data_7AV6
# 
_entry.id   7AV6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.384 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   7AV6         pdb_00007av6 10.2210/pdb7av6/pdb 
WWPDB D_1292112082 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2021-06-09 
2 'Structure model' 1 1 2024-01-31 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'        
2 2 'Structure model' 'Database references'    
3 2 'Structure model' 'Refinement description' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' chem_comp_atom                
2 2 'Structure model' chem_comp_bond                
3 2 'Structure model' database_2                    
4 2 'Structure model' pdbx_initial_refinement_model 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_database_2.pdbx_DOI'                
2 2 'Structure model' '_database_2.pdbx_database_accession' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        7AV6 
_pdbx_database_status.recvd_initial_deposition_date   2020-11-04 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Bukhdruker, S.'    1  0000-0002-0157-532X 
'Remeeva, A.'       2  0000-0003-3977-3679 
'Ruchkin, D.'       3  ?                   
'Gorbachev, D.'     4  ?                   
'Povarova, N.'      5  ?                   
'Mineev, K.'        6  0000-0002-2418-9421 
'Goncharuk, S.'     7  0000-0002-0263-6462 
'Baranov, M.'       8  0000-0002-9339-7603 
'Mishin, A.'        9  0000-0003-3759-380X 
'Borshchevskiy, V.' 10 0000-0003-4398-9712 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Chem Sci' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-6520 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            12 
_citation.language                  ? 
_citation.page_first                6719 
_citation.page_last                 6725 
_citation.title                     
'NanoFAST: structure-based design of a small fluorogen-activating protein with only 98 amino acids.' 
_citation.year                      2021 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1039/d1sc01454d 
_citation.pdbx_database_id_PubMed   34040747 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Mineev, K.S.'      1  0000-0002-2418-9421 
primary 'Goncharuk, S.A.'   2  ?                   
primary 'Goncharuk, M.V.'   3  ?                   
primary 'Povarova, N.V.'    4  ?                   
primary 'Sokolov, A.I.'     5  ?                   
primary 'Baleeva, N.S.'     6  ?                   
primary 'Smirnov, A.Y.'     7  0000-0002-1545-6604 
primary 'Myasnyanko, I.N.'  8  0000-0002-2168-3555 
primary 'Ruchkin, D.A.'     9  ?                   
primary 'Bukhdruker, S.'    10 ?                   
primary 'Remeeva, A.'       11 ?                   
primary 'Mishin, A.'        12 0000-0003-3759-380X 
primary 'Borshchevskiy, V.' 13 ?                   
primary 'Gordeliy, V.'      14 ?                   
primary 'Arseniev, A.S.'    15 ?                   
primary 'Gorbachev, D.A.'   16 ?                   
primary 'Gavrikov, A.S.'    17 ?                   
primary 'Mishin, A.S.'      18 0000-0002-4935-7030 
primary 'Baranov, M.S.'     19 0000-0002-9339-7603 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Photoactive yellow protein' 15249.174 1  ? ? ? FAST 
2 non-polymer syn 'FORMIC ACID'                46.025    2  ? ? ? ?    
3 water       nat water                        18.015    21 ? ? ? ?    
