data_7AER # _entry.id 7AER # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7AER pdb_00007aer 10.2210/pdb7aer/pdb WWPDB D_1292111145 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-12-30 2 'Structure model' 1 1 2024-10-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_entry_details 5 2 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7AER _pdbx_database_status.recvd_initial_deposition_date 2020-09-18 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB ;Structure 5YEP was re-built and re-refined fixing chain tracing in chain A and adding tri-AMPylation modification on Y104 of chains B and C ; 5YEP re-refinement PDB 'PDB entries for the same citation' 7AE2 unspecified PDB 'PDB entries for the same citation' 7AE6 unspecified PDB 'PDB entries for the same citation' 7AE8 unspecified PDB 'PDB entries for the same citation' 7AE9 unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Tamulaitiene, G.' 1 0000-0002-9794-3544 'Sasnauskas, G.' 2 0000-0002-3185-2682 'Songailiene, I.' 3 ? 'Juozapaitis, J.' 4 ? 'Siksnys, V.' 5 ? # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.unpublished_flag ? ? ? ? ? ? ? US ? ? primary Mol.Cell MOCEFL 2168 1097-2765 ? ? 80 ? 955 970.e7 'HEPN-MNT Toxin-Antitoxin System: The HEPN Ribonuclease Is Neutralized by OligoAMPylation.' 2020 ? 10.1016/j.molcel.2020.11.034 33290744 ? ? ? ? ? ? ? ? US ? ? 1 'J. Biol. Chem.' JBCHA3 0071 1083-351X ? ? 293 ? 6812 6823 ;Structure-function analyses reveal the molecular architecture and neutralization mechanism of a bacterial HEPN-MNT toxin-antitoxin system. ; 2018 ? 10.1074/jbc.RA118.002421 29555683 ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Songailiene, I.' 1 ? primary 'Juozapaitis, J.' 2 ? primary 'Tamulaitiene, G.' 3 ? primary 'Ruksenaite, A.' 4 ? primary 'Sulcius, S.' 5 ? primary 'Sasnauskas, G.' 6 ? primary 'Venclovas, C.' 7 ? primary 'Siksnys, V.' 8 ? 1 'Jia, X.' 9 ? 1 'Yao, J.' 10 ? 1 'Gao, Z.' 11 ? 1 'Liu, G.' 12 ? 1 'Dong, Y.H.' 13 ? 1 'Wang, X.' 14 ? 1 'Zhang, H.' 15 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Toxin-antitoxin system antidote Mnt family' 15723.268 1 ? ? ? ? 2 polymer man 'Toxin-antitoxin system toxin HepN family' 16253.215 3 ? ? ? ? 3 non-polymer syn 'ADENOSINE MONOPHOSPHATE' 347.221 6 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no yes ;(MSE)QQLNENKIIKLLRDNIPKLQLIYLFGSYSQGTQHRNSDIDIAVLAADTLDNIARWELAQKLASALDSDVDLVDLR SASTVLCQQVVTQGKQLWGTQQDDELFAVKTIS(MSE)YQHLQAERQAIIDDV(MSE)ANTAAKAHRGESL ; ;MQQLNENKIIKLLRDNIPKLQLIYLFGSYSQGTQHRNSDIDIAVLAADTLDNIARWELAQKLASALDSDVDLVDLRSAST VLCQQVVTQGKQLWGTQQDDELFAVKTISMYQHLQAERQAIIDDVMANTAAKAHRGESL ; A ? 2 'polypeptide(L)' no yes ;(MSE)NDIIINKIATIKRCIKRIQQVYGDGSQFKQDFTLQDSVILNLQRCCEACIDIANHINRQQQLGIPQSSRDSFTLL AQNNLITQPLSDNLKK(MSE)VGLRNIAVHDYQELNLDIVVHVVQHHLEDFEQFIDVIKAEHHHHHH ; ;MNDIIINKIATIKRCIKRIQQVYGDGSQFKQDFTLQDSVILNLQRCCEACIDIANHINRQQQLGIPQSSRDSFTLLAQNN LITQPLSDNLKKMVGLRNIAVHDYQELNLDIVVHVVQHHLEDFEQFIDVIKAEHHHHHH ; B,C,D ? # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name 'ADENOSINE MONOPHOSPHATE' _pdbx_entity_nonpoly.comp_id AMP # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 GLN n 1 3 GLN n 1 4 LEU n 1 5 ASN n 1 6 GLU n 1 7 ASN n 1 8 LYS n 1 9 ILE n 1 10 ILE n 1 11 LYS n 1 12 LEU n 1 13 LEU n 1 14 ARG n 1 15 ASP n 1 16 ASN n 1 17 ILE n 1 18 PRO n 1 19 LYS n 1 20 LEU n 1 21 GLN n 1 22 LEU n 1 23 ILE n 1 24 TYR n 1 25 LEU n 1 26 PHE n 1 27 GLY n 1 28 SER n 1 29 TYR n 1 30 SER n 1 31 GLN n 1 32 GLY n 1 33 THR n 1 34 GLN n 1 35 HIS n 1 36 ARG n 1 37 ASN n 1 38 SER n 1 39 ASP n 1 40 ILE n 1 41 ASP n 1 42 ILE n 1 43 ALA n 1 44 VAL n 1 45 LEU n 1 46 ALA n 1 47 ALA n 1 48 ASP n 1 49 THR n 1 50 LEU n 1 51 ASP n 1 52 ASN n 1 53 ILE n 1 54 ALA n 1 55 ARG n 1 56 TRP n 1 57 GLU n 1 58 LEU n 1 59 ALA n 1 60 GLN n 1 61 LYS n 1 62 LEU n 1 63 ALA n 1 64 SER n 1 65 ALA n 1 66 LEU n 1 67 ASP n 1 68 SER n 1 69 ASP n 1 70 VAL n 1 71 ASP n 1 72 LEU n 1 73 VAL n 1 74 ASP n 1 75 LEU n 1 76 ARG n 1 77 SER n 1 78 ALA n 1 79 SER n 1 80 THR n 1 81 VAL n 1 82 LEU n 1 83 CYS n 1 84 GLN n 1 85 GLN n 1 86 VAL n 1 87 VAL n 1 88 THR n 1 89 GLN n 1 90 GLY n 1 91 LYS n 1 92 GLN n 1 93 LEU n 1 94 TRP n 1 95 GLY n 1 96 THR n 1 97 GLN n 1 98 GLN n 1 99 ASP n 1 100 ASP n 1 101 GLU n 1 102 LEU n 1 103 PHE n 1 104 ALA n 1 105 VAL n 1 106 LYS n 1 107 THR n 1 108 ILE n 1 109 SER n 1 110 MSE n 1 111 TYR n 1 112 GLN n 1 113 HIS n 1 114 LEU n 1 115 GLN n 1 116 ALA n 1 117 GLU n 1 118 ARG n 1 119 GLN n 1 120 ALA n 1 121 ILE n 1 122 ILE n 1 123 ASP n 1 124 ASP n 1 125 VAL n 1 126 MSE n 1 127 ALA n 1 128 ASN n 1 129 THR n 1 130 ALA n 1 131 ALA n 1 132 LYS n 1 133 ALA n 1 134 HIS n 1 135 ARG n 1 136 GLY n 1 137 GLU n 1 138 SER n 1 139 LEU n 2 1 MSE n 2 2 ASN n 2 3 ASP n 2 4 ILE n 2 5 ILE n 2 6 ILE n 2 7 ASN n 2 8 LYS n 2 9 ILE n 2 10 ALA n 2 11 THR n 2 12 ILE n 2 13 LYS n 2 14 ARG n 2 15 CYS n 2 16 ILE n 2 17 LYS n 2 18 ARG n 2 19 ILE n 2 20 GLN n 2 21 GLN n 2 22 VAL n 2 23 TYR n 2 24 GLY n 2 25 ASP n 2 26 GLY n 2 27 SER n 2 28 GLN n 2 29 PHE n 2 30 LYS n 2 31 GLN n 2 32 ASP n 2 33 PHE n 2 34 THR n 2 35 LEU n 2 36 GLN n 2 37 ASP n 2 38 SER n 2 39 VAL n 2 40 ILE n 2 41 LEU n 2 42 ASN n 2 43 LEU n 2 44 GLN n 2 45 ARG n 2 46 CYS n 2 47 CYS n 2 48 GLU n 2 49 ALA n 2 50 CYS n 2 51 ILE n 2 52 ASP n 2 53 ILE n 2 54 ALA n 2 55 ASN n 2 56 HIS n 2 57 ILE n 2 58 ASN n 2 59 ARG n 2 60 GLN n 2 61 GLN n 2 62 GLN n 2 63 LEU n 2 64 GLY n 2 65 ILE n 2 66 PRO n 2 67 GLN n 2 68 SER n 2 69 SER n 2 70 ARG n 2 71 ASP n 2 72 SER n 2 73 PHE n 2 74 THR n 2 75 LEU n 2 76 LEU n 2 77 ALA n 2 78 GLN n 2 79 ASN n 2 80 ASN n 2 81 LEU n 2 82 ILE n 2 83 THR n 2 84 GLN n 2 85 PRO n 2 86 LEU n 2 87 SER n 2 88 ASP n 2 89 ASN n 2 90 LEU n 2 91 LYS n 2 92 LYS n 2 93 MSE n 2 94 VAL n 2 95 GLY n 2 96 LEU n 2 97 ARG n 2 98 ASN n 2 99 ILE n 2 100 ALA n 2 101 VAL n 2 102 HIS n 2 103 ASP n 2 104 TYR n 2 105 GLN n 2 106 GLU n 2 107 LEU n 2 108 ASN n 2 109 LEU n 2 110 ASP n 2 111 ILE n 2 112 VAL n 2 113 VAL n 2 114 HIS n 2 115 VAL n 2 116 VAL n 2 117 GLN n 2 118 HIS n 2 119 HIS n 2 120 LEU n 2 121 GLU n 2 122 ASP n 2 123 PHE n 2 124 GLU n 2 125 GLN n 2 126 PHE n 2 127 ILE n 2 128 ASP n 2 129 VAL n 2 130 ILE n 2 131 LYS n 2 132 ALA n 2 133 GLU n 2 134 HIS n 2 135 HIS n 2 136 HIS n 2 137 HIS n 2 138 HIS n 2 139 HIS n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 139 ? ? SO_3165 ? MR-1 ? ? ? ? 'Shewanella oneidensis (strain MR-1)' 211586 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 139 ? ? SO_3166 ? MR-1 ? ? ? ? 'Shewanella oneidensis (strain MR-1)' 211586 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 AMP non-polymer . 'ADENOSINE MONOPHOSPHATE' ? 'C10 H14 N5 O7 P' 347.221 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 1 MSE MET A . n A 1 2 GLN 2 2 2 GLN GLN A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 ASN 5 5 5 ASN ASN A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 ASN 7 7 7 ASN ASN A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 SER 30 30 ? ? ? A . n A 1 31 GLN 31 31 ? ? ? A . n A 1 32 GLY 32 32 ? ? ? A . n A 1 33 THR 33 33 ? ? ? A . n A 1 34 GLN 34 34 ? ? ? A . n A 1 35 HIS 35 35 ? ? ? A . n A 1 36 ARG 36 36 ? ? ? A . n A 1 37 ASN 37 37 ? ? ? A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 TRP 56 56 56 TRP TRP A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 CYS 83 83 83 CYS CYS A . n A 1 84 GLN 84 84 84 GLN GLN A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 THR 88 88 88 THR THR A . n A 1 89 GLN 89 89 89 GLN GLN A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 GLN 92 92 92 GLN GLN A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 TRP 94 94 94 TRP TRP A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 THR 96 96 96 THR THR A . n A 1 97 GLN 97 97 97 GLN GLN A . n A 1 98 GLN 98 98 98 GLN GLN A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 PHE 103 103 103 PHE PHE A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 THR 107 107 107 THR THR A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 MSE 110 110 110 MSE MSE A . n A 1 111 TYR 111 111 111 TYR TYR A . n A 1 112 GLN 112 112 112 GLN GLN A . n A 1 113 HIS 113 113 113 HIS HIS A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 GLN 115 115 115 GLN GLN A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 GLU 117 117 117 GLU GLU A . n A 1 118 ARG 118 118 118 ARG ARG A . n A 1 119 GLN 119 119 119 GLN GLN A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 ILE 121 121 121 ILE ILE A . n A 1 122 ILE 122 122 122 ILE ILE A . n A 1 123 ASP 123 123 123 ASP ASP A . n A 1 124 ASP 124 124 124 ASP ASP A . n A 1 125 VAL 125 125 125 VAL VAL A . n A 1 126 MSE 126 126 126 MSE MSE A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 ASN 128 128 ? ? ? A . n A 1 129 