data_7ZZV # _entry.id 7ZZV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.394 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7ZZV pdb_00007zzv 10.2210/pdb7zzv/pdb WWPDB D_1292123359 ? ? BMRB 51231 ? 10.13018/BMR51231 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-06-15 2 'Structure model' 1 1 2023-06-14 3 'Structure model' 1 2 2024-06-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Other 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_database_status 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 2 3 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7ZZV _pdbx_database_status.recvd_initial_deposition_date 2022-05-26 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.db_id 51231 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 4 _pdbx_contact_author.email dblohin@kpfu.ru _pdbx_contact_author.name_first Dmitriy _pdbx_contact_author.name_last Blokhin _pdbx_contact_author.name_mi S. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-8740-8313 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Blokhin, D.S.' 1 ? 'Yulmetov, A.R.' 2 ? 'Kusova, A.M.' 3 ? 'Skvortsova, P.V.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Journal of Molecular Structure' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 00222860 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 1253 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structure of amyloidogenic PAP(85-120) peptide by high-resolution NMR spectroscopy' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.molstruc.2021.132294 _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Blokhin, D.S.' 1 ? primary 'Yulmetov, A.R.' 2 ? primary 'Kusova, A.M.' 3 ? primary 'Skvortsova, P.V.' 4 ? primary 'Mukhametzyanov, T.A.' 5 ? primary 'Klochkov, V.V.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description 'Prostatic acid phosphatase' _entity.formula_weight 4473.167 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.1.3.2,3.1.3.5,3.1.3.48 _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name ;PAP,5'-nucleotidase,5'-NT,Acid phosphatase 3,Ecto-5'-nucleotidase,Protein tyrosine phosphatase ACP3,Thiamine monophosphatase,TMPase ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code IRKRYRKFLNESYKHEQVYIRSTDVDRTLMSAMTNL _entity_poly.pdbx_seq_one_letter_code_can IRKRYRKFLNESYKHEQVYIRSTDVDRTLMSAMTNL _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ILE n 1 2 ARG n 1 3 LYS n 1 4 ARG n 1 5 TYR n 1 6 ARG n 1 7 LYS n 1 8 PHE n 1 9 LEU n 1 10 ASN n 1 11 GLU n 1 12 SER n 1 13 TYR n 1 14 LYS n 1 15 HIS n 1 16 GLU n 1 17 GLN n 1 18 VAL n 1 19 TYR n 1 20 ILE n 1 21 ARG n 1 22 SER n 1 23 THR n 1 24 ASP n 1 25 VAL n 1 26 ASP n 1 27 ARG n 1 28 THR n 1 29 LEU n 1 30 MET n 1 31 SER n 1 32 ALA n 1 33 MET n 1 34 THR n 1 35 ASN n 1 36 LEU n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 36 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ILE 1 85 85 ILE ILE A . n A 1 2 ARG 2 86 86 ARG ARG A . n A 1 