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'PYP; FAST' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPGTDSPEFYGKFK
EGVASGNLNTMFEWMIPTSRGPTKVKVHMKKALSGDSYWVFVKRVKLAAALEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPGTDSPEFYGKFK
EGVASGNLNTMFEWMIPTSRGPTKVKVHMKKALSGDSYWVFVKRVKLAAALEHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'FORMIC ACID' FMT 
3 water         HOH 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLU n 
1 3   HIS n 
1 4   VAL n 
1 5   ALA n 
1 6   PHE n 
1 7   GLY n 
1 8   SER n 
1 9   GLU n 
1 10  ASP n 
1 11  ILE n 
1 12  GLU n 
1 13  ASN n 
1 14  THR n 
1 15  LEU n 
1 16  ALA n 
1 17  LYS n 
1 18  MET n 
1 19  ASP n 
1 20  ASP n 
1 21  GLY n 
1 22  GLN n 
1 23  LEU n 
1 24  ASP n 
1 25  GLY n 
1 26  LEU n 
1 27  ALA n 
1 28  PHE n 
1 29  GLY n 
1 30  ALA n 
1 31  ILE n 
1 32  GLN n 
1 33  LEU n 
1 34  ASP n 
1 35  GLY n 
1 36  ASP n 
1 37  GLY n 
1 38  ASN n 
1 39  ILE n 
1 40  LEU n 
1 41  GLN n 
1 42  TYR n 
1 43  ASN n 
1 44  ALA n 
1 45  ALA n 
1 46  GLU n 
1 47  GLY n 
1 48  ASP n 
1 49  ILE n 
1 50  THR n 
1 51  GLY n 
1 52  ARG n 
1 53  ASP n 
1 54  PRO n 
1 55  LYS n 
1 56  GLN n 
1 57  VAL n 
1 58  ILE n 
1 59  GLY n 
1 60  LYS n 
1 61  ASN n 
1 62  PHE n 
1 63  PHE n 
1 64  LYS n 
1 65  ASP n 
1 66  VAL n 
1 67  ALA n 
1 68  PRO n 
1 69  GLY n 
1 70  THR n 
1 71  ASP n 
1 72  SER n 
1 73  PRO n 
1 74  GLU n 
1 75  PHE n 
1 76  TYR n 
1 77  GLY n 
1 78  LYS n 
1 79  PHE n 
1 80  LYS n 
1 81  GLU n 
1 82  GLY n 
1 83  VAL n 
1 84  ALA n 
1 85  SER n 
1 86  GLY n 
1 87  ASN n 
1 88  LEU n 
1 89  ASN n 
1 90  THR n 
1 91  MET n 
1 92  PHE n 
1 93  GLU n 
1 94  TRP n 
1 95  MET n 
1 96  ILE n 
1 97  PRO n 
1 98  THR n 
1 99  SER n 
1 100 ARG n 
1 101 GLY n 
1 102 PRO n 
1 103 THR n 
1 104 LYS n 
1 105 VAL n 
1 106 LYS n 
1 107 VAL n 
1 108 HIS n 
1 109 MET n 
1 110 LYS n 
1 111 LYS n 
1 112 ALA n 
1 113 LEU n 
1 114 SER n 
1 115 GLY n 
1 116 ASP n 
1 117 SER n 
1 118 TYR n 
1 119 TRP n 
1 120 VAL n 
1 121 PHE n 
1 122 VAL n 
1 123 LYS n 
1 124 ARG n 
1 125 VAL n 
1 126 LYS n 
1 127 LEU n 
1 128 ALA n 
1 129 ALA n 
1 130 ALA n 
1 131 LEU n 
1 132 GLU n 
1 133 HIS n 
1 134 HIS n 
1 135 HIS n 
1 136 HIS n 
1 137 HIS n 
1 138 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   138 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 pyp 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Halorhodospira halophila' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1053 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET-24b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
FMT non-polymer         . 'FORMIC ACID'   ? 'C H2 O2'        46.025  
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   GLU 2   2   ?   ?   ?   A . n 
A 1 3   HIS 3   3   ?   ?   ?   A . n 
A 1 4   VAL 4   4   ?   ?   ?   A . n 