THR 129 129 ? ? ? A . n A 1 130 ALA 130 130 ? ? ? A . n A 1 131 ALA 131 131 ? ? ? A . n A 1 132 LYS 132 132 ? ? ? A . n A 1 133 ALA 133 133 ? ? ? A . n A 1 134 HIS 134 134 ? ? ? A . n A 1 135 ARG 135 135 ? ? ? A . n A 1 136 GLY 136 136 ? ? ? A . n A 1 137 GLU 137 137 ? ? ? A . n A 1 138 SER 138 138 ? ? ? A . n A 1 139 LEU 139 139 ? ? ? A . n B 2 1 MSE 1 1 1 MSE MSE B . n B 2 2 ASN 2 2 2 ASN ASN B . n B 2 3 ASP 3 3 3 ASP ASP B . n B 2 4 ILE 4 4 4 ILE ILE B . n B 2 5 ILE 5 5 5 ILE ILE B . n B 2 6 ILE 6 6 6 ILE ILE B . n B 2 7 ASN 7 7 7 ASN ASN B . n B 2 8 LYS 8 8 8 LYS LYS B . n B 2 9 ILE 9 9 9 ILE ILE B . n B 2 10 ALA 10 10 10 ALA ALA B . n B 2 11 THR 11 11 11 THR THR B . n B 2 12 ILE 12 12 12 ILE ILE B . n B 2 13 LYS 13 13 13 LYS LYS B . n B 2 14 ARG 14 14 14 ARG ARG B . n B 2 15 CYS 15 15 15 CYS CYS B . n B 2 16 ILE 16 16 16 ILE ILE B . n B 2 17 LYS 17 17 17 LYS LYS B . n B 2 18 ARG 18 18 18 ARG ARG B . n B 2 19 ILE 19 19 19 ILE ILE B . n B 2 20 GLN 20 20 20 GLN GLN B . n B 2 21 GLN 21 21 21 GLN GLN B . n B 2 22 VAL 22 22 22 VAL VAL B . n B 2 23 TYR 23 23 23 TYR TYR B . n B 2 24 GLY 24 24 24 GLY GLY B . n B 2 25 ASP 25 25 25 ASP ASP B . n B 2 26 GLY 26 26 26 GLY GLY B . n B 2 27 SER 27 27 27 SER SER B . n B 2 28 GLN 28 28 28 GLN GLN B . n B 2 29 PHE 29 29 29 PHE PHE B . n B 2 30 LYS 30 30 30 LYS LYS B . n B 2 31 GLN 31 31 31 GLN GLN B . n B 2 32 ASP 32 32 32 ASP ASP B . n B 2 33 PHE 33 33 33 PHE PHE B . n B 2 34 THR 34 34 34 THR THR B . n B 2 35 LEU 35 35 35 LEU LEU B . n B 2 36 GLN 36 36 36 GLN GLN B . n B 2 37 ASP 37 37 37 ASP ASP B . n B 2 38 SER 38 38 38 SER SER B . n B 2 39 VAL 39 39 39 VAL VAL B . n B 2 40 ILE 40 40 40 ILE ILE B . n B 2 41 LEU 41 41 41 LEU LEU B . n B 2 42 ASN 42 42 42 ASN ASN B . n B 2 43 LEU 43 43 43 LEU LEU B . n B 2 44 GLN 44 44 44 GLN GLN B . n B 2 45 ARG 45 45 45 ARG ARG B . n B 2 46 CYS 46 46 46 CYS CYS B . n B 2 47 CYS 47 47 47 CYS CYS B . n B 2 48 GLU 48 48 48 GLU GLU B . n B 2 49 ALA 49 49 49 ALA ALA B . n B 2 50 CYS 50 50 50 CYS CYS B . n B 2 51 ILE 51 51 51 ILE ILE B . n B 2 52 ASP 52 52 52 ASP ASP B . n B 2 53 ILE 53 53 53 ILE ILE B . n B 2 54 ALA 54 54 54 ALA ALA B . n B 2 55 ASN 55 55 55 ASN ASN B . n B 2 56 HIS 56 56 56 HIS HIS B . n B 2 57 ILE 57 57 57 ILE ILE B . n B 2 58 ASN 58 58 58 ASN ASN B . n B 2 59 ARG 59 59 59 ARG ARG B . n B 2 60 GLN 60 60 60 GLN GLN B . n B 2 61 GLN 61 61 61 GLN GLN B . n B 2 62 GLN 62 62 62 GLN GLN B . n B 2 63 LEU 63 63 63 LEU LEU B . n B 2 64 GLY 64 64 64 GLY GLY B . n B 2 65 ILE 65 65 65 ILE ILE B . n B 2 66 PRO 66 66 66 PRO PRO B . n B 2 67 GLN 67 67 67 GLN GLN B . n B 2 68 SER 68 68 68 SER SER B . n B 2 69 SER 69 69 69 SER SER B . n B 2 70 ARG 70 70 70 ARG ARG B . n B 2 71 ASP 71 71 71 ASP ASP B . n B 2 72 SER 72 72 72 SER SER B . n B 2 73 PHE 73 73 73 PHE PHE B . n B 2 74 THR 74 74 74 THR THR B . n B 2 75 LEU 75 75 75 LEU LEU B . n B 2 76 LEU 76 76 76 LEU LEU B . n B 2 77 ALA 77 77 77 ALA ALA B . n B 2 78 GLN 78 78 78 GLN GLN B . n B 2 79 ASN 79 79 79 ASN ASN B . n B 2 80 ASN 80 80 80 ASN ASN B . n B 2 81 LEU 81 81 81 LEU LEU B . n B 2 82 ILE 82 82 82 ILE ILE B . n B 2 83 THR 83 83 83 THR THR B . n B 2 84 GLN 84 84 84 GLN GLN B . n B 2 85 PRO 85 85 85 PRO PRO B . n B 2 86 LEU 86 86 86 LEU LEU B . n B 2 87 SER 87 87 87 SER SER B . n B 2 88 ASP 88 88 88 ASP ASP B . n B 2 89 ASN 89 89 89 ASN ASN B . n B 2 90 LEU 90 90 90 LEU LEU B . n B 2 91 LYS 91 91 91 LYS LYS B . n B 2 92 LYS 92 92 92 LYS LYS B . n B 2 93 MSE 93 93 93 MSE MSE B . n B 2 94 VAL 94 94 94 VAL VAL B . n B 2 95 GLY 95 95 95 GLY GLY B . n B 2 96 LEU 96 96 96 LEU LEU B . n B 2 97 ARG 97 97 97 ARG ARG B . n B 2 98 ASN 98 98 98 ASN ASN B . n B 2 99 ILE 99 99 99 ILE ILE B . n B 2 100 ALA 100 100 100 ALA ALA B . n B 2 101 VAL 101 101 101 VAL VAL B . n B 2 102 HIS 102 102 102 HIS HIS B . n B 2 103 ASP 103 103 103 ASP ASP B . n B 2 104 TYR 104 104 104 TYR TYR B . n B 2 105 GLN 105 105 105 GLN GLN B . n B 2 106 GLU 106 106 106 GLU GLU B . n B 2 107 LEU 107 107 107 LEU LEU B . n B 2 108 ASN 108 108 108 ASN ASN B . n B 2 109 LEU 109 109 109 LEU LEU B . n B 2 110 ASP 110 110 110 ASP ASP B . n B 2 111 ILE 111 111 111 ILE ILE B . n B 2 112 VAL 112 112 112 VAL VAL B . n B 2 113 VAL 113 113 113 VAL VAL B . n B 2 114 HIS 114 114 114 HIS HIS B . n B 2 115 VAL 115 115 115 VAL VAL B . n B 2 116 VAL 116 116 116 VAL VAL B . n B 2 117 GLN 117 117 117 GLN GLN B . n B 2 118 HIS 118 118 118 HIS HIS B . n B 2 119 HIS 119 119 119 HIS HIS B . n B 2 120 LEU 120 120 120 LEU LEU B . n B 2 121 GLU 121 121 121 GLU GLU B . n B 2 122 ASP 122 122 122 ASP ASP B . n B 2 123 PHE 123 123 123 PHE PHE B . n B 2 124 GLU 124 124 124 GLU GLU B . n B 2 125 GLN 125 125 125 GLN GLN B . n B 2 126 PHE 126 126 126 PHE PHE B . n B 2 127 ILE 127 127 127 ILE ILE B . n B 2 128 ASP 128 128 128 ASP ASP B . n B 2 129 VAL 129 129 129 VAL VAL B . n B 2 130 ILE 130 130 130 ILE ILE B . n B 2 131 LYS 131 131 131 LYS LYS B . n B 2 132 ALA 132 132 132 ALA ALA B . n B 2 133 GLU 133 133 133 GLU GLU B . n B 2 134 HIS 134 134 ? ? ? B . n B 2 135 HIS 135 135 ? ? ? B . n B 2 136 HIS 136 136 ? ? ? B . n B 2 137 HIS 137 137 ? ? ? B . n B 2 138 HIS 138 138 ? ? ? B . n B 2 139 HIS 139 139 ? ? ? B . n C 2 1 MSE 1 1 ? ? ? C . n C 2 2 ASN 2 2 2 ASN ASN C . n C 2 3 ASP 3 3 3 ASP ASP C . n C 2 4 ILE 4 4 4 ILE ILE C . n C 2 5 ILE 5 5 5 ILE ILE C . n C 2 6 ILE 6 6 6 ILE ILE C . n C 2 7 ASN 7 7 7 ASN ASN C . n C 2 8 LYS 8 8 8 LYS LYS C . n C 2 9 ILE 9 9 9 ILE ILE C . n C 2 10 ALA 10 10 10 ALA ALA C . n C 2 11 THR 11 11 11 THR THR C . n C 2 12 ILE 12 12 12 ILE ILE C . n C 2 13 LYS 13 13 13 LYS LYS C . n C 2 14 ARG 14 14 14 ARG ARG C . n C 2 15 CYS 15 15 15 CYS CYS C . n C 2 16 ILE 16 16 16 ILE ILE C . n C 2 17 LYS 17 17 17 LYS LYS C . n C 2 18 ARG 18 18 18 ARG ARG C . n C 2 19 ILE 19 19 19 ILE ILE C . n C 2 20 GLN 20 20 20 GLN GLN C . n C 2 21 GLN 21 21 21 GLN GLN C . n C 2 22 VAL 22 22 22 VAL VAL C . n C 2 23 TYR 23 23 23 TYR TYR C . n C 2 24 GLY 24 24 24 GLY GLY C . n C 2 25 ASP 25 25 25 ASP ASP C . n C 2 26 GLY 26 26 26 GLY GLY C . n C 2 27 SER 27 27 27 SER SER C . n C 2 28 GLN 28 28 28 GLN GLN C . n C 2 29 PHE 29 29 29 PHE PHE C . n C 2 30 LYS 30 30 30 LYS LYS C . n C 2 31 GLN 31 31 31 GLN GLN C . n C 2 32 ASP 32 32 32 ASP ASP C . n C 2 33 PHE 33 33 33 PHE PHE C . n C 2 34 THR 34 34 34 THR THR C . n C 2 35 LEU 35 35 35 LEU LEU C . n C 2 36 GLN 36 36 36 GLN GLN C . n C 2 37 ASP 37 37 37 ASP ASP C . n C 2 38 SER 38 38 38 SER SER C . n C 2 39 VAL 39 39 39 VAL VAL C . n C 2 40 ILE 40 40 40 ILE ILE C . n C 2 41 LEU 41 41 41 LEU LEU C . n C 2 42 ASN 42 42 42 ASN ASN C . n C 2 43 LEU 43 43 43 LEU LEU C . n C 2 44 GLN 44 44 44 GLN GLN C . n C 2 45 ARG 45 45 45 ARG ARG C . n C 2 46 CYS 46 46 46 CYS CYS C . n C 2 47 CYS 47 47 47 CYS CYS C . n C 2 48 GLU 48 48 48 GLU GLU C . n C 2 49 ALA 49 49 49 ALA ALA C . n C 2 50 CYS 50 50 50 CYS CYS C . n C 2 51 ILE 51 51 51 ILE ILE C . n C 2 52 ASP 52 52 52 ASP ASP C . n C 2 53 ILE 53 53 53 ILE ILE C . n C 2 54 ALA 54 54 54 ALA ALA C . n C 2 55 ASN 55 55 55 ASN ASN C . n C 2 56 HIS 56 56 56 HIS HIS C . n C 2 57 ILE 57 57 57 ILE ILE C . n C 2 58 ASN 58 58 58 ASN ASN C . n C 2 59 ARG 59 59 59 ARG ARG C . n C 2 60 GLN 60 60 60 GLN GLN C . n C 2 61 GLN 61 61 61 GLN GLN C . n C 2 62 GLN 62 62 62 GLN GLN C . n C 2 63 LEU 63 63 63 LEU LEU C . n C 2 64 GLY 64 64 64 GLY GLY C . n C 2 65 ILE 65 65 65 ILE ILE C . n C 2 66 PRO 66 66 66 PRO PRO C . n C 2 67 GLN 67 67 67 GLN GLN C . n C 2 68 SER 68 68 68 SER SER C . n C 2 69 SER 69 69 69 SER SER C . n C 2 70 ARG 70 70 70 ARG ARG C . n C 2 71 ASP 71 71 71 ASP ASP C . n C 2 72 SER 72 72 72 SER SER C . n C 2 73 PHE 73 73 73 PHE PHE C . n C 2 74 THR 74 74 74 THR THR C . n C 2 75 LEU 75 75 75 LEU LEU C . n C 2 76 LEU 76 76 76 LEU LEU C . n C 2 77 ALA 77 77 77 ALA ALA C . n C 2 78 GLN 78 78 78 GLN GLN C . n C 2 79 ASN 79 79 79 ASN ASN C . n C 2 80 ASN 80 80 80 ASN ASN C . n C 2 81 LEU 81 81 81 LEU LEU C . n C 2 82 ILE 82 82 82 ILE ILE C . n C 2 83 THR 83 83 83 THR THR C . n C 2 84 GLN 84 84 84 GLN GLN C . n C 2 85 PRO 85 85 85 PRO PRO C . n C 2 86 LEU 86 86 86 LEU LEU C . n C 2 87 SER 87 87 87 SER SER C . n C 2 88 ASP 88 88 88 ASP ASP C . n C 2 89 ASN 89 89 89 ASN ASN C . n C 2 90 LEU 90 90 90 LEU LEU C . n C 2 91 LYS 91 91 91 LYS LYS C . n C 2 92 LYS 92 92 92 LYS LYS C . n C 2 93 MSE 93 93 93 MSE MSE C . n C 2 94 VAL 94 94 94 VAL VAL C . n C 2 95 GLY 95 95 95 GLY GLY C . n C 2 96 LEU 96 96 96 LEU LEU C . n C 2 97 ARG 97 97 97 ARG ARG C . n C 2 98 ASN 98 98 98 ASN ASN C . n C 2 99 ILE 99 99 99 ILE ILE C . n C 2 100 ALA 100 100 100 ALA ALA C . n C 2 101 VAL 101 101 101 VAL VAL C . n C 2 102 HIS 102 102 102 HIS HIS C . n C 2 103 ASP 103 103 103 ASP ASP C . n C 2 104 TYR 104 104 