3 LYS 3 87 87 LYS LYS A . n A 1 4 ARG 4 88 88 ARG ARG A . n A 1 5 TYR 5 89 89 TYR TYR A . n A 1 6 ARG 6 90 90 ARG ARG A . n A 1 7 LYS 7 91 91 LYS LYS A . n A 1 8 PHE 8 92 92 PHE PHE A . n A 1 9 LEU 9 93 93 LEU LEU A . n A 1 10 ASN 10 94 94 ASN ASN A . n A 1 11 GLU 11 95 95 GLU GLU A . n A 1 12 SER 12 96 96 SER SER A . n A 1 13 TYR 13 97 97 TYR TYR A . n A 1 14 LYS 14 98 98 LYS LYS A . n A 1 15 HIS 15 99 99 HIS HIS A . n A 1 16 GLU 16 100 100 GLU GLU A . n A 1 17 GLN 17 101 101 GLN GLN A . n A 1 18 VAL 18 102 102 VAL VAL A . n A 1 19 TYR 19 103 103 TYR TYR A . n A 1 20 ILE 20 104 104 ILE ILE A . n A 1 21 ARG 21 105 105 ARG ARG A . n A 1 22 SER 22 106 106 SER SER A . n A 1 23 THR 23 107 107 THR THR A . n A 1 24 ASP 24 108 108 ASP ASP A . n A 1 25 VAL 25 109 109 VAL VAL A . n A 1 26 ASP 26 110 110 ASP ASP A . n A 1 27 ARG 27 111 111 ARG ARG A . n A 1 28 THR 28 112 112 THR THR A . n A 1 29 LEU 29 113 113 LEU LEU A . n A 1 30 MET 30 114 114 MET MET A . n A 1 31 SER 31 115 115 SER SER A . n A 1 32 ALA 32 116 116 ALA ALA A . n A 1 33 MET 33 117 117 MET MET A . n A 1 34 THR 34 118 118 THR THR A . n A 1 35 ASN 35 119 119 ASN ASN A . n A 1 36 LEU 36 120 120 LEU LEU A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7ZZV _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7ZZV _struct.title 'Prostatic acid phosphatase (PAP) fragment (85-120)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7ZZV _struct_keywords.text 'HIV infection; NMR spectroscopy; Prostatic acid phosphatase; Spatial structure, PROTEIN FIBRIL' _struct_keywords.pdbx_keywords 'PROTEIN FIBRIL' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PPAP_HUMAN _struct_ref.pdbx_db_accession P15309 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code IRKRYRKFLNESYKHEQVYIRSTDVDRTLMSAMTNL _struct_ref.pdbx_align_begin 85 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7ZZV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 36 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P15309 _struct_ref_seq.db_align_beg 85 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 120 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 85 _struct_ref_seq.pdbx_auth_seq_align_end 120 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 3120 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id VAL _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 18 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ASP _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 26 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id VAL _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 102 _struct_conf.end_auth_comp_id ASP _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 110 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 87 ? ? -94.35 47.15 2 1 ALA A 116 ? ? -176.20 117.74 3 1 ASN A 119 ? ? -138.21 -32.26 4 2 LYS A 87 ? ? -99.65 44.79 5 2 ALA A 116 ? ? -173.03 147.87 6 2 MET A 117 ? ? -69.25 -71.48 7 3 LYS A 87 ? ? -101.83 56.71 8 3 GLN A 101 ? ? -105.64 45.64 9 3 ALA A 116 ? ? -175.21 143.22 10 3 ASN A 119 ? ? -151.53 57.00 11 4 TYR A 89 ? ? -65.19 99.94 12 4 LYS A 91 ? ? -66.11 -77.90 13 4 ASN A 94 ? ? -44.83 150.53 14 4 GLU A 100 ? ? -141.50 -96.27 15 4 GLN A 101 ? ? -144.77 24.32 16 4 SER A 115 ? ? -48.89 104.20 17 5 LYS A 87 ? ? -92.99 32.47 18 5 ARG A 88 ? ? 