A 1 5   ALA 5   5   ?   ?   ?   A . n 
A 1 6   PHE 6   6   ?   ?   ?   A . n 
A 1 7   GLY 7   7   ?   ?   ?   A . n 
A 1 8   SER 8   8   ?   ?   ?   A . n 
A 1 9   GLU 9   9   ?   ?   ?   A . n 
A 1 10  ASP 10  10  ?   ?   ?   A . n 
A 1 11  ILE 11  11  ?   ?   ?   A . n 
A 1 12  GLU 12  12  ?   ?   ?   A . n 
A 1 13  ASN 13  13  ?   ?   ?   A . n 
A 1 14  THR 14  14  ?   ?   ?   A . n 
A 1 15  LEU 15  15  ?   ?   ?   A . n 
A 1 16  ALA 16  16  ?   ?   ?   A . n 
A 1 17  LYS 17  17  ?   ?   ?   A . n 
A 1 18  MET 18  18  ?   ?   ?   A . n 
A 1 19  ASP 19  19  ?   ?   ?   A . n 
A 1 20  ASP 20  20  ?   ?   ?   A . n 
A 1 21  GLY 21  21  ?   ?   ?   A . n 
A 1 22  GLN 22  22  ?   ?   ?   A . n 
A 1 23  LEU 23  23  ?   ?   ?   A . n 
A 1 24  ASP 24  24  ?   ?   ?   A . n 
A 1 25  GLY 25  25  25  GLY GLY A . n 
A 1 26  LEU 26  26  26  LEU LEU A . n 
A 1 27  ALA 27  27  27  ALA ALA A . n 
A 1 28  PHE 28  28  28  PHE PHE A . n 
A 1 29  GLY 29  29  29  GLY GLY A . n 
A 1 30  ALA 30  30  30  ALA ALA A . n 
A 1 31  ILE 31  31  31  ILE ILE A . n 
A 1 32  GLN 32  32  32  GLN GLN A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  ASP 34  34  34  ASP ASP A . n 
A 1 35  GLY 35  35  35  GLY GLY A . n 
A 1 36  ASP 36  36  36  ASP ASP A . n 
A 1 37  GLY 37  37  37  GLY GLY A . n 
A 1 38  ASN 38  38  38  ASN ASN A . n 
A 1 39  ILE 39  39  39  ILE ILE A . n 
A 1 40  LEU 40  40  40  LEU LEU A . n 
A 1 41  GLN 41  41  41  GLN GLN A . n 
A 1 42  TYR 42  42  42  TYR TYR A . n 
A 1 43  ASN 43  43  43  ASN ASN A . n 
A 1 44  ALA 44  44  44  ALA ALA A . n 
A 1 45  ALA 45  45  ?   ?   ?   A . n 
A 1 46  GLU 46  46  ?   ?   ?   A . n 
A 1 47  GLY 47  47  ?   ?   ?   A . n 
A 1 48  ASP 48  48  48  ASP ASP A . n 
A 1 49  ILE 49  49  49  ILE ILE A . n 
A 1 50  THR 50  50  50  THR THR A . n 
A 1 51  GLY 51  51  51  GLY GLY A . n 
A 1 52  ARG 52  52  52  ARG ARG A . n 
A 1 53  ASP 53  53  53  ASP ASP A . n 
A 1 54  PRO 54  54  54  PRO PRO A . n 
A 1 55  LYS 55  55  55  LYS LYS A . n 
A 1 56  GLN 56  56  56  GLN GLN A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  ILE 58  58  58  ILE ILE A . n 
A 1 59  GLY 59  59  59  GLY GLY A . n 
A 1 60  LYS 60  60  60  LYS LYS A . n 
A 1 61  ASN 61  61  61  ASN ASN A . n 
A 1 62  PHE 62  62  62  PHE PHE A . n 
A 1 63  PHE 63  63  63  PHE PHE A . n 
A 1 64  LYS 64  64  64  LYS LYS A . n 
A 1 65  ASP 65  65  65  ASP ASP A . n 
A 1 66  VAL 66  66  66  VAL VAL A . n 
A 1 67  ALA 67  67  67  ALA ALA A . n 
A 1 68  PRO 68  68  68  PRO PRO A . n 
A 1 69  GLY 69  69  69  GLY GLY A . n 
A 1 70  THR 70  70  70  THR THR A . n 
A 1 71  ASP 71  71  71  ASP ASP A . n 
A 1 72  SER 72  72  72  SER SER A . n 
A 1 73  PRO 73  73  73  PRO PRO A . n 