104 TYR TYR C . n C 2 105 GLN 105 105 105 GLN GLN C . n C 2 106 GLU 106 106 106 GLU GLU C . n C 2 107 LEU 107 107 107 LEU LEU C . n C 2 108 ASN 108 108 108 ASN ASN C . n C 2 109 LEU 109 109 109 LEU LEU C . n C 2 110 ASP 110 110 110 ASP ASP C . n C 2 111 ILE 111 111 111 ILE ILE C . n C 2 112 VAL 112 112 112 VAL VAL C . n C 2 113 VAL 113 113 113 VAL VAL C . n C 2 114 HIS 114 114 114 HIS HIS C . n C 2 115 VAL 115 115 115 VAL VAL C . n C 2 116 VAL 116 116 116 VAL VAL C . n C 2 117 GLN 117 117 117 GLN GLN C . n C 2 118 HIS 118 118 118 HIS HIS C . n C 2 119 HIS 119 119 119 HIS HIS C . n C 2 120 LEU 120 120 120 LEU LEU C . n C 2 121 GLU 121 121 121 GLU GLU C . n C 2 122 ASP 122 122 122 ASP ASP C . n C 2 123 PHE 123 123 123 PHE PHE C . n C 2 124 GLU 124 124 124 GLU GLU C . n C 2 125 GLN 125 125 125 GLN GLN C . n C 2 126 PHE 126 126 126 PHE PHE C . n C 2 127 ILE 127 127 127 ILE ILE C . n C 2 128 ASP 128 128 128 ASP ASP C . n C 2 129 VAL 129 129 129 VAL VAL C . n C 2 130 ILE 130 130 130 ILE ILE C . n C 2 131 LYS 131 131 131 LYS LYS C . n C 2 132 ALA 132 132 132 ALA ALA C . n C 2 133 GLU 133 133 133 GLU GLU C . n C 2 134 HIS 134 134 ? ? ? C . n C 2 135 HIS 135 135 ? ? ? C . n C 2 136 HIS 136 136 ? ? ? C . n C 2 137 HIS 137 137 ? ? ? C . n C 2 138 HIS 138 138 ? ? ? C . n C 2 139 HIS 139 139 ? ? ? C . n D 2 1 MSE 1 1 ? ? ? D . n D 2 2 ASN 2 2 2 ASN ASN D . n D 2 3 ASP 3 3 3 ASP ASP D . n D 2 4 ILE 4 4 4 ILE ILE D . n D 2 5 ILE 5 5 5 ILE ILE D . n D 2 6 ILE 6 6 6 ILE ILE D . n D 2 7 ASN 7 7 7 ASN ASN D . n D 2 8 LYS 8 8 8 LYS LYS D . n D 2 9 ILE 9 9 9 ILE ILE D . n D 2 10 ALA 10 10 10 ALA ALA D . n D 2 11 THR 11 11 11 THR THR D . n D 2 12 ILE 12 12 12 ILE ILE D . n D 2 13 LYS 13 13 13 LYS LYS D . n D 2 14 ARG 14 14 14 ARG ARG D . n D 2 15 CYS 15 15 15 CYS CYS D . n D 2 16 ILE 16 16 16 ILE ILE D . n D 2 17 LYS 17 17 17 LYS LYS D . n D 2 18 ARG 18 18 18 ARG ARG D . n D 2 19 ILE 19 19 19 ILE ILE D . n D 2 20 GLN 20 20 20 GLN GLN D . n D 2 21 GLN 21 21 21 GLN GLN D . n D 2 22 VAL 22 22 22 VAL VAL D . n D 2 23 TYR 23 23 23 TYR TYR D . n D 2 24 GLY 24 24 24 GLY GLY D . n D 2 25 ASP 25 25 25 ASP ASP D . n D 2 26 GLY 26 26 26 GLY GLY D . n D 2 27 SER 27 27 27 SER SER D . n D 2 28 GLN 28 28 28 GLN GLN D . n D 2 29 PHE 29 29 29 PHE PHE D . n D 2 30 LYS 30 30 30 LYS LYS D . n D 2 31 GLN 31 31 31 GLN GLN D . n D 2 32 ASP 32 32 32 ASP ASP D . n D 2 33 PHE 33 33 33 PHE PHE D . n D 2 34 THR 34 34 34 THR THR D . n D 2 35 LEU 35 35 35 LEU LEU D . n D 2 36 GLN 36 36 36 GLN GLN D . n D 2 37 ASP 37 37 37 ASP ASP D . n D 2 38 SER 38 38 38 SER SER D . n D 2 39 VAL 39 39 39 VAL VAL D . n D 2 40 ILE 40 40 40 ILE ILE D . n D 2 41 LEU 41 41 41 LEU LEU D . n D 2 42 ASN 42 42 42 ASN ASN D . n D 2 43 LEU 43 43 43 LEU LEU D . n D 2 44 GLN 44 44 44 GLN GLN D . n D 2 45 ARG 45 45 45 ARG ARG D . n D 2 46 CYS 46 46 46 CYS CYS D . n D 2 47 CYS 47 47 47 CYS CYS D . n D 2 48 GLU 48 48 48 GLU GLU D . n D 2 49 ALA 49 49 49 ALA ALA D . n D 2 50 CYS 50 50 50 CYS CYS D . n D 2 51 ILE 51 51 51 ILE ILE D . n D 2 52 ASP 52 52 52 ASP ASP D . n D 2 53 ILE 53 53 53 ILE ILE D . n D 2 54 ALA 54 54 54 ALA ALA D . n D 2 55 ASN 55 55 55 ASN ASN D . n D 2 56 HIS 56 56 56 HIS HIS D . n D 2 57 ILE 57 57 57 ILE ILE D . n D 2 58 ASN 58 58 58 ASN ASN D . n D 2 59 ARG 59 59 59 ARG ARG D . n D 2 60 GLN 60 60 60 GLN GLN D . n D 2 61 GLN 61 61 61 GLN GLN D . n D 2 62 GLN 62 62 62 GLN GLN D . n D 2 63 LEU 63 63 63 LEU LEU D . n D 2 64 GLY 64 64 64 GLY GLY D . n D 2 65 ILE 65 65 65 ILE ILE D . n D 2 66 PRO 66 66 66 PRO PRO D . n D 2 67 GLN 67 67 67 GLN GLN D . n D 2 68 SER 68 68 68 SER SER D . n D 2 69 SER 69 69 69 SER SER D . n D 2 70 ARG 70 70 70 ARG ARG D . n D 2 71 ASP 71 71 71 ASP ASP D . n D 2 72 SER 72 72 72 SER SER D . n D 2 73 PHE 73 73 73 PHE PHE D . n D 2 74 THR 74 74 74 THR THR D . n D 2 75 LEU 75 75 75 LEU LEU D . n D 2 76 LEU 76 76 76 LEU LEU D . n D 2 77 ALA 77 77 77 ALA ALA D . n D 2 78 GLN 78 78 78 GLN GLN D . n D 2 79 ASN 79 79 79 ASN ASN D . n D 2 80 ASN 80 80 80 ASN ASN D . n D 2 81 LEU 81 81 81 LEU LEU D . n D 2 82 ILE 82 82 82 ILE ILE D . n D 2 83 THR 83 83 83 THR THR D . n D 2 84 GLN 84 84 84 GLN GLN D . n D 2 85 PRO 85 85 85 PRO PRO D . n D 2 86 LEU 86 86 86 LEU LEU D . n D 2 87 SER 87 87 87 SER SER D . n D 2 88 ASP 88 88 88 ASP ASP D . n D 2 89 ASN 89 89 89 ASN ASN D . n D 2 90 LEU 90 90 90 LEU LEU D . n D 2 91 LYS 91 91 91 LYS LYS D . n D 2 92 LYS 92 92 92 LYS LYS D . n D 2 93 MSE 93 93 93 MSE MSE D . n D 2 94 VAL 94 94 94 VAL VAL D . n D 2 95 GLY 95 95 95 GLY GLY D . n D 2 96 LEU 96 96 96 LEU LEU D . n D 2 97 ARG 97 97 97 ARG ARG D . n D 2 98 ASN 98 98 98 ASN ASN D . n D 2 99 ILE 99 99 99 ILE ILE D . n D 2 100 ALA 100 100 100 ALA ALA D . n D 2 101 VAL 101 101 101 VAL VAL D . n D 2 102 HIS 102 102 102 HIS HIS D . n D 2 103 ASP 103 103 103 ASP ASP D . n D 2 104 TYR 104 104 104 TYR TYR D . n D 2 105 GLN 105 105 105 GLN GLN D . n D 2 106 GLU 106 106 106 GLU GLU D . n D 2 107 LEU 107 107 107 LEU LEU D . n D 2 108 ASN 108 108 108 ASN ASN D . n D 2 109 LEU 109 109 109 LEU LEU D . n D 2 110 ASP 110 110 110 ASP ASP D . n D 2 111 ILE 111 111 111 ILE ILE D . n D 2 112 VAL 112 112 112 VAL VAL D . n D 2 113 VAL 113 113 113 VAL VAL D . n D 2 114 HIS 114 114 114 HIS HIS D . n D 2 115 VAL 115 115 115 VAL VAL D . n D 2 116 VAL 116 116 116 VAL VAL D . n D 2 117 GLN 117 117 117 GLN GLN D . n D 2 118 HIS 118 118 118 HIS HIS D . n D 2 119 HIS 119 119 119 HIS HIS D . n D 2 120 LEU 120 120 120 LEU LEU D . n D 2 121 GLU 121 121 121 GLU GLU D . n D 2 122 ASP 122 122 122 ASP ASP D . n D 2 123 PHE 123 123 123 PHE PHE D . n D 2 124 GLU 124 124 124 GLU GLU D . n D 2 125 GLN 125 125 125 GLN GLN D . n D 2 126 PHE 126 126 126 PHE PHE D . n D 2 127 ILE 127 127 127 ILE ILE D . n D 2 128 ASP 128 128 128 ASP ASP D . n D 2 129 VAL 129 129 129 VAL VAL D . n D 2 130 ILE 130 130 130 ILE ILE D . n D 2 131 LYS 131 131 131 LYS LYS D . n D 2 132 ALA 132 132 132 ALA ALA D . n D 2 133 GLU 133 133 133 GLU GLU D . n D 2 134 HIS 134 134 ? ? ? D . n D 2 135 HIS 135 135 ? ? ? D . n D 2 136 HIS 136 136 ? ? ? D . n D 2 137 HIS 137 137 ? ? ? D . n D 2 138 HIS 138 138 ? ? ? D . n D 2 139 HIS 139 139 ? ? ? D . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id AMP _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id AMP _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code E 3 AMP 1 201 201 AMP AMP B . F 3 AMP 1 202 202 AMP AMP B . G 3 AMP 1 203 203 AMP AMP B . H 3 AMP 1 201 201 AMP AMP C . I 3 AMP 1 202 202 AMP AMP C . J 3 AMP 1 203 203 AMP AMP C . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A MSE 1 ? CG ? A MSE 1 CG 2 1 Y 1 A MSE 1 ? SE ? A MSE 1 SE 3 1 Y 1 A MSE 1 ? CE ? A MSE 1 CE 4 1 Y 1 A GLN 2 ? CG ? A GLN 2 CG 5 1 Y 1 A GLN 2 ? CD ? A GLN 2 CD 6 1 Y 1 A GLN 2 ? OE1 ? A GLN 2 OE1 7 1 Y 1 A GLN 2 ? NE2 ? A GLN 2 NE2 8 1 Y 1 A GLN 3 ? CG ? A GLN 3 CG 9 1 Y 1 A GLN 3 ? CD ? A GLN 3 CD 10 1 Y 1 A GLN 3 ? OE1 ? A GLN 3 OE1 11 1 Y 1 A GLN 3 ? NE2 ? A GLN 3 NE2 12 1 Y 1 A LEU 4 ? CG ? A LEU 4 CG 13 1 Y 1 A LEU 4 ? CD1 ? A LEU 4 CD1 14 1 Y 1 A LEU 4 ? CD2 ? A LEU 4 CD2 15 1 Y 1 B LYS 30 ? CG ? B LYS 30 CG 16 1 Y 1 B LYS 30 ? CD ? B LYS 30 CD 17 1 Y 1 B LYS 30 ? CE ? B LYS 30 CE 18 1 Y 1 B LYS 30 ? NZ ? B LYS 30 NZ 19 1 Y 1 B GLN 67 ? CG ? B GLN 67 CG 20 1 Y 1 B GLN 67 ? CD ? B GLN 67 CD 21 1 Y 1 B GLN 67 ? OE1 ? B GLN 67 OE1 22 1 Y 1 B GLN 67 ? NE2 ? B GLN 67 NE2 23 1 Y 1 B GLU 121 ? CG ? B GLU 121 CG 24 1 Y 1 B GLU 121 ? CD ? B GLU 121 CD 25 1 Y 1 B GLU 121 ? OE1 ? B GLU 121 OE1 26 1 Y 1 B GLU 121 ? OE2 ? B GLU 121 OE2 27 1 Y 1 B GLU 133 ? CG ? B GLU 133 CG 28 1 Y 1 B GLU 133 ? CD ? B GLU 133 CD 29 1 Y 1 B GLU 133 ? OE1 ? B GLU 133 OE1 30 1 Y 1 B GLU 133 ? OE2 ? B GLU 133 OE2 31 1 Y 1 C ASN 2 ? CG ? C ASN 2 CG 32 1 Y 1 C ASN 2 ? OD1 ? C ASN 2 OD1 33 1 Y 1 C ASN 2 ? ND2 ? C ASN 2 ND2 34 1 Y 1 C LYS 17 ? CG ? C LYS 17 CG 35 1 Y 1 C LYS 17 ? CD ? C LYS 17 CD 36 1 Y 1 C LYS 17 ? CE ? C LYS 17 CE 37 1 Y 1 C LYS 17 ? NZ ? C LYS 17 NZ 38 1 Y 1 C GLN 60 ? CG ? C GLN 60 CG 39 1 Y 1 C GLN 60 ? CD ? C GLN 60 CD 40 1 Y 1 C GLN 60 ? OE1 ? C GLN 60 OE1 41 1 Y 1 C GLN 60 ? NE2 ? C GLN 60 NE2 42 1 Y 1 C LYS 91 ? CG ? C LYS 91 CG 43 1 Y 1 C LYS 91 ? CD ? C LYS 91 CD 44 1 Y 1 C LYS 91 ? CE ? C LYS 91 CE 45 1 Y 1 C LYS 91 ? NZ ? C LYS 91 NZ 46 1 Y 1 C LYS 92 ? CG ? C LYS 92 CG 47 1 Y 1 C LYS 92 ? CD ? C LYS 92 CD 48 1 Y 1 C LYS 92 ? CE ? C LYS 92 CE 49 1 Y 1 C LYS 92 ? NZ ? C LYS 92 NZ 50 1 Y 1 C GLU 106 ? CG ? C GLU 106 CG 51 1 Y 1 C GLU 106 ? CD ? C GLU 106 CD 52 1 Y 1 C GLU 106 ? OE1 ? C GLU 106 OE1 53 1 Y 1 C GLU 106 ? OE2 ? C GLU 106 OE2 54 1 Y 1 C LYS 131 ? CG ? C LYS 131 CG 55 1 Y 1 C LYS 131 ? CD ? C LYS 131 CD 56 1 Y 1 C LYS 131 ? CE ? C LYS 131 CE 57 1 Y 1 C LYS 131 ? NZ ? C LYS 131 