76.34 67.17 19 5 GLN A 101 ? ? -111.73 56.16 20 5 MET A 114 ? ? -63.64 -174.44 21 5 MET A 117 ? ? -137.49 -62.86 22 6 MET A 117 ? ? -65.08 -73.54 23 6 ASN A 119 ? ? -154.27 85.19 24 7 ASN A 94 ? ? -47.86 150.80 25 7 GLU A 100 ? ? -128.95 -91.32 26 7 GLN A 101 ? ? -155.54 31.85 27 7 SER A 115 ? ? -50.44 104.50 28 7 ALA A 116 ? ? -177.54 127.60 29 9 LYS A 87 ? ? -93.98 45.04 30 9 SER A 96 ? ? -175.72 -177.43 31 9 GLN A 101 ? ? -106.92 58.58 32 9 ALA A 116 ? ? -175.85 124.13 33 10 ASN A 94 ? ? -48.01 161.17 34 10 SER A 96 ? ? -175.41 -170.56 35 10 MET A 117 ? ? -76.06 -74.12 36 11 GLN A 101 ? ? -80.17 46.38 37 11 SER A 115 ? ? 51.84 74.32 38 11 MET A 117 ? ? -145.82 -61.17 39 11 ASN A 119 ? ? -169.69 107.40 40 12 LYS A 87 ? ? -106.58 50.88 41 12 GLN A 101 ? ? -118.91 51.81 42 12 ALA A 116 ? ? -176.36 127.58 43 13 SER A 115 ? ? -47.76 109.32 44 13 ALA A 116 ? ? -175.56 125.21 45 13 ASN A 119 ? ? -167.62 110.63 46 14 LYS A 87 ? ? -112.63 59.61 47 14 LYS A 98 ? ? -115.74 -95.34 48 14 HIS A 99 ? ? -148.92 20.49 49 15 PHE A 92 ? ? -131.76 -32.47 50 15 GLU A 100 ? ? -104.41 -164.57 51 15 GLN A 101 ? ? -77.47 38.43 52 15 ALA A 116 ? ? -174.88 132.56 53 16 LYS A 87 ? ? -98.05 42.08 54 16 GLU A 100 ? ? -74.38 -169.65 55 16 MET A 114 ? ? -49.66 159.53 56 16 ALA A 116 ? ? -171.12 135.10 57 17 LYS A 87 ? ? -146.32 58.85 58 17 GLU A 100 ? ? -119.18 -88.84 59 17 GLN A 101 ? ? -142.08 22.14 60 17 MET A 117 ? ? -71.41 -74.02 61 17 ASN A 119 ? ? -170.80 137.89 62 18 LYS A 87 ? ? -94.42 46.26 63 18 GLN A 101 ? ? -78.83 46.85 64 18 ALA A 116 ? ? -177.00 119.50 # _pdbx_nmr_ensemble.entry_id 7ZZV _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 18 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with acceptable covalent geometry' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7ZZV _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.8 mM pap85_120, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label PAP85_sample _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component pap85_120 _pdbx_nmr_exptl_sample.concentration 0.8 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 3.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-1H TOCSY' 1 isotropic 2 1 1 '2D 1H-13C HSQC' 1 isotropic 3 1 1 '2D 1H-15N HSQC' 1 isotropic 4 1 1 '2D 1H-13C HMBC' 1 isotropic 5 1 1 '2D 1H-1H NOESY' 1 isotropic # _pdbx_nmr_refine.entry_id 7ZZV _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 2 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 processing TopSpin ? 