A 1 74  GLU 74  74  74  GLU GLU A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  TYR 76  76  76  TYR TYR A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  LYS 78  78  78  LYS LYS A . n 
A 1 79  PHE 79  79  79  PHE PHE A . n 
A 1 80  LYS 80  80  80  LYS LYS A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  GLY 82  82  82  GLY GLY A . n 
A 1 83  VAL 83  83  83  VAL VAL A . n 
A 1 84  ALA 84  84  84  ALA ALA A . n 
A 1 85  SER 85  85  85  SER SER A . n 
A 1 86  GLY 86  86  86  GLY GLY A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  LEU 88  88  88  LEU LEU A . n 
A 1 89  ASN 89  89  89  ASN ASN A . n 
A 1 90  THR 90  90  90  THR THR A . n 
A 1 91  MET 91  91  91  MET MET A . n 
A 1 92  PHE 92  92  92  PHE PHE A . n 
A 1 93  GLU 93  93  93  GLU GLU A . n 
A 1 94  TRP 94  94  94  TRP TRP A . n 
A 1 95  MET 95  95  95  MET MET A . n 
A 1 96  ILE 96  96  96  ILE ILE A . n 
A 1 97  PRO 97  97  97  PRO PRO A . n 
A 1 98  THR 98  98  98  THR THR A . n 
A 1 99  SER 99  99  99  SER SER A . n 
A 1 100 ARG 100 100 100 ARG ARG A . n 
A 1 101 GLY 101 101 101 GLY GLY A . n 
A 1 102 PRO 102 102 102 PRO PRO A . n 
A 1 103 THR 103 103 103 THR THR A . n 
A 1 104 LYS 104 104 104 LYS LYS A . n 
A 1 105 VAL 105 105 105 VAL VAL A . n 
A 1 106 LYS 106 106 106 LYS LYS A . n 
A 1 107 VAL 107 107 107 VAL VAL A . n 
A 1 108 HIS 108 108 108 HIS HIS A . n 
A 1 109 MET 109 109 109 MET MET A . n 
A 1 110 LYS 110 110 110 LYS LYS A . n 
A 1 111 LYS 111 111 111 LYS LYS A . n 
A 1 112 ALA 112 112 112 ALA ALA A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 SER 114 114 114 SER SER A . n 
A 1 115 GLY 115 115 115 GLY GLY A . n 
A 1 116 ASP 116 116 116 ASP ASP A . n 
A 1 117 SER 117 117 117 SER SER A . n 
A 1 118 TYR 118 118 118 TYR TYR A . n 
A 1 119 TRP 119 119 119 TRP TRP A . n 
A 1 120 VAL 120 120 120 VAL VAL A . n 
A 1 121 PHE 121 121 121 PHE PHE A . n 
A 1 122 VAL 122 122 122 VAL VAL A . n 
A 1 123 LYS 123 123 123 LYS LYS A . n 
A 1 124 ARG 124 124 124 ARG ARG A . n 
A 1 125 VAL 125 125 125 VAL VAL A . n 
A 1 126 LYS 126 126 126 LYS LYS A . n 
A 1 127 LEU 127 127 ?   ?   ?   A . n 
A 1 128 ALA 128 128 ?   ?   ?   A . n 
A 1 129 ALA 129 129 ?   ?   ?   A . n 
A 1 130 ALA 130 130 ?   ?   ?   A . n 
A 1 131 LEU 131 131 ?   ?   ?   A . n 
A 1 132 GLU 132 132 ?   ?   ?   A . n 
A 1 133 HIS 133 133 ?   ?   ?   A . n 
A 1 134 HIS 134 134 ?   ?   ?   A . n 
A 1 135 HIS 135 135 ?   ?   ?   A . n 
A 1 136 HIS 136 136 ?   ?   ?   A . n 
A 1 137 HIS 137 137 ?   ?   ?   A . n 
A 1 138 HIS 138 138 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 FMT 1  201 201 FMT FMT A . 
C 2 FMT 1  202 202 FMT FMT A . 
D 3 HOH 1  301 302 HOH HOH A . 
D 3 HOH 2  302 318 HOH HOH A . 
D 3 HOH 3  303 301 HOH HOH A . 
D 3 HOH 4  304 311 HOH HOH A . 
D 3 HOH 5  305 305 HOH HOH A . 
D 3 HOH 6  306 312 HOH HOH A . 
D 3 HOH 7  307 315 HOH HOH A . 
D 3 HOH 8  308 306 HOH HOH A . 