NZ 58 1 Y 1 C GLU 133 ? CG ? C GLU 133 CG 59 1 Y 1 C GLU 133 ? CD ? C GLU 133 CD 60 1 Y 1 C GLU 133 ? OE1 ? C GLU 133 OE1 61 1 Y 1 C GLU 133 ? OE2 ? C GLU 133 OE2 62 1 Y 1 D LYS 17 ? CG ? D LYS 17 CG 63 1 Y 1 D LYS 17 ? CD ? D LYS 17 CD 64 1 Y 1 D LYS 17 ? CE ? D LYS 17 CE 65 1 Y 1 D LYS 17 ? NZ ? D LYS 17 NZ 66 1 Y 1 D GLN 21 ? CG ? D GLN 21 CG 67 1 Y 1 D GLN 21 ? CD ? D GLN 21 CD 68 1 Y 1 D GLN 21 ? OE1 ? D GLN 21 OE1 69 1 Y 1 D GLN 21 ? NE2 ? D GLN 21 NE2 70 1 Y 1 D GLN 28 ? CG ? D GLN 28 CG 71 1 Y 1 D GLN 28 ? CD ? D GLN 28 CD 72 1 Y 1 D GLN 28 ? OE1 ? D GLN 28 OE1 73 1 Y 1 D GLN 28 ? NE2 ? D GLN 28 NE2 74 1 Y 1 D GLN 31 ? CG ? D GLN 31 CG 75 1 Y 1 D GLN 31 ? CD ? D GLN 31 CD 76 1 Y 1 D GLN 31 ? OE1 ? D GLN 31 OE1 77 1 Y 1 D GLN 31 ? NE2 ? D GLN 31 NE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? phenix-1.12-2829 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? SHELXCD ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7AER _cell.details ? _cell.formula_units_Z ? _cell.length_a 56.610 _cell.length_a_esd ? _cell.length_b 224.380 _cell.length_b_esd ? _cell.length_c 53.310 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7AER _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7AER _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.64 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 53.46 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M Bicine (pH 8.6), 14% PEG6000 and 8% Ethlene glycol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 S 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-04-10 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9788 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL19U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9788 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL19U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7AER _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.000 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14273 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.600 _reflns.pdbx_Rmerge_I_obs 0.06500 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.9300 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 3.00 _reflns_shell.d_res_low 3.08 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.510 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1031 _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.648 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.949 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 206.290 _refine.B_iso_mean 72.3087 _refine.B_iso_min 31.410 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7AER _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.0000 _refine.ls_d_res_low 48.1500 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 14270 _refine.ls_number_reflns_R_free 711 _refine.ls_number_reflns_R_work 13559 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.8000 _refine.ls_percent_reflns_R_free 4.9800 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2289 _refine.ls_R_factor_R_free 0.2725 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2265 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.360 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 29.8500 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4500 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 3.0000 _refine_hist.d_res_low 48.1500 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 4199 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 516 _refine_hist.pdbx_B_iso_mean_ligand 71.27 _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 4067 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 132 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.002 ? 4265 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.552 ? 5804 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.037 ? 693 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 735 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 13.316 ? 2581 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.pdbx_weight _refine_ls_restr_ncs.pdbx_ens_id 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 1 TORSIONAL ? B 288 10.952 ? 1 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 2 TORSIONAL ? C 288 10.952 ? 1 'X-RAY DIFFRACTION' 3 ? ? ? ? ? 3 TORSIONAL ? D 288 10.952 ? 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 4 TORSIONAL ? B 800 10.952 ? 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 5 TORSIONAL ? C 800 10.952 ? 2 'X-RAY DIFFRACTION' 3 ? ? ? ? ? 6 TORSIONAL ? D 800 10.952 ? 2 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 7 TORSIONAL ? B 146 10.952 ? 3 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 8 TORSIONAL ? C 146 10.952 ? 3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? 9 TORSIONAL ? D 146 10.952 ? 3 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 3.0000 3.2316 . . 137 2625 100.0000 . . . 0.3341 0.0000 0.2989 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2316 3.5567 . . 141 2689 100.0000 . . . 0.3621 0.0000 0.2784 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.5567 4.0712 . . 140 2675 100.0000 . . . 0.2901 0.0000 0.2362 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.0712 5.1283 . . 143 2710 100.0000 . . . 0.2414 0.0000 0.2076 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.1283 48.1500 . . 150 2860 100.0000 . . . 0.2456 0.0000 0.2035 . . . . . . . . . . . # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 '(chain B and (resid 112 through 130 or (resid 131 through 133 and (name N or name CA or name C or name O or name CB ))))' 1 2 ;(chain C and (resid 112 through 120 or (resid 121 and (name N or name CA or name C or name O or name CB )) or resid 122 through 133)) ; 1 3 ;(chain D and (resid 112 through 120 or (resid 121 and (name N or name CA or name C or name O or name CB )) or resid 122 through 130 or (resid 131 through 133 and (name N or name CA or name C or name O or name CB )))) ; 2 1 ;(chain B and ((resid 2 and (name N or name CA or name C or name O or name CB )) or resid 3 through 16 or (resid 17 and (name N or name CA or name C or name O or name CB )) or resid 18 through 20 or (resid 21 and (name N or name CA or name C or name O or name CB )) or resid 22 through 27 or (resid 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 30 or (resid 31 and (name N or name CA or name C or name O or name CB )) or resid 32 through 59 or (resid 60 and (name N or name CA or name C or name O or name CB )))) ; 2 2 ;(chain C and (resid 2 through 20 or (resid 21 and (name N or name CA or name C or name O or name CB )) or resid 22 through 27 or (resid 28 and (name N or name CA or name C or name O or name CB )) or resid 29 or (resid 30 through 31 and (name N or name CA or name C or name O or name CB )) or resid 32 through 60)) ; 2 3 ;(chain D and ((resid 2 and (name N or name CA or name C or name O or name CB )) or resid 3 through 29 or (resid 30 through 31 and (name N or name CA or name C or name O or name CB )) or resid 32 through 59 or (resid 60 and (name N or name CA or name C or name O or name CB )))) ; 3 1 '(chain B and (resid 81 through 90 or (resid 91 and (name N or name CA or name C or name O or name CB ))))' 3 2 '(chain C and resid 81 through 91)' 3 3 '(chain D and (resid 81 through 90 or (resid 91 and (name N or name CA or name C or name O or name CB ))))' # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.selection_details _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.end_auth_comp_id 1 1 1 ? B 0 B 0 '(chain B and (resid 112 through 130 or (resid 131 through 133 and (name N or name CA or name C or name O or name CB ))))' ? ? ? ? ? ? ? ? ? ? 1 2 1 ? C 112 C 120 ;(chain C and (resid 112 through 120 or (resid 121 and (name N or name CA or name C or name O or name CB )) or resid 122 through 133)) ; ? ? ? ? ? ? ? ? ? ? 1 2 2 ? C 121 C 121 ;(chain C and (resid 112 through 120 or (resid 121 and (name N or name CA or name C or name O or name CB )) or resid 122 through 133)) ; ? ? ? ? ? ? ? ? ? ? 1 2 3 ? C 2 C 203 ;(chain C and (resid 112 through 120 or (resid 121 and (name N or name CA or name C or name O or name CB )) or resid 122 through 133)) ; ? ? ? ? ? ? ? ? ? ? 1 2 4 ? C 2 C 203 ;(chain C and (resid 112 through 120 or (resid 121 and (name N or name CA or name C or name O or name CB )) or resid 122 through 133)) ; ? ? ? ? ? ? ? ? ? ? 1 2 5 ? C 2 C 203 ;(chain C and (resid 112 through 120 or (resid 121 and (name N or name CA or name C or name O or name CB )) or resid 122 through 133)) ; ? ? ? ? ? ? ? ? ? ? 1 2 6 ? C 2 C 203 ;(chain C and (resid 112 through 120 or (resid 121 and (name N or name CA or name C or name O or name CB )) or resid 122 through 133)) ; ? ? ? ? ? ? ? ? ? ? 