'Bruker Biospin' 2 'structure calculation' 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' 3 'chemical shift assignment' 'CcpNmr Analysis' ? CCPN 4 'peak picking' 'CcpNmr Analysis' ? CCPN # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 HIS N N N N 113 HIS CA C N S 114 HIS C C N N 115 HIS O O N N 116 HIS CB C N N 117 HIS CG C Y N 118 HIS ND1 N Y N 119 HIS CD2 C Y N 120 HIS CE1 C Y N 121 HIS NE2 N Y N 122 HIS OXT O N N 123 HIS H H N N 124 HIS H2 H N N 125 HIS HA H N N 126 HIS HB2 H N N 127 HIS HB3 H N N 128 HIS HD1 H N N 129 HIS HD2 H N N 130 HIS HE1 H N N 131 HIS HE2 H N N 132 HIS HXT H N N 133 ILE N N N N 134 ILE CA C N S 135 ILE C C N N 136 ILE O O N N 137 ILE CB C N S 138 ILE CG1 C N N 139 ILE CG2 C N N 140 ILE CD1 C N N 141 ILE OXT O N N 142 ILE H H N N 143 ILE H2 H N N 144 ILE HA H N N 145 ILE HB H N N 146 ILE HG12 H N N 147 ILE HG13 H N N 148 ILE HG21 H N N 149 ILE HG22 H N N 150 ILE HG23 H N N 151 ILE HD11 H N N 152 ILE HD12 H N N 153 ILE HD13 H N N 154 ILE HXT H N N 155 LEU N N N N 156 LEU CA C N S 157 LEU C C N N 158 LEU O O N N 159 LEU CB C N N 160 LEU CG C N N 161 LEU CD1 C N N 162 LEU CD2 C N N 163 LEU OXT O N N 164 LEU H H N N 165 LEU H2 H N N 166 LEU HA H N N 167 LEU HB2 H N N 168 LEU HB3 H N N 169 LEU HG H N N 170 LEU HD11 H N N 171 LEU HD12 H N N 172 LEU HD13 H N N 173 LEU HD21 H N N 174 LEU HD22 H N N 175 LEU HD23 H N N 176 LEU HXT H N N 177 LYS N N N N 178 LYS CA C N S 179 LYS C C N N 180 LYS O O N N 181 LYS CB C N N 182 LYS CG C N N 183 LYS CD C N N 184 LYS CE C N N 185 LYS NZ N N N 186 LYS OXT O N N 187 LYS H H N N 188 LYS H2 H N N 189 LYS HA H N N 190 LYS HB2 H N N 191 LYS HB3 H N N 192 LYS HG2 H N N 193 LYS HG3 H N N 194 LYS HD2 H N N 195 LYS HD3 H N N 196 LYS HE2 H N N 197 LYS HE3 H N N 198 LYS HZ1 H N N 199 LYS HZ2 H N N 200 LYS HZ3 H N N 201 LYS HXT H N N 202 MET N N N N 203 MET CA C N S 204 MET C C N N 205 MET O O N N 206 MET CB C N N 207 MET CG C N N 208 MET SD S N N 209 MET CE C N N 210 MET OXT O N N 211 MET H H N N 212 MET H2 H N N 213 MET HA H N N 214 MET HB2 H N N 215 MET HB3 H N N 216 MET HG2 H N N 217 MET HG3 H N N 218 MET HE1 H N N 219 MET HE2 H N N 220 MET HE3 H N N 221 MET HXT H N N 222 PHE N N N N 223 PHE CA C N S 224 PHE C C N N 225 PHE O O N N 226 PHE CB C N N 227 PHE CG C Y N 228 PHE CD1 C Y N 229 PHE CD2 C Y N 230 PHE CE1 C Y N 231 PHE CE2 C Y N 232 PHE CZ C Y N 233 PHE OXT O N N 234 PHE H H N N 235 PHE H2 H N N 236 PHE HA H N N 237 PHE HB2 H N N 238 PHE HB3 H N N 239 PHE HD1 H N N 240 PHE HD2 H N N 241 PHE HE1 H N N 242 PHE HE2 H N N 243 PHE HZ H N N 244 PHE HXT H N N 245 SER N N N N 246 SER CA C N S 247 SER C C N N 248 SER O O N N 249 SER CB C N N 250 SER OG O N N 251 SER OXT O N N 252 SER H H N N 253 SER H2 H N N 254 SER HA H N N 255 SER HB2 H N N 256 SER HB3 H N N 257 SER HG H N N 258 SER HXT H N N 259 THR N N N N 260 THR CA C N S 261 THR C C N N 262 THR O O N N 263 THR CB C N R 264 THR OG1 O N N 265 THR CG2 C N N 266 THR OXT O N N 267 THR H H N N 268 THR H2 H N N 269 THR HA H N N 270 THR HB H N N 271 THR HG1 H N N 272 THR HG21 H N N 273 