D 3 HOH 9  309 320 HOH HOH A . 
D 3 HOH 10 310 309 HOH HOH A . 
D 3 HOH 11 311 314 HOH HOH A . 
D 3 HOH 12 312 310 HOH HOH A . 
D 3 HOH 13 313 321 HOH HOH A . 
D 3 HOH 14 314 319 HOH HOH A . 
D 3 HOH 15 315 308 HOH HOH A . 
D 3 HOH 16 316 317 HOH HOH A . 
D 3 HOH 17 317 304 HOH HOH A . 
D 3 HOH 18 318 307 HOH HOH A . 
D 3 HOH 19 319 316 HOH HOH A . 
D 3 HOH 20 320 303 HOH HOH A . 
D 3 HOH 21 321 313 HOH HOH A . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LEU 26  ? CD1 ? A LEU 26  CD1 
2  1 Y 1 A LEU 26  ? CD2 ? A LEU 26  CD2 
3  1 Y 1 A ASP 48  ? CG  ? A ASP 48  CG  
4  1 Y 1 A ASP 48  ? OD1 ? A ASP 48  OD1 
5  1 Y 1 A ASP 48  ? OD2 ? A ASP 48  OD2 
6  1 Y 1 A LYS 55  ? NZ  ? A LYS 55  NZ  
7  1 Y 1 A LYS 64  ? CE  ? A LYS 64  CE  
8  1 Y 1 A LYS 64  ? NZ  ? A LYS 64  NZ  
9  1 Y 1 A LYS 80  ? NZ  ? A LYS 80  NZ  
10 1 Y 1 A ARG 100 ? CD  ? A ARG 100 CD  
11 1 Y 1 A ARG 100 ? NE  ? A ARG 100 NE  
12 1 Y 1 A ARG 100 ? CZ  ? A ARG 100 CZ  
13 1 Y 1 A ARG 100 ? NH1 ? A ARG 100 NH1 
14 1 Y 1 A ARG 100 ? NH2 ? A ARG 100 NH2 
15 1 Y 1 A LYS 104 ? CE  ? A LYS 104 CE  
16 1 Y 1 A LYS 104 ? NZ  ? A LYS 104 NZ  
17 1 Y 1 A LYS 106 ? CD  ? A LYS 106 CD  
18 1 Y 1 A LYS 106 ? CE  ? A LYS 106 CE  
19 1 Y 1 A LYS 106 ? NZ  ? A LYS 106 NZ  
20 1 Y 1 A LYS 110 ? CD  ? A LYS 110 CD  
21 1 Y 1 A LYS 110 ? CE  ? A LYS 110 CE  
22 1 Y 1 A LYS 110 ? NZ  ? A LYS 110 NZ  
23 1 Y 1 A LYS 111 ? NZ  ? A LYS 111 NZ  
24 1 Y 1 A LYS 123 ? CG  ? A LYS 123 CG  
25 1 Y 1 A LYS 123 ? CD  ? A LYS 123 CD  
26 1 Y 1 A LYS 123 ? CE  ? A LYS 123 CE  
27 1 Y 1 A LYS 123 ? NZ  ? A LYS 123 NZ  
28 1 Y 1 A ARG 124 ? CG  ? A ARG 124 CG  
29 1 Y 1 A ARG 124 ? CD  ? A ARG 124 CD  
30 1 Y 1 A ARG 124 ? NE  ? A ARG 124 NE  
31 1 Y 1 A ARG 124 ? CZ  ? A ARG 124 CZ  
32 1 Y 1 A ARG 124 ? NH1 ? A ARG 124 NH1 
33 1 Y 1 A ARG 124 ? NH2 ? A ARG 124 NH2 
34 1 Y 1 A LYS 126 ? CD  ? A LYS 126 CD  
35 1 Y 1 A LYS 126 ? CE  ? A LYS 126 CE  
36 1 Y 1 A LYS 126 ? NZ  ? A LYS 126 NZ  
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data collection' ? ? ? ? ? ? ? ? ? ? ? MxCuBE   ? ? ? 3         1 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? XDS      ? ? ? 20200131  2 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? XSCALE   ? ? ? 20200131  3 
? phasing           ? ? ? ? ? ? ? ? ? ? ? MoRDa    ? ? ? 1.3.02    4 
? 'model building'  ? ? ? ? ? ? ? ? ? ? ? ARP/wARP ? ? ? 8.0       5 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? 1.18_3855 6 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     7AV6 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     45.920 
_cell.length_a_esd                 ? 