1 3 1 ? D 112 D 120 ;(chain D and (resid 112 through 120 or (resid 121 and (name N or name CA or name C or name O or name CB )) or resid 122 through 130 or (resid 131 through 133 and (name N or name CA or name C or name O or name CB )))) ; ? ? ? ? ? ? ? ? ? ? 1 3 2 ? D 121 D 121 ;(chain D and (resid 112 through 120 or (resid 121 and (name N or name CA or name C or name O or name CB )) or resid 122 through 130 or (resid 131 through 133 and (name N or name CA or name C or name O or name CB )))) ; ? ? ? ? ? ? ? ? ? ? 1 3 3 ? D 2 D 133 ;(chain D and (resid 112 through 120 or (resid 121 and (name N or name CA or name C or name O or name CB )) or resid 122 through 130 or (resid 131 through 133 and (name N or name CA or name C or name O or name CB )))) ; ? ? ? ? ? ? ? ? ? ? 1 3 4 ? D 2 D 133 ;(chain D and (resid 112 through 120 or (resid 121 and (name N or name CA or name C or name O or name CB )) or resid 122 through 130 or (resid 131 through 133 and (name N or name CA or name C or name O or name CB )))) ; ? ? ? ? ? ? ? ? ? ? 1 3 5 ? D 2 D 133 ;(chain D and (resid 112 through 120 or (resid 121 and (name N or name CA or name C or name O or name CB )) or resid 122 through 130 or (resid 131 through 133 and (name N or name CA or name C or name O or name CB )))) ; ? ? ? ? ? ? ? ? ? ? 1 3 6 ? D 2 D 133 ;(chain D and (resid 112 through 120 or (resid 121 and (name N or name CA or name C or name O or name CB )) or resid 122 through 130 or (resid 131 through 133 and (name N or name CA or name C or name O or name CB )))) ; ? ? ? ? ? ? ? ? ? ? 2 1 1 ? B 2 B 2 ;(chain B and ((resid 2 and (name N or name CA or name C or name O or name CB )) or resid 3 through 16 or (resid 17 and (name N or name CA or name C or name O or name CB )) or resid 18 through 20 or (resid 21 and (name N or name CA or name C or name O or name CB )) or resid 22 through 27 or (resid 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 30 or (resid 31 and (name N or name CA or name C or name O or name CB )) or resid 32 through 59 or (resid 60 and (name N or name CA or name C or name O or name CB )))) ; ? ? ? ? ? ? ? ? ? ? 2 1 2 ? B 1 B 203 ;(chain B and ((resid 2 and (name N or name CA or name C or name O or name CB )) or resid 3 through 16 or (resid 17 and (name N or name CA or name C or name O or name CB )) or resid 18 through 20 or (resid 21 and (name N or name CA or name C or name O or name CB )) or resid 22 through 27 or (resid 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 30 or (resid 31 and (name N or name CA or name C or name O or name CB )) or resid 32 through 59 or (resid 60 and (name N or name CA or name C or name O or name CB )))) ; ? ? ? ? ? ? ? ? ? ? 2 1 3 ? B 1 B 203 ;(chain B and ((resid 2 and (name N or name CA or name C or name O or name CB )) or resid 3 through 16 or (resid 17 and (name N or name CA or name C or name O or name CB )) or resid 18 through 20 or (resid 21 and (name N or name CA or name C or name O or name CB )) or resid 22 through 27 or (resid 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 30 or (resid 31 and (name N or name CA or name C or name O or name CB )) or resid 32 through 59 or (resid 60 and (name N or name CA or name C or name O or name CB )))) ; ? ? ? ? ? ? ? ? ? ? 2 1 4 ? B 1 B 203 ;(chain B and ((resid 2 and (name N or name CA or name C or name O or name CB )) or resid 3 through 16 or (resid 17 and (name N or name CA or name C or name O or name CB )) or resid 18 through 20 or (resid 21 and (name N or name CA or name C or name O or name CB )) or resid 22 through 27 or (resid 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 30 or (resid 31 and (name N or name CA or name C or name O or name CB )) or resid 32 through 59 or (resid 60 and (name N or name CA or name C or name O or name CB )))) ; ? ? ? ? ? ? ? ? ? ? 2 1 5 ? B 1 B 203 ;(chain B and ((resid 2 and (name N or name CA or name C or name O or name CB )) or resid 3 through 16 or (resid 17 and (name N or name CA or name C or name O or name CB )) or resid 18 through 20 or (resid 21 and (name N or name CA or name C or name O or name CB )) or resid 22 through 27 or (resid 28 and (name N or name CA or name C or name O or name CB )) or resid 29 through 30 or (resid 31 and (name N or name CA or name C or name O or name CB )) or resid 32 through 59 or (resid 60 and (name N or name CA or name C or name O or name CB )))) ; ? ? ? ? ? ? ? ? ? ? 2 2 1 ? C 2 C 20 ;(chain C and (resid 2 through 20 or (resid 21 and (name N or name CA or name C or name O or name CB )) or resid 22 through 27 or (resid 28 and (name N or name CA or name C or name O or name CB )) or resid 29 or (resid 30 through 31 and (name N or name CA or name C or name O or name CB )) or resid 32 through 60)) ; ? ? ? ? ? ? ? ? ? ? 2 2 2 ? C 21 C 21 ;(chain C and (resid 2 through 20 or (resid 21 and (name N or name CA or name C or name O or name CB )) or resid 22 through 27 or (resid 28 and (name N or name CA or name C or name O or name CB )) or resid 29 or (resid 30 through 31 and (name N or name CA or name C or name O or name CB )) or resid 32 through 60)) ; ? ? ? ? ? ? ? ? ? ? 2 2 3 ? C 2 C 203 ;(chain C and (resid 2 through 20 or (resid 21 and (name N or name CA or name C or name O or name CB )) or resid 22 through 27 or (resid 28 and (name N or name CA or name C or name O or name CB )) or resid 29 or (resid 30 through 31 and (name N or name CA or name C or name O or name CB )) or resid 32 through 60)) ; ? ? ? ? ? ? ? ? ? ? 2 2 4 ? C 2 C 203 ;(chain C and (resid 2 through 20 or (resid 21 and (name N or name CA or name C or name O or name CB )) or resid 22 through 27 or (resid 28 and (name N or name CA or name C or name O or name CB )) or resid 29 or (resid 30 through 31 and (name N or name CA or name C or name O or name CB )) or resid 32 through 60)) ; ? ? ? ? ? ? ? ? ? ? 2 2 5 ? C 2 C 203 ;(chain C and (resid 2 through 20 or (resid 21 and (name N or name CA or name C or name O or name CB )) or resid 22 through 27 or (resid 28 and (name N or name CA or name C or name O or name CB )) or resid 29 or (resid 30 through 31 and (name N or name CA or name C or name O or name CB )) or resid 32 through 60)) ; ? ? ? ? ? ? ? ? ? ? 2 2 6 ? C 2 C 203 ;(chain C and (resid 2 through 20 or (resid 21 and (name N or name CA or name C or name O or name CB )) or resid 22 through 27 or (resid 28 and (name N or name CA or name C or name O or name CB )) or resid 29 or (resid 30 through 31 and (name N or name CA or name C or name O or name CB )) or resid 32 through 60)) ; ? ? ? ? ? ? ? ? ? ? 2 3 1 ? D 2 D 2 ;(chain D and ((resid 2 and (name N or name CA or name C or name O or name CB )) or resid 3 through 29 or (resid 30 through 31 and (name N or name CA or name C or name O or name CB )) or resid 32 through 59 or (resid 60 and (name N or name CA or name C or name O or name CB )))) ; ? ? ? ? ? ? ? ? ? ? 2 3 2 ? D 2 D 133 ;(chain D and ((resid 2 and (name N or name CA or name C or name O or name CB )) or resid 3 through 29 or (resid 30 through 31 and (name N or name CA or name C or name O or name CB )) or resid 32 through 59 or (resid 60 and (name N or name CA or name C or name O or name CB )))) ; ? ? ? ? ? ? ? ? ? ? 2 3 3 ? D 2 D 133 ;(chain D and ((resid 2 and (name N or name CA or name C or name O or name CB )) or resid 3 through 29 or (resid 30 through 31 and (name N or name CA or name C or name O or name CB )) or resid 32 through 59 or (resid 60 and (name N or name CA or name C or name O or name CB )))) ; ? ? ? ? ? ? ? ? ? ? 2 3 4 ? D 2 D 133 ;(chain D and ((resid 2 and (name N or name CA or name C or name O or name CB )) or resid 3 through 29 or (resid 30 through 31 and (name N or name CA or name C or name O or name CB )) or resid 32 through 59 or (resid 60 and (name N or name CA or name C or name O or name CB )))) ; ? ? ? ? ? ? ? ? ? ? 2 3 5 ? D 2 D 133 ;(chain D and ((resid 2 and (name N or name CA or name C or name O or name CB )) or resid 3 through 29 or (resid 30 through 31 and (name N or name CA or name C or name O or name CB )) or resid 32 through 59 or (resid 60 and (name N or name CA or name C or name O or name CB )))) ; ? ? ? ? ? ? ? ? ? ? 3 1 1 ? B 0 B 0 '(chain B and (resid 81 through 90 or (resid 91 and (name N or name CA or name C or name O or name CB ))))' ? ? ? ? ? ? ? ? ? ? 3 2 1 ? C 81 C 91 '(chain C and resid 81 through 91)' ? ? ? ? ? ? ? ? ? ? 3 3 1 ? D 0 D 0 '(chain D and (resid 81 through 90 or (resid 91 and (name N or name CA or name C or name O or name CB ))))' ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ncs_ens.id _struct_ncs_ens.details 1 ? 2 ? 