR N H2 sing N N 381 TYR CA C sing N N 382 TYR CA CB sing N N 383 TYR CA HA sing N N 384 TYR C O doub N N 385 TYR C OXT sing N N 386 TYR CB CG sing N N 387 TYR CB HB2 sing N N 388 TYR CB HB3 sing N N 389 TYR CG CD1 doub Y N 390 TYR CG CD2 sing Y N 391 TYR CD1 CE1 sing Y N 392 TYR CD1 HD1 sing N N 393 TYR CD2 CE2 doub Y N 394 TYR CD2 HD2 sing N N 395 TYR CE1 CZ doub Y N 396 TYR CE1 HE1 sing N N 397 TYR CE2 CZ sing Y N 398 TYR CE2 HE2 sing N N 399 TYR CZ OH sing N N 400 TYR OH HH sing N N 401 TYR OXT HXT sing N N 402 VAL N CA sing N N 403 VAL N H sing N N 404 VAL N H2 sing N N 405 VAL CA C sing N N 406 VAL CA CB sing N N 407 VAL CA HA sing N N 408 VAL C O doub N N 409 VAL C OXT sing N N 410 VAL CB CG1 sing N N 411 VAL CB CG2 sing N N 412 VAL CB HB sing N N 413 VAL CG1 HG11 sing N N 414 VAL CG1 HG12 sing N N 415 VAL CG1 HG13 sing N N 416 VAL CG2 HG21 sing N N 417 VAL CG2 HG22 sing N N 418 VAL CG2 HG23 sing N N 419 VAL OXT HXT sing N N 420 # _pdbx_audit_support.funding_organization 'European Regional Development Fund' _pdbx_audit_support.country 'European Union' _pdbx_audit_support.grant_number CZ.02.1.01/0.0/0.0/16_019/0000729 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id JU9 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id JU9 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.accession_code 3PHB _pdbx_initial_refinement_model.details ? _pdbx_initial_refinement_model.entity_id_list 1 _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.type 'experimental model' # _atom_sites.entry_id 7ZSM _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.007016 _atom_sites.fract_transf_matrix[1][2] 0.004051 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008101 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006086 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CL N O P S # loop_