_cell.length_b                     45.920 
_cell.length_b_esd                 ? 
_cell.length_c                     105.040 
_cell.length_c_esd                 ? 
_cell.volume                       221492.218 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         7AV6 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                92 
_symmetry.space_group_name_Hall            'P 4abw 2nw' 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   7AV6 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            1.78 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         31.1 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.2 M magnesium formate, 20 % w/v PEG 3350' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M-F' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2020-09-27 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9772 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ESRF BEAMLINE ID23-1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9772 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ID23-1 
_diffrn_source.pdbx_synchrotron_site       ESRF 
# 
_reflns.B_iso_Wilson_estimate            36.93 
_reflns.entry_id                         7AV6 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.50 
_reflns.d_resolution_low                 42.09 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       18549 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             98.5 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  25.4 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            32.8 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  0.007 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     1 
_reflns.pdbx_CC_star                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_CC_star 
_reflns_shell.pdbx_R_split 
1.50 1.54  ? 0.7   ? ? ? ? 1274 96.6 ? ? ? ? ? ? ? ? ? ? ? ? ? 23.9 ? ? ? ? ? 0.726 ? 1  1 0.325 ? ? 
1.54 1.58  ? 1.2   ? ? ? ? 1283 97.3 ? ? ? ? ? ? ? ? ? ? ? ? ? 26.1 ? ? ? ? ? 0.485 ? 2  1 0.585 ? ? 
1.58 1.62  ? 1.8   ? ? ? ? 1276 97.6 ? ? ? ? ? ? ? ? ? ? ? ? ? 27.1 ? ? ? ? ? 0.348 ? 3  1 0.723 ? ? 
1.62 1.68  ? 2.7   ? ? ? ? 1269 97.8 ? ? ? ? ? ? ? ? ? ? ? ? ? 26.9 ? ? ? ? ? 0.248 ? 4  1 0.842 ? ? 
1.68 1.74  ? 4.3   ? ? ? ? 1298 98.2 ? ? ? ? ? ? ? ? ? ? ? ? ? 26.2 ? ? ? ? ? 0.163 ? 5  1 0.934 ? ? 
1.74 1.81  ? 7.0   ? ? ? ? 1300 98.1 ? ? ? ? ? ? ? ? ? ? ? ? ? 25.0 ? ? ? ? ? 0.101 ? 6  1 0.977 ? ? 
1.81 1.89  ? 10.9  ? ? ? ? 1298 98.6 ? ? ? ? ? ? ? ? ? ? ? ? ? 25.9 ? ? ? ? ? 0.065 ? 7  1 0.990 ? ? 
1.89 1.99  ? 18.1  ? ? ? ? 1317 98.5 ? ? ? ? ? ? ? ? ? ? ? ? ? 26.9 ? ? ? ? ? 0.039 ? 8  1 0.997 ? ? 
1.99 2.11  ? 29.0  ? ? ? ? 1319 98.9 ? ? ? ? ? ? ? ? ? ? ? ? ? 26.4 ? ? ? ? ? 0.024 ? 9  1 0.998 ? ? 
2.11 2.28  ? 41.3  ? ? ? ? 1320 99.1 ? ? ? ? ? ? ? ? ? ? ? ? ? 24.8 ? ? ? ? ? 0.016 ? 10 1 0.999 ? ? 
2.28 2.50  ? 56.4  ? ? ? ? 1353 99.2 ? ? ? ? ? ? ? ? ? ? ? ? ? 25.4 ? ? ? ? ? 0.012 ? 11 1 0.999 ? ? 
2.50 2.87  ? 73.4  ? ? ? ? 1362 99.6 ? ? ? ? ? ? ? ? ? ? ? ? ? 25.8 ? ? ? ? ? 0.009 ? 12 1 1     ? ? 