THR HG22 H N N 274 THR HG23 H N N 275 THR HXT H N N 276 TYR N N N N 277 TYR CA C N S 278 TYR C C N N 279 TYR O O N N 280 TYR CB C N N 281 TYR CG C Y N 282 TYR CD1 C Y N 283 TYR CD2 C Y N 284 TYR CE1 C Y N 285 TYR CE2 C Y N 286 TYR CZ C Y N 287 TYR OH O N N 288 TYR OXT O N N 289 TYR H H N N 290 TYR H2 H N N 291 TYR HA H N N 292 TYR HB2 H N N 293 TYR HB3 H N N 294 TYR HD1 H N N 295 TYR HD2 H N N 296 TYR HE1 H N N 297 TYR HE2 H N N 298 TYR HH H N N 299 TYR HXT H N N 300 VAL N N N N 301 VAL CA C N S 302 VAL C C N N 303 VAL O O N N 304 VAL CB C N N 305 VAL CG1 C N N 306 VAL CG2 C N N 307 VAL OXT O N N 308 VAL H H N N 309 VAL H2 H N N 310 VAL HA H N N 311 VAL HB H N N 312 VAL HG11 H N N 313 VAL HG12 H N N 314 VAL HG13 H N N 315 VAL HG21 H N N 316 VAL HG22 H N N 317 VAL HG23 H N N 318 VAL HXT H N N 319 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 HIS N CA sing N N 107 HIS N H sing N N 108 HIS N H2 sing N N 109 HIS CA C sing N N 110 HIS CA CB sing N N 111 HIS CA HA sing N N 112 HIS C O doub N N 113 HIS C OXT sing N N 114 HIS CB CG sing N N 115 HIS CB HB2 sing N N 116 HIS CB HB3 sing N N 117 HIS CG ND1 sing Y N 118 HIS CG CD2 doub Y N 119 HIS ND1 CE1 doub Y N 120 HIS ND1 HD1 sing N N 121 HIS CD2 NE2 sing Y N 122 HIS CD2 HD2 sing N N 123 HIS CE1 NE2 sing Y N 124 HIS CE1 HE1 sing N N 125 HIS NE2 HE2 sing N N 126 HIS OXT HXT sing N N 127 ILE N CA sing N N 128 ILE N H sing N N 129 ILE N H2 sing N N 130 ILE CA C sing N N 131 ILE CA CB sing N N 132 ILE CA HA sing N N 133 ILE C O doub N N 134 ILE C OXT sing N N 135 ILE CB CG1 sing N N 136 ILE CB CG2 sing N N 137 ILE CB HB sing N N 138 ILE CG1 CD1 sing N N 139 ILE CG1 HG12 sing N N 140 ILE CG1 HG13 sing N N 141 ILE CG2 HG21 sing N N 142 ILE CG2 HG22 sing N N 143 ILE CG2 HG23 sing N N 144 ILE CD1 HD11 sing N N 145 ILE CD1 HD12 sing N N 146 ILE CD1 HD13 sing N N 147 ILE OXT HXT sing N N 148 LEU N CA sing N N 149 LEU N H sing N N 150 LEU N H2 sing N N 151 LEU CA C sing N N 152 LEU CA CB sing N N 153 LEU CA HA sing N N 154 LEU C O doub N N 155 LEU C OXT sing N N 156 LEU CB CG sing N N 157 LEU CB HB2 sing N N 158 LEU CB HB3 sing N N 159 LEU CG CD1 sing N N 160 LEU CG CD2 sing N N 161 LEU CG HG sing N N 162 LEU CD1 HD11 sing N N 163 LEU CD1 HD12 sing N N 164 LEU CD1 HD13 sing N N 165 LEU CD2 HD21 sing N N 166 LEU CD2 HD22 sing N N 167 LEU CD2 HD23 sing N N 168 LEU OXT HXT sing N N 169 LYS N CA sing N N 170 LYS N H sing N N 171 LYS N H2 sing N N 172 LYS CA C sing N N 173 LYS CA CB sing N N 174 LYS CA HA sing N N 175 LYS C O doub N N 176 LYS C OXT sing N N 177 LYS CB CG sing N N 178 LYS CB HB2 sing N N 179 LYS CB HB3 sing N N 180 LYS CG CD sing N N 181 LYS CG HG2 sing N N 182 LYS CG HG3 sing N N 183 LYS CD CE sing N N 184 LYS CD HD2 sing N N 185 LYS CD HD3 sing N N 186 LYS CE NZ sing N N 187 LYS CE HE2 sing N N 188 LYS CE HE3 sing N N 189 LYS NZ HZ1 sing N N 190 LYS NZ HZ2 sing N N 191 LYS NZ HZ3 sing N N 192 LYS OXT HXT sing N N 193 MET N CA sing N N 194 MET