3 ? # _struct.entry_id 7AER _struct.title 'Rebuilt and re-refined PDB entry 5yep: tri-AMPylated Shewanella oneidensis HEPN toxin in complex with MNT antitoxin' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7AER _struct_keywords.text 'toxin-antitoxin system, MNT-HEPN, AMPylation, TOXIN/ANTITOXIN, TOXIN-ANTITOXIN complex' _struct_keywords.pdbx_keywords TOXIN/ANTITOXIN # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 3 ? G N N 3 ? H N N 3 ? I N N 3 ? J N N 3 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP Q8ECH7_SHEON Q8ECH7 ? 1 ;MQQLNENKIIKLLRDNIPKLQLIYLFGSYSQGTQHRNSDIDIAVLAADTLDNIARWELAQKLASALDSDVDLVDLRSAST VLCQQVVTQGKQLWGTQQDDELFAVKTISMYQHLQAERQAIIDDVMANTAAKAHRGESL ; 1 2 UNP Q8ECH6_SHEON Q8ECH6 ? 2 ;MNDIIINKIATIKRCIKRIQQVYGDGSQFKQDFTLQDSVILNLQRCCEACIDIANHINRQQQLGIPQSSRDSFTLLAQNN LITQPLSDNLKKMVGLRNIAVHDYQELNLDIVVHVVQHHLEDFEQFIDVIKAE ; 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7AER A 1 ? 139 ? Q8ECH7 1 ? 139 ? 1 139 2 2 7AER B 1 ? 133 ? Q8ECH6 1 ? 133 ? 1 133 3 2 7AER C 1 ? 133 ? Q8ECH6 1 ? 133 ? 1 133 4 2 7AER D 1 ? 133 ? Q8ECH6 1 ? 133 ? 1 133 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 2 7AER HIS B 134 ? UNP Q8ECH6 ? ? 'expression tag' 134 1 2 7AER HIS B 135 ? UNP Q8ECH6 ? ? 'expression tag' 135 2 2 7AER HIS B 136 ? UNP Q8ECH6 ? ? 'expression tag' 136 3 2 7AER HIS B 137 ? UNP Q8ECH6 ? ? 'expression tag' 137 4 2 7AER HIS B 138 ? UNP Q8ECH6 ? ? 'expression tag' 138 5 2 7AER HIS B 139 ? UNP Q8ECH6 ? ? 'expression tag' 139 6 3 7AER HIS C 134 ? UNP Q8ECH6 ? ? 'expression tag' 134 7 3 7AER HIS C 135 ? UNP Q8ECH6 ? ? 'expression tag' 135 8 3 7AER HIS C 136 ? UNP Q8ECH6 ? ? 'expression tag' 136 9 3 7AER HIS C 137 ? UNP Q8ECH6 ? ? 'expression tag' 137 10 3 7AER HIS C 138 ? UNP Q8ECH6 ? ? 'expression tag' 138 11 3 7AER HIS C 139 ? UNP Q8ECH6 ? ? 'expression tag' 139 12 4 7AER HIS D 134 ? UNP Q8ECH6 ? ? 'expression tag' 134 13 4 7AER HIS D 135 ? UNP Q8ECH6 ? ? 'expression tag' 135 14 4 7AER HIS D 136 ? UNP Q8ECH6 ? ? 'expression tag' 136 15 4 7AER HIS D 137 ? UNP Q8ECH6 ? ? 'expression tag' 137 16 4 7AER HIS D 138 ? UNP Q8ECH6 ? ? 'expression tag' 138 17 4 7AER HIS D 139 ? UNP Q8ECH6 ? ? 'expression tag' 139 18 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 9050 ? 1 MORE -6 ? 1 'SSA (A^2)' 23800 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 MSE A 1 ? ILE A 17 ? MSE A 1 ILE A 17 1 ? 17 HELX_P HELX_P2 AA2 ASP A 51 ? ASP A 67 ? ASP A 51 ASP A 67 1 ? 17 HELX_P HELX_P3 AA3 SER A 79 ? GLN A 89 ? SER A 79 GLN A 89 1 ? 11 HELX_P HELX_P4 AA4 THR A 96 ? ARG A 118 ? THR A 96 ARG A 118 1 ? 23 HELX_P HELX_P5 AA5 ARG A 118 ? MSE A 126 ? ARG A 118 MSE A 126 1 ? 9 HELX_P HELX_P6 AA6 ASN B 2 ? TYR B 23 ? ASN B 2 TYR B 23 1 ? 22 HELX_P HELX_P7 AA7 GLN B 28 ? GLN B 31 ? GLN B 28 GLN B 31 5 ? 4 HELX_P HELX_P8 AA8 ASP B 32 ? GLN B 61 ? ASP B 32 GLN B 61 1 ? 30 HELX_P HELX_P9 AA9 SER B 68 ? ASN B 79 ? SER B 68 ASN B 79 1 ? 12 HELX_P HELX_P10 AB1 THR B 83 ? HIS B 102 ? THR B 83 HIS B 102 1 ? 20 HELX_P HELX_P11 AB2 ASN B 108 ? HIS B 119 ? ASN B 108 HIS B 119 1 ? 12 HELX_P HELX_P12 AB3 HIS B 119 ? GLU B 133 ? HIS B 119 GLU B 133 1 ? 15 HELX_P HELX_P13 AB4 ASP C 3 ? GLY C 24 ? ASP C 3 GLY C 24 1 ? 22 HELX_P HELX_P14 AB5 GLN C 28 ? GLN C 31 ? GLN C 28 GLN C 31 5 ? 4 HELX_P HELX_P15 AB6 ASP C 32 ? GLN C 62 ? ASP C 32 GLN C 62 1 ? 31 HELX_P HELX_P16 AB7 ARG C 70 ? ASN C 79 ? ARG C 70 ASN C 79 1 ? 10 HELX_P HELX_P17 AB8 THR C 83 ? HIS C 102 ? THR C 83 HIS C 102 1 ? 20 HELX_P HELX_P18 AB9 ASN C 108 ? HIS C 119 ? ASN C 108 HIS C 119 1 ? 12 HELX_P HELX_P19 AC1 HIS C 119 ? GLU C 133 ? HIS C 119 GLU C 133 1 ? 15 HELX_P HELX_P20 AC2 ASP D 3 ? GLY D 24 ? ASP D 3 GLY D 24 1 ? 22 HELX_P HELX_P21 AC3 ASP D 32 ? GLN D 61 ? ASP D 32 GLN D 61 1 ? 30 HELX_P HELX_P22 AC4 SER D 68 ? ASN D 79 ? SER D 68 ASN D 79 1 ? 12 HELX_P HELX_P23 AC5 THR D 83 ? GLY D 95 ? THR D 83 GLY D 95 1 ? 13 HELX_P HELX_P24 AC6 LEU D 96 ? HIS D 102 ? LEU D 96 HIS D 102 1 ? 7 HELX_P HELX_P25 AC7 ASN D 108 ? HIS D 119 ? ASN D 108 HIS D 119 1 ? 12 HELX_P HELX_P26 AC8 HIS D 119 ? GLU D 133 ? HIS D 119 GLU D 133 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A SER 109 C ? ? ? 1_555 A MSE 110 N ? ? A SER 109 A MSE 110 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale2 covale both ? A MSE 110 C ? ? ? 1_555 A TYR 111 N ? ? A MSE 110 A TYR 111 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale3 covale both ? A VAL 125 C ? ? ? 1_555 A MSE 126 N ? ? A VAL 125 A MSE 126 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale4 covale both ? A MSE 126 C ? ? ? 1_555 A ALA 127 N ? ? A MSE 126 A ALA 127 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale5 covale both ? B MSE 1 C ? ? ? 1_555 B ASN 2 N ? ? B MSE 1 B ASN 2 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale6 covale both ? B LYS 92 C ? ? ? 1_555 B MSE 93 N ? ? B LYS 92 B MSE 93 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale7 covale both ? B MSE 93 C ? ? ? 1_555 B VAL 94 N ? ? B MSE 93 B VAL 94 1_555 ? ? ? ? ? ? ? 1.336 ? ? covale8 covale one ? B TYR 104 OH ? ? ? 1_555 E AMP . P ? ? B TYR 104 B AMP 201 1_555 ? ? ? ? ? ? ? 1.590 ? ? covale9 covale one ? E AMP . "O3'" ? ? ? 1_555 F AMP . P ? ? B AMP 201 B AMP 202 1_555 ? ? ? ? ? ? ? 1.604 ? ? covale10 covale one ? F AMP . "O3'" ? ? ? 1_555 G AMP . P ? ? B AMP 202 B AMP 203 1_555 ? ? ? ? ? ? ? 1.592 ? ? covale11 covale both ? C LYS 92 C ? ? ? 1_555 C MSE 93 N ? ? C LYS 92 C MSE 93 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale12 covale both ? C MSE 93 C ? ? ? 1_555 C VAL 94 N ? ? C MSE 93 C VAL 94 1_555 ? ? ? ? ? ? ? 1.336 ? ? covale13 covale one ? C TYR 104 OH ? ? ? 1_555 H AMP . P ? ? C TYR 104 C AMP 201 1_555 ? ? ? ? ? ? ? 1.559 ? ? covale14 covale one ? H AMP . "O3'" ? ? ? 1_555 I AMP . P ? ? C AMP 201 C AMP 202 1_555 ? ? ? ? ? ? ? 1.589 ? ? covale15 covale one ? I AMP . "O3'" ? ? ? 1_555 J AMP . P ? ? C AMP 202 C AMP 203 1_555 ? ? ? ? ? ? ? 1.595 ? ? covale16 covale both ? D LYS 92 C ? ? ? 1_555 D MSE 93 N ? ? D LYS 92 D MSE 93 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale17 covale both ? D MSE 93 C ? ? ? 1_555 D VAL 94 N ? ? D MSE 93 D VAL 94 1_555 ? ? ? ? ? ? ? 1.336 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 MSE A 110 ? . . . . MSE A 110 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 2 MSE A 126 ? . . . . MSE A 126 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 3 MSE B 1 ? . . . . MSE B 1 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 4 MSE B 93 ? . . . . MSE B 93 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 5 MSE C 93 ? . . . . MSE C 93 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 6 MSE D 93 ? . . . . MSE D 93 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 7 AMP E . ? TYR B 104 ? AMP B 201 ? 1_555 TYR B 104 ? 1_555 P OH TYR 1 AMP AMPylation 'Nucleotide monophosphate' 8 AMP H . ? TYR C 104 ? AMP C 201 ? 1_555 TYR C 104 ? 1_555 P OH TYR 1 AMP AMPylation 'Nucleotide monophosphate' # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ASP A 69 ? ASP A 74 ? ASP A 69 ASP A 74 AA1 2 ASP A 39 ? ALA A 46 ? ASP A 39 ALA A 46 AA1 3 LEU A 20 ? PHE A 26 ? LEU A 20 PHE A 26 AA1 4 LYS A 91 ? TRP A 94 ? LYS A 91 TRP A 94 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O VAL A 73 ? O VAL A 73 N VAL A 44 ? N VAL A 44 AA1 2 3 O ALA A 43 ? O ALA A 43 N TYR A 24 ? N TYR A 24 AA1 3 4 N ILE A 23 ? N ILE A 23 O LEU A 93 ? O LEU A 93 # _pdbx_entry_details.entry_id 7AER _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 88 ? ? -79.50 -75.75 2 1 ASP B 25 ? ? -156.32 -3.86 3 1 VAL B 101 ? ? -74.09 -72.76 4 1 GLN B 105 ? ? -173.71 137.47 5 1 GLN C 105 ? ? -170.16 148.47 6 1 ASP D 103 ? ? -94.71 59.91 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 110 A MSE 110 ? MET 'modified residue' 2 A MSE 126 A MSE 126 ? MET 'modified residue' 3 B MSE 1 B MSE 1 ? MET 'modified residue' 4 B MSE 93 B MSE 93 ? MET 'modified residue' 5 C MSE 93 C MSE 93 ? MET 'modified residue' 6 D MSE 93 D MSE 93 ? MET 'modified residue' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 30 ? A SER 30 2 1 Y 1 A GLN 31 ? A GLN 31 3 1 Y 1 A GLY 32 ? A GLY 32 4 1 Y 1 A THR 33 ? A THR 33 5 1 Y 1 A GLN 34 ? A GLN 34 6 1 Y 1 A HIS 35 ? A HIS 35 7 1 Y 1 A ARG 36 ? A ARG 36 8 1 Y 1 A ASN 37 ? A ASN 37 9 1 Y 1 A ASN 128 ? A ASN 128 10 1 Y 1 A THR 129 ? A THR 129 11 1 Y 1 A ALA 130 ? A ALA 130 12 1 Y 1 A ALA 131 ? A ALA 131 13 1 Y 1 A LYS 132 ? A LYS 132 14 1 Y 1 A ALA 133 ? A ALA 133 15 1 Y 1 A HIS 134 ? A HIS 134 16 1 Y 1 A ARG 135 ? A ARG 135 17 1 Y 1 A GLY 136 ? A GLY 136 18 1 Y 1 A GLU 137 ? A GLU 137 19 1 Y 1 A SER 138 ? A SER 138 20 1 Y 1 A LEU 139 ? A LEU 139 21 1 Y 1 B HIS 134 ? B HIS 134 22 1 Y 1 B HIS 135 ? B HIS 135 23 1 Y 1 B HIS 136 ? B HIS 136 24 1 Y 1 B HIS 137 ? B HIS 137 25 1 Y 1 B HIS 138 ? B HIS 138 26 1 Y 1 B HIS 139 ? B HIS 139 27 1 Y 