2.87 3.61  ? 89.5  ? ? ? ? 1386 99.9 ? ? ? ? ? ? ? ? ? ? ? ? ? 23.1 ? ? ? ? ? 0.007 ? 13 1 1     ? ? 
3.61 42.09 ? 103.7 ? ? ? ? 1494 99.9 ? ? ? ? ? ? ? ? ? ? ? ? ? 23.0 ? ? ? ? ? 0.006 ? 14 1 1     ? ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               50.54 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 7AV6 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.50 
_refine.ls_d_res_low                             42.08 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     18518 
_refine.ls_number_reflns_R_free                  927 
_refine.ls_number_reflns_R_work                  17591 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    98.48 
_refine.ls_percent_reflns_R_free                 5.01 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2153 
_refine.ls_R_factor_R_free                       0.2372 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2141 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.33 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      1ODV 
_refine.pdbx_stereochemistry_target_values       'GeoStd + Monomer Library + CDL v1.2' 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 30.4480 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.2024 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       1.50 
_refine_hist.d_res_low                        42.08 
_refine_hist.number_atoms_solvent             21 
_refine_hist.number_atoms_total               762 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       ? 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        735 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         6 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.0053  ? 789  ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.7360  ? 1068 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.0717  ? 112  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.0055  ? 141  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 17.8633 ? 275  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_R_complete 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.50 1.58  . . 128 2419 96.59 . . . 0.3721 . 0.3451 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.58 1.68  . . 127 2410 97.65 . . . 0.3216 . 0.2806 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.68 1.81  . . 131 2473 98.15 . . . 0.2824 . 0.2520 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.81 1.99  . . 130 2482 98.53 . . . 0.2614 . 0.2313 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.99 2.28  . . 132 2502 98.95 . . . 0.2432 . 0.2273 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.28 2.87  . . 135 2574 99.41 . . . 0.2768 . 0.2455 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.87 42.08 . . 144 2731 99.90 . . . 0.2166 . 0.1960 . . . . . . . . . . . 
# 
_struct.entry_id                     7AV6 
_struct.title                        'FAST in a domain-swapped dimer form' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        7AV6 
_struct_keywords.text            
'fluorescence, fluorogen, fluorogen-activating protein, fluorescent labelling, FAST, FLUORESCENT PROTEIN' 
_struct_keywords.pdbx_keywords   'FLUORESCENT PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PYP_HALHA 
_struct_ref.pdbx_db_accession          P16113 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFK
EGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
;
_struct_ref.pdbx_align_begin           1 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              7AV6 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 125 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P16113 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  125 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       125 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 7AV6 GLY A 69  ? UNP P16113 CYS 69  'engineered mutation' 69  1  
1 7AV6 TRP A 94  ? UNP P16113 TYR 94  'engineered mutation' 94  2  
1 7AV6 MET A 95  ? UNP P16113 THR 95  'engineered mutation' 95  3  
1 7AV6 ILE A 96  ? UNP P16113 PHE 96  'engineered mutation' 96  4  
1 7AV6 PRO A 97  ? UNP P16113 ASP 97  'engineered mutation' 97  5  
1 7AV6 THR A 98  ? UNP P16113 TYR 98  'engineered mutation' 98  6  
1 7AV6 SER A 99  ? UNP P16113 GLN 99  'engineered mutation' 99  7  
1 7AV6 ARG A 100 ? UNP P16113 MET 100 'engineered mutation' 100 8  
1 7AV6 GLY A 101 ? UNP P16113 THR 101 'engineered mutation' 101 9  
1 7AV6 LYS A 126 ? UNP P16113 ?   ?   'expression tag'      126 10 
1 7AV6 LEU A 127 ? UNP P16113 ?   ?   'expression tag'      127 11 
1 7AV6 ALA A 128 ? UNP P16113 ?   ?   'expression tag'      128 12 
1 7AV6 ALA A 129 ? UNP P16113 ?   ?   'expression tag'      129 13 
1 7AV6 ALA A 130 ? UNP P16113 ?   ?   'expression tag'      130 14 
1 7AV6 LEU A 131 ? UNP P16113 ?   ?   'expression tag'      131 15 
1 7AV6 GLU A 132 ? UNP P16113 ?   ?   'expression tag'      132 16 
1 7AV6 HIS A 133 ? UNP P16113 ?   ?   'expression tag'      133 17 
1 7AV6 HIS A 134 ? UNP P16113 ?   ?   'expression tag'      134 18 
1 7AV6 HIS A 135 ? UNP P16113 ?   ?   'expression tag'      135 19 
1 7AV6 HIS A 136 ? UNP P16113 ?   ?   'expression tag'      136 20 
1 7AV6 HIS A 137 ? UNP P16113 ?   ?   'expression tag'      137 21 
1 7AV6 HIS A 138 ? UNP P16113 ?   ?   'expression tag'      138 22 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4150  ? 