N H sing N N 195 MET N H2 sing N N 196 MET CA C sing N N 197 MET CA CB sing N N 198 MET CA HA sing N N 199 MET C O doub N N 200 MET C OXT sing N N 201 MET CB CG sing N N 202 MET CB HB2 sing N N 203 MET CB HB3 sing N N 204 MET CG SD sing N N 205 MET CG HG2 sing N N 206 MET CG HG3 sing N N 207 MET SD CE sing N N 208 MET CE HE1 sing N N 209 MET CE HE2 sing N N 210 MET CE HE3 sing N N 211 MET OXT HXT sing N N 212 PHE N CA sing N N 213 PHE N H sing N N 214 PHE N H2 sing N N 215 PHE CA C sing N N 216 PHE CA CB sing N N 217 PHE CA HA sing N N 218 PHE C O doub N N 219 PHE C OXT sing N N 220 PHE CB CG sing N N 221 PHE CB HB2 sing N N 222 PHE CB HB3 sing N N 223 PHE CG CD1 doub Y N 224 PHE CG CD2 sing Y N 225 PHE CD1 CE1 sing Y N 226 PHE CD1 HD1 sing N N 227 PHE CD2 CE2 doub Y N 228 PHE CD2 HD2 sing N N 229 PHE CE1 CZ doub Y N 230 PHE CE1 HE1 sing N N 231 PHE CE2 CZ sing Y N 232 PHE CE2 HE2 sing N N 233 PHE CZ HZ sing N N 234 PHE OXT HXT sing N N 235 SER N CA sing N N 236 SER N H sing N N 237 SER N H2 sing N N 238 SER CA C sing N N 239 SER CA CB sing N N 240 SER CA HA sing N N 241 SER C O doub N N 242 SER C OXT sing N N 243 SER CB OG sing N N 244 SER CB HB2 sing N N 245 SER CB HB3 sing N N 246 SER OG HG sing N N 247 SER OXT HXT sing N N 248 THR N CA sing N N 249 THR N H sing N N 250 THR N H2 sing N N 251 THR CA C sing N N 252 THR CA CB sing N N 253 THR CA HA sing N N 254 THR C O doub N N 255 THR C OXT sing N N 256 THR CB OG1 sing N N 257 THR CB CG2 sing N N 258 THR CB HB sing N N 259 THR OG1 HG1 sing N N 260 THR CG2 HG21 sing N N 261 THR CG2 HG22 sing N N 262 THR CG2 HG23 sing N N 263 THR OXT HXT sing N N 264 TYR N CA sing N N 265 TYR N H sing N N 266 TYR N H2 sing N N 267 TYR CA C sing N N 268 TYR CA CB sing N N 269 TYR CA HA sing N N 270 TYR C O doub N N 271 TYR C OXT sing N N 272 TYR CB CG sing N N 273 TYR CB HB2 sing N N 274 TYR CB HB3 sing N N 275 TYR CG CD1 doub Y N 276 TYR CG CD2 sing Y N 277 TYR CD1 CE1 sing Y N 278 TYR CD1 HD1 sing N N 279 TYR CD2 CE2 doub Y N 280 TYR CD2 HD2 sing N N 281 TYR CE1 CZ doub Y N 282 TYR CE1 HE1 sing N N 283 TYR CE2 CZ sing Y N 284 TYR CE2 HE2 sing N N 285 TYR CZ OH sing N N 286 TYR OH HH sing N N 287 TYR OXT HXT sing N N 288 VAL N CA sing N N 289 VAL N H sing N N 290 VAL N H2 sing N N 291 VAL CA C sing N N 292 VAL CA CB sing N N 293 VAL CA HA sing N N 294 VAL C O doub N N 295 VAL C OXT sing N N 296 VAL CB CG1 sing N N 297 VAL CB CG2 sing N N 298 VAL CB HB sing N N 299 VAL CG1 HG11 sing N N 300 VAL CG1 HG12 sing N N 301 VAL CG1 HG13 sing N N 302 VAL CG2 HG21 sing N N 303 VAL CG2 HG22 sing N N 304 VAL CG2 HG23 sing N N 305 VAL OXT HXT sing N N 306 # _pdbx_audit_support.funding_organization 'Ministry of Science and Higher Education of the Russian Federation' _pdbx_audit_support.country 'Russian Federation' _pdbx_audit_support.grant_number MK-938.2020.4 _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 7ZZV _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_