1 C MSE 1 ? C MSE 1 28 1 Y 1 C HIS 134 ? C HIS 134 29 1 Y 1 C HIS 135 ? C HIS 135 30 1 Y 1 C HIS 136 ? C HIS 136 31 1 Y 1 C HIS 137 ? C HIS 137 32 1 Y 1 C HIS 138 ? C HIS 138 33 1 Y 1 C HIS 139 ? C HIS 139 34 1 Y 1 D MSE 1 ? D MSE 1 35 1 Y 1 D HIS 134 ? D HIS 134 36 1 Y 1 D HIS 135 ? D HIS 135 37 1 Y 1 D HIS 136 ? D HIS 136 38 1 Y 1 D HIS 137 ? D HIS 137 39 1 Y 1 D HIS 138 ? D HIS 138 40 1 Y 1 D HIS 139 ? D HIS 139 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 AMP P P N N 14 AMP O1P O N N 15 AMP O2P O N N 16 AMP O3P O N N 17 AMP "O5'" O N N 18 AMP "C5'" C N N 19 AMP "C4'" C N R 20 AMP "O4'" O N N 21 AMP "C3'" C N S 22 AMP "O3'" O N N 23 AMP "C2'" C N R 24 AMP "O2'" O N N 25 AMP "C1'" C N R 26 AMP N9 N Y N 27 AMP C8 C Y N 28 AMP N7 N Y N 29 AMP C5 C Y N 30 AMP C6 C Y N 31 AMP N6 N N N 32 AMP N1 N Y N 33 AMP C2 C Y N 34 AMP N3 N Y N 35 AMP C4 C Y N 36 AMP HOP2 H N N 37 AMP HOP3 H N N 38 AMP "H5'1" H N N 39 AMP "H5'2" H N N 40 AMP "H4'" H N N 41 AMP "H3'" H N N 42 AMP "HO3'" H N N 43 AMP "H2'" H N N 44 AMP "HO2'" H N N 45 AMP "H1'" H N N 46 AMP H8 H N N 47 AMP HN61 H N N 48 AMP HN62 H N N 49 AMP H2 H N N 50 ARG N N N N 51 ARG CA C N S 52 ARG C C N N 53 ARG O O N N 54 ARG CB C N N 55 ARG CG C N N 56 ARG CD C N N 57 ARG NE N N N 58 ARG CZ C N N 59 ARG NH1 N N N 60 ARG NH2 N N N 61 ARG OXT O N N 62 ARG H H N N 63 ARG H2 H N N 64 ARG HA H N N 65 ARG HB2 H N N 66 ARG HB3 H N N 67 ARG HG2 H N N 68 ARG HG3 H N N 69 ARG HD2 H N N 70 ARG HD3 H N N 71 ARG HE H N N 72 ARG HH11 H N N 73 ARG HH12 H N N 74 ARG HH21 H N N 75 ARG HH22 H N N 76 ARG HXT H N N 77 ASN N N N N 78 ASN CA C N S 79 ASN C C N N 80 ASN O O N N 81 ASN CB C N N 82 ASN CG C N N 83 ASN OD1 O N N 84 ASN ND2 N N N 85 ASN OXT O N N 86 ASN H H N N 87 ASN H2 H N N 88 ASN HA H N N 89 ASN HB2 H N N 90 ASN HB3 H N N 91 ASN HD21 H N N 92 ASN HD22 H N N 93 ASN HXT H N N 94 ASP N N N N 95 ASP CA C N S 96 ASP C C N N 97 ASP O O N N 98 ASP CB C N N 99 ASP CG C N N 100 ASP OD1 O N N 101 ASP OD2 O N N 102 ASP OXT O N N 103 ASP H H N N 104 ASP H2 H N N 105 ASP HA H N N 106 ASP HB2 H N N 107 ASP HB3 H N N 108 ASP HD2 H N N 109 ASP HXT H N N 110 CYS N N N N 111 CYS CA C N R 112 CYS C C N N 113 CYS O O N N 114 CYS CB C N N 115 CYS SG S N N 116 CYS OXT O N N 117 CYS H H N N 118 CYS H2 H N N 119 CYS HA H N N 120 CYS HB2 H N N 121 CYS HB3 H N N 122 CYS HG H N N 123 CYS HXT H N N 124 GLN N N N N 125 GLN CA C N S 126 GLN C C N N 127 GLN O O N N 128 GLN CB C N N 129 GLN CG C N N 130 GLN CD C N N 131 GLN OE1 O N N 132 GLN NE2 N N N 133 GLN OXT O N N 134 GLN H H N N 135 GLN H2 H N N 136 GLN HA H N N 137 GLN HB2 H N N 138 GLN HB3 H N N 139 GLN HG2 H N N 140 GLN HG3 H N N 141 GLN HE21 H N N 142 GLN HE22 H N N 143 GLN HXT H N N 144 GLU N N N N 145 GLU CA C N S 146 GLU C C N N 147 GLU O O N N 148 GLU CB C N N 149 GLU CG C N N 150 GLU CD C N N 151 GLU OE1 O N N 152 GLU OE2 O N N 153 GLU OXT O N N 154 GLU H H N N 155 GLU H2 H N N 156 GLU HA H N N 157 GLU HB2 H N N 158 GLU HB3 H N N 159 GLU HG2 H N N 160 GLU HG3 H N N 161 GLU HE2 H N N 162 GLU HXT H N N 163 GLY N N N N 164 GLY CA C N N 165 GLY C C N N 166 GLY O O N N 167 GLY OXT O N N 168 GLY H H N N 169 GLY H2 H N N 170 GLY HA2 H N N 171 GLY HA3 H N N 172 GLY HXT H N N 173 HIS N N N N 174 HIS CA C N S 175 HIS C C N N 176 HIS O O N N 177 HIS CB C N N 178 HIS CG C Y N 179 HIS ND1 N Y N 180 HIS CD2 C Y N 181 HIS CE1 C Y N 182 HIS NE2 N Y N 183 HIS OXT O N N 184 HIS H H N N 185 HIS H2 H N N 186 HIS HA H N N 187 HIS HB2 H N N 188 HIS HB3 H N N 189 HIS HD1 H N N 190 HIS HD2 H N N 191 HIS HE1 H N N 192 HIS HE2 H N N 193 HIS HXT H N N 194 ILE N N N N 195 ILE CA C N S 196 ILE C C N N 197 ILE O O N N 198 ILE CB C N S 199 ILE CG1 C N N 200 ILE CG2 C N N 201 ILE CD1 C N N 202 ILE OXT O N N 203 ILE H H N N 204 ILE H2 H N N 205 ILE HA H N N 206 ILE HB H N N 207 ILE HG12 H N N 208 ILE HG13 H N N 209 ILE HG21 H N N 210 ILE HG22 H N N 211 ILE HG23 H N N 212 ILE HD11 H N N 213 ILE HD12 H N N 214 ILE HD13 H N N 215 ILE HXT H N N 216 LEU N N N N 217 LEU CA C N S 218 LEU C C N N 219 LEU O O N N 220 LEU CB C N N 221 LEU CG C N N 222 LEU CD1 C N N 223 LEU CD2 C N N 224 LEU OXT O N N 225 LEU H H N N 226 LEU H2 H N N 227 LEU HA H N N 228 LEU HB2 H N N 229 LEU HB3 H N N 230 LEU HG H N N 231 LEU HD11 H N N 232 LEU HD12 H N N 233 LEU HD13 H N N 234 LEU HD21 H N N 235 LEU HD22 H N N 236 LEU HD23 H N N 237 LEU HXT H N N 238 LYS N N N N 239 LYS CA C N S 240 LYS C C N N 241 LYS O O N N 242 LYS CB C N N 243 LYS CG C N N 244 LYS CD C N N 245 LYS CE C N N 246 LYS NZ N N N 247 LYS OXT O N N 248 LYS H H N N 249 LYS H2 H N N 250 LYS HA H N N 251 LYS HB2 H N N 252 LYS HB3 H N N 253 LYS HG2 H N N 254 LYS HG3 H N N 255 LYS HD2 H N N 256 LYS HD3 H N N 257 LYS HE2 H N N 258 LYS HE3 H N N 259 LYS HZ1 H N N 260 LYS HZ2 H N N 261 LYS HZ3 H N N 262 LYS HXT H N N 263 MSE N N N N 264 MSE CA C N S 265 MSE C C N N 266 MSE O O N N 267 MSE OXT O N N 268 MSE CB C N N 269 MSE CG C N N 270 MSE SE SE N N 271 MSE CE C N N 272 MSE H H N N 273 MSE H2 H N N 274 MSE HA H N N 275 MSE HXT H N N 276 MSE HB2 H N N 277 MSE HB3 H N N 278 MSE HG2 H N N 279 MSE HG3 H N N 280 MSE HE1 H N N 281 MSE HE2 H N N 282 MSE HE3 H N N 283 PHE N N N N 284 PHE CA C N S 285 PHE C C N N 286 PHE O O N N 287 PHE CB C N N 288 PHE CG C Y N 289 PHE CD1 C Y N 290 PHE CD2 C Y N 291 PHE CE1 C Y N 292 PHE CE2 C Y N 293 PHE CZ C Y N 294 PHE OXT O N N 295 PHE H H N N 296 PHE H2 H N N 297 PHE HA H N N 298 PHE HB2 H N N 299 PHE HB3 H N N 300 PHE HD1 H N N 301 PHE HD2 H N N 302 PHE HE1 H N N 303 PHE HE2 H N N 304 PHE HZ H N N 305 PHE HXT H N N 306 PRO N N N N 307 PRO CA C N S 308 PRO C C N N 309 PRO O O N N 310 PRO CB C N N 311 PRO CG C N N 312 PRO CD C N N 313 PRO OXT O N N 314 PRO H H N N 315 PRO HA H N N 316 PRO HB2 H N N 317 PRO HB3 H N N 318 PRO HG2 H N N 319 PRO HG3 H N N 320 PRO HD2 H N N 321 PRO HD3 H N N 322 PRO HXT H N N 323 SER N N N N 324 SER CA C N S 325 SER C C N N 326 SER O O N N 327 SER CB C N N 328 SER OG O N N 329 SER OXT O N N 330 SER H H N N 331 SER H2 H N N 332 SER HA H N N 333 SER HB2 H N N 334 SER HB3 H N N 335 SER HG H N N 336 SER HXT H N N 337 THR N N N N 338 THR CA C N S 339 THR C C N N 340 THR O O N N 341 THR CB C N R 342 THR OG1 O N N 343 THR CG2 C N N 344 THR OXT O N N 345 THR H H N N 346 THR H2 H N N 347 THR HA H N N 348 THR HB H N N 349 THR HG1 H N N 350 THR HG21 H N N 351 THR HG22 H N N 352 THR HG23 H N N 353 THR HXT H N N 354 TRP N N N N 355 TRP CA C N S 356 TRP C C N N 357 TRP O O N N 358 TRP CB C N N 359 TRP CG C Y N 360 TRP CD1 C Y N 361 TRP CD2 C Y N 362 TRP NE1 N Y N 363 TRP CE2 C Y N 364 TRP CE3 C Y N 365 TRP CZ2 C Y N 366 TRP CZ3 C Y N 367 TRP CH2 C Y N 368 TRP OXT O N N 369 TRP H H N N 370 TRP H2 H N N 371 TRP HA H N N 372 TRP HB2 H N N 373 TRP HB3 H N N 374 TRP HD1 H N N 375 TRP HE1 H N N 376 TRP HE3 H N N 377 TRP HZ2 H N N 378 TRP HZ3 H N N 379 TRP HH2 H N N 380 TRP HXT H N N 381 TYR N N N N 382 TYR CA C N S 383 TYR C C N N 384 TYR O O N N 385 TYR CB C N N 386 TYR CG C Y N 387 TYR CD1 C Y N 388 TYR CD2 C Y N 389 TYR CE1 C Y N 390 TYR CE2 C Y N 391 TYR CZ C Y N 392 TYR OH O N N 393 TYR OXT O N N 394 TYR H H N N 395 TYR H2 H N N 396 TYR HA H N N 397 TYR HB2 H N N 398 TYR HB3 H N N 399 TYR HD1 H N N 400 TYR HD2 H N N 401 TYR HE1 H N N 402 TYR HE2 H N N 403 TYR HH H N N 404 TYR HXT H N N 405 VAL N N N N 406 VAL CA C N S 407 VAL C C N N 408 VAL O O N N 409 VAL CB C N N 410 VAL CG1 C N N 411 VAL CG2 C N N 412 VAL OXT O N N 413 VAL H H N N 414 VAL H2 H N N 415 VAL HA H N N 416 VAL HB H N N 417 VAL HG11 H N N 418 VAL HG12 H N N 419 VAL HG13 H N N 420 VAL HG21 H N N 421 VAL HG22 H N N 422 VAL HG23 H N N 423 VAL HXT H N N 424 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 AMP P O1P doub N N 13 AMP P O2P sing N N 14 AMP P O3P sing N N 15 AMP P "O5'" sing N N 16 AMP O2P HOP2 sing N N 17 AMP O3P HOP3 sing N N 18 AMP "O5'" "C5'" sing N N 19 AMP "C5'" "C4'" sing N N 20 AMP "C5'" "H5'1" sing N N 21 AMP "C5'" "H5'2" sing N N 22 AMP "C4'" "O4'" sing N N 23 AMP "C4'" "C3'" sing N N 24 AMP "C4'" "H4'" sing N N 25 AMP "O4'" "C1'" sing N N 26 AMP "C3'" "O3'" sing N N 27 AMP "C3'" "C2'" sing N N 28 AMP "C3'" "H3'" sing N N 29 AMP "O3'" "HO3'" sing N N 30 AMP "C2'" "O2'" sing N N 31 AMP "C2'" "C1'" sing N N 32 AMP "C2'" "H2'" sing N N 33 AMP "O2'" "HO2'" sing N N 34 AMP "C1'" N9 sing N N 35 AMP "C1'" "H1'" sing N N 36 AMP N9 C8 sing Y N 37 AMP N9 C4 sing Y N 38 AMP C8 N7 doub Y N 39 AMP C8 H8 sing N N 40 AMP N7 C5 sing Y N 41 AMP C5 C6 sing Y N 42 AMP C5 C4 doub Y N 43 AMP C6 N6 sing N N 44 AMP C6 N1 doub Y N 45 AMP N6 HN61 sing N N 46 AMP N6 HN62 sing N N 47 AMP N1 C2 sing Y N 48 AMP C2 N3 doub Y N 49 AMP C2 H2 sing N N 50 AMP N3 C4 sing Y N 51 ARG N CA sing N N 52 ARG N H sing N N 53 ARG N H2 sing N N 54 ARG CA C sing N N 55 ARG CA CB sing N N 56 ARG CA HA sing N N 57 ARG C O doub N N 58 ARG C OXT sing N N 59 ARG CB CG sing N N 60 ARG CB HB2 sing N N 61 ARG CB HB3 sing N N 62 ARG CG CD sing N N 63 ARG CG HG2 sing N N 64 ARG CG HG3 sing N N 65 ARG CD NE sing N N 66 ARG CD HD2 sing N N 67 ARG CD HD3 sing N N 68 ARG NE CZ sing N N 69 ARG NE HE sing N N 70 ARG CZ NH1 sing N N 71 ARG CZ NH2 doub N N 72 ARG NH1 HH11 sing N N 73 ARG NH1 HH12 sing N N 74 ARG NH2 HH21 sing N N 75 ARG NH2 HH22 sing N N 76 ARG OXT HXT sing N N 77 ASN N CA sing N N 78 ASN N H sing N N 79 ASN N H2 sing N N 80 ASN CA C sing N N 81 ASN CA CB sing N N 82 ASN CA HA sing N N 83 ASN C O doub N N 84 ASN C OXT sing N N 85 ASN CB CG sing N N 86 ASN CB HB2 sing N N 87 ASN CB HB3 sing N N 88 ASN CG OD1 doub N N 89 ASN CG ND2 sing N N 90 ASN ND2 HD21 sing N N 91 ASN ND2 HD22 sing N N 92 ASN OXT HXT sing N N 93 ASP N CA sing N N 94 ASP N H sing N N 95 ASP N H2 sing N N 96 ASP CA C sing N N 97 ASP CA CB sing N N 98 ASP CA HA sing N N 99 ASP C O doub N N 100 ASP C OXT sing N N 101 ASP CB CG sing N N 102 ASP CB HB2 sing N N 103 ASP CB HB3 sing N N 104 ASP CG OD1 doub N N 105 ASP CG OD2 sing N N 106 ASP OD2 HD2 sing N N 107 ASP OXT HXT sing N N 108 CYS N CA sing N N 109 CYS N H sing N N 110 CYS N H2 sing N N 111 CYS CA C sing N N 112 CYS CA CB sing N N 113 CYS CA HA sing N N 114 CYS C O doub N N 115 CYS C OXT sing N N 116 CYS CB SG sing N N 117 CYS CB HB2 sing N N 118 CYS CB HB3 sing N N 119 CYS SG HG sing N N 120 CYS OXT HXT sing N N 121 GLN N CA sing N N 122 GLN N H sing N N 123 GLN N H2 sing N N 124 GLN CA C sing N N 125 GLN CA CB sing N N 126 GLN CA HA sing N N 127 GLN C O doub N N 128 GLN C OXT sing N N 129 GLN CB CG sing N N 130 GLN CB HB2 sing N N 131 GLN CB HB3 sing N N 132 GLN CG CD sing N N 133 GLN CG HG2 sing N N 134 GLN CG HG3 sing N N 135 GLN CD OE1 doub N N 136 GLN CD NE2 sing N N 137 GLN NE2 HE21 sing N N 138 GLN NE2 HE22 sing N N 139 GLN OXT HXT sing N N 140 GLU N CA sing N N 141 GLU N H sing N N 142 GLU N H2 sing N N 143 GLU CA C sing N N 144 GLU CA CB sing N N 145 GLU CA HA sing N N 146 GLU C O doub N N 147 GLU C OXT sing N N 148 GLU CB CG sing N N 149 GLU CB HB2 sing N N 150 GLU CB HB3 sing N N 151 GLU CG CD sing N N 152 GLU CG HG2 sing N N 153 GLU CG HG3 sing N N 154 GLU CD OE1 doub N N 155 GLU CD OE2 sing N N 156 GLU OE2 HE2 sing N N 157 GLU OXT HXT sing N N 158 GLY N CA sing N N 159 GLY N H sing N N 160 GLY N H2 sing N N 161 GLY CA C sing N N 162 GLY CA HA2 sing N N 163 GLY CA HA3 sing N N 164 GLY C O doub N N 165 GLY C OXT sing N N 166 GLY OXT HXT sing N N 167 HIS N CA sing N N 168 HIS N H sing N N 169 HIS N H2 sing N N 170 HIS CA C sing N N 171 HIS CA CB sing N N 172 HIS CA HA sing N N 173 HIS C O doub N N 174 HIS C OXT sing N N 175 HIS CB CG sing N N 176 HIS CB HB2 sing N N 177 HIS CB HB3 sing N N 178 HIS CG ND1 sing Y N 179 HIS CG CD2 doub Y N 180 HIS ND1 CE1 doub Y N 181 HIS ND1 HD1 sing N N 182 HIS CD2 NE2 sing Y N 183 HIS CD2 HD2 sing N N 184 HIS CE1 NE2 sing Y N 185 HIS CE1 HE1 sing N N 186 HIS NE2 HE2 sing N N 187 HIS OXT HXT sing N N 188 ILE N CA sing N N 189 ILE N H sing N N 190 ILE N H2 sing N N 191 ILE CA C sing N N 192 ILE CA CB sing N N 193 ILE CA HA sing N N 194 ILE C O doub N N 195 ILE C OXT sing N N 196 ILE CB CG1 sing N N 197 ILE CB CG2 sing N N 198 ILE CB HB sing N N 199 ILE CG1 CD1 sing N N 200 ILE CG1 HG12 sing N N 201 ILE CG1 HG13 sing N N 202 ILE CG2 HG21 sing N N 203 ILE CG2 HG22 sing N N 204 ILE CG2 HG23 sing N N 205 ILE CD1 HD11 sing N N 206 ILE CD1 HD12 sing N N 207 ILE CD1 HD13 sing N N 208 ILE OXT HXT sing N N 209 LEU N CA sing N N 210 LEU N H sing N N 211 LEU N H2 sing N N 212 LEU CA C sing N N 213 LEU CA CB sing N N 214 LEU CA HA sing N N 215 LEU C O doub N N 216 LEU C OXT sing N N 217 LEU CB CG sing N N 218 LEU CB HB2 sing N N 219 LEU CB HB3 sing N N 220 LEU CG CD1 sing N N 221 LEU CG CD2 sing N N 222 LEU CG HG sing N N 223 LEU CD1 HD11 sing N N 224 LEU CD1 HD12 sing N N 225 LEU CD1 HD13 sing N N 226 LEU CD2 HD21 sing N N 227 LEU CD2 HD22 sing N N 228 LEU CD2 HD23 sing N N 229 LEU OXT HXT sing N N 230 LYS N CA sing N N 231 LYS N H sing N N 232 LYS N H2 sing N N 233 LYS CA C sing N N 234 LYS CA CB sing N N 235 LYS CA HA sing N N 236 LYS C O doub N N 237 LYS C OXT sing N N 238 LYS CB CG sing N N 239 LYS CB HB2 sing N N 240 LYS CB HB3 sing N N 241 LYS CG CD sing N N 242 LYS CG HG2 sing N N 243 LYS CG HG3 sing N N 244 LYS CD CE sing N N 245 LYS CD HD2 sing N N 246 LYS CD HD3 sing N N 247 LYS CE NZ sing N N 248 LYS CE HE2 sing N N 249 LYS CE HE3 sing N N 250 LYS NZ HZ1 sing N N 251 LYS NZ HZ2 sing N N 252 LYS NZ HZ3 sing N N 253 LYS OXT HXT sing N N 254 MSE N CA sing N N 255 MSE N H sing N N 256 MSE N H2 sing N N 257 MSE CA C sing N N 258 MSE CA CB sing N N 259 MSE CA HA sing N N 260 MSE C O doub N N 261 MSE C OXT sing N N 262 MSE OXT HXT sing N N 263 MSE CB CG sing N N 264 MSE CB HB2 sing N N 265 MSE CB HB3 sing N N 266 MSE CG SE sing N N 267 MSE CG HG2 sing N N 268 MSE CG HG3 sing N N 269 MSE SE CE sing N N 270 MSE CE HE1 sing N N 271 MSE CE HE2 sing N N 272 MSE CE HE3 sing N N 273 PHE N CA sing N N 274 PHE N H sing N N 275 PHE N H2 sing N N 276 PHE CA C sing N N 277 PHE CA CB sing N N 278 PHE CA HA sing N N 279 PHE C O doub N N 280 PHE C OXT sing N N 281 PHE CB CG sing N N 282 PHE CB HB2 sing N N 283 PHE CB HB3 sing N N 284 PHE CG CD1 doub Y N 285 PHE CG CD2 sing Y N 286 PHE CD1 CE1 sing Y N 287 PHE CD1 HD1 sing N N 288 PHE CD2 CE2 doub Y N 289 PHE CD2 HD2 sing N N 290 PHE CE1 CZ doub Y N 291 PHE CE1 HE1 sing N N 292 PHE CE2 CZ sing Y N 293 PHE CE2 HE2 sing N N 294 PHE CZ HZ sing N N 295 PHE OXT HXT sing N N 296 PRO N CA sing N N 297 PRO N CD sing N N 298 PRO N H sing N N 299 PRO CA C sing N N 300 PRO CA CB sing N N 301 PRO CA HA sing N N 302 PRO C O doub N N 303 PRO C OXT sing N N 304 PRO CB CG sing N N 305 PRO CB HB2 sing N N 306 PRO CB HB3 sing N N 307 PRO CG CD sing N N 308 PRO CG HG2 sing N N 309 PRO CG HG3 sing N N 310 PRO CD HD2 sing N N 311 PRO CD HD3 sing N N 312 PRO OXT HXT sing N N 313 SER N CA sing N N 314 SER N H sing N N 315 SER N H2 sing N N 316 SER CA C sing N N 317 SER CA CB sing N N 318 SER CA HA sing N N 319 SER C O doub N N 320 SER C OXT sing N N 321 SER CB OG sing N N 322 SER CB HB2 sing N N 323 SER CB HB3 sing N N 324 SER OG HG sing N N 325 SER OXT HXT sing N N 326 THR N CA sing N N 327 THR N H sing N N 328 THR N H2 sing N N 329 THR CA C sing N N 330 THR CA CB sing N N 331 THR CA HA sing N N 332 THR C O doub N N 333 THR C OXT sing N N 334 THR CB OG1 sing N N 335 THR CB CG2 sing N N 336 THR CB HB sing N N 337 THR OG1 HG1 sing N N 338 THR CG2 HG21 sing N N 339 THR CG2 HG22 sing N N 340 THR CG2 HG23 sing N N 341 THR OXT HXT sing N N 342 TRP N CA sing N N 343 TRP N H sing N N 344 TRP N H2 sing N N 345 TRP CA C sing N N 346 TRP CA CB sing N N 347 TRP CA HA sing N N 348 TRP C O doub N N 349 TRP C OXT sing N N 350 TRP CB CG sing N N 351 TRP CB HB2 sing N N 352 TRP CB HB3 sing N N 353 TRP CG CD1 doub Y N 354 TRP CG CD2 sing Y N 355 TRP CD1 NE1 sing Y N 356 TRP CD1 HD1 sing N N 357 TRP CD2 CE2 doub Y N 358 TRP CD2 CE3 sing Y N 359 TRP NE1 CE2 sing Y N 360 TRP NE1 HE1 sing N N 361 TRP CE2 CZ2 sing Y N 362 TRP CE3 CZ3 doub Y N 363 TRP CE3 HE3 sing N N 364 TRP CZ2 CH2 doub Y N 365 TRP CZ2 HZ2 sing N N 366 TRP CZ3 CH2 sing Y N 367 TRP CZ3 HZ3 sing N N 368 TRP CH2 HH2 sing N N 369 TRP OXT HXT sing N N 370 TYR N CA sing N N 371 TYR N H sing N N 372 TYR N H2 sing N N 373 TYR CA C sing N N 374 TYR CA CB sing N N 375 TYR CA HA sing N N 376 TYR C O doub N N 377 TYR C OXT sing N N 378 TYR CB CG sing N N 379 TYR CB HB2 sing N N 380 TYR CB HB3 sing N N 381 TYR CG CD1 doub Y N 382 TYR CG CD2 sing Y N 383 TYR CD1 CE1 sing Y N 384 TYR CD1 HD1 sing N N 385 TYR CD2 CE2 doub Y N 386 TYR CD2 HD2 sing N N 387 TYR CE1 CZ doub Y N 388 TYR CE1 HE1 sing N N 389 TYR CE2 CZ sing Y N 390 TYR CE2 HE2 sing N N 391 TYR CZ OH sing N N 392 TYR OH HH sing N N 393 TYR OXT HXT sing N N 394 VAL N CA sing N N 395 VAL N H sing N N 396 VAL N H2 sing N N 397 VAL CA C sing N N 398 VAL CA CB sing N N 399 VAL CA HA sing N N 400 VAL C O doub N N 401 VAL C OXT sing N N 402 VAL CB CG1 sing N N 403 VAL CB CG2 sing N N 404 VAL CB HB sing N N 405 VAL CG1 HG11 sing N N 406 VAL CG1 HG12 sing N N 407 VAL CG1 HG13 sing N N 408 VAL CG2 HG21 sing N N 409 VAL CG2 HG22 sing N N 410 VAL CG2 HG23 sing N N 411 VAL OXT HXT sing N N 412 # _atom_sites.entry_id 7AER _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.017665 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.004457 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.018758 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O P S SE # loop_