1 MORE         -28   ? 
1 'SSA (A^2)'  11100 ? 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   none 
_pdbx_struct_assembly_auth_evidence.details                ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z            1.0000000000 0.0000000000  0.0000000000 0.0000000000  0.0000000000  
1.0000000000 0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 8_665 -y+1,-x+1,-z+1/2 0.0000000000 -1.0000000000 0.0000000000 45.9200000000 -1.0000000000 
0.0000000000 0.0000000000 45.9200000000 0.0000000000 0.0000000000 -1.0000000000 52.5200000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 ALA A 67 ? ASP A 71 ? ALA A 67 ASP A 71 5 ? 5  
HELX_P HELX_P2 AA2 PHE A 75 ? GLY A 86 ? PHE A 75 GLY A 86 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ALA A 30  ? LEU A 33  ? ALA A 30  LEU A 33  
AA1 2 ILE A 39  ? ASN A 43  ? ILE A 39  ASN A 43  
AA1 3 THR A 50  ? GLY A 51  ? THR A 50  GLY A 51  
AA2 1 ASN A 89  ? ILE A 96  ? ASN A 89  ILE A 96  
AA2 2 THR A 103 ? LYS A 111 ? THR A 103 LYS A 111 
AA2 3 TYR A 118 ? ARG A 124 ? TYR A 118 ARG A 124 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLN A 32  ? N GLN A 32  O LEU A 40  ? O LEU A 40  
AA1 2 3 N TYR A 42  ? N TYR A 42  O GLY A 51  ? O GLY A 51  
AA2 1 2 N PHE A 92  ? N PHE A 92  O VAL A 107 ? O VAL A 107 
AA2 2 3 N LYS A 106 ? N LYS A 106 O LYS A 123 ? O LYS A 123 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A FMT 201 ? 2 'binding site for residue FMT A 201' 
AC2 Software A FMT 202 ? 5 'binding site for residue FMT A 202' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 2 HIS A 108 ? HIS A 108 . ? 1_555 ? 
2 AC1 2 PHE A 121 ? PHE A 121 . ? 1_555 ? 
3 AC2 5 ALA A 67  ? ALA A 67  . ? 1_555 ? 
4 AC2 5 PRO A 68  ? PRO A 68  . ? 1_555 ? 
5 AC2 5 GLY A 69  ? GLY A 69  . ? 1_555 ? 
6 AC2 5 TRP A 119 ? TRP A 119 . ? 6_565 ? 
7 AC2 5 HOH D .   ? HOH A 307 . ? 1_555 ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 53 ? ? -151.26 71.23  
2 1 ASP A 53 ? ? -153.62 71.23  
3 1 PHE A 75 ? ? -139.68 -75.61 
4 1 ASN A 89 ? ? -163.49 85.90  
# 
loop_
_space_group_symop.id 
_space_group_symop.operation_xyz 
1 x,y,z               
2 -y+1/2,x+1/2,z+1/4  
3 y+1/2,-x+1/2,z+3/4  
4 x+1/2,-y+1/2,-z+3/4 
5 -x+1/2,y+1/2,-z+1/4 
6 -x,-y,z+1/2         
7 y,x,-z              
8 -y,-x,-z+1/2        
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[1][1]_esd 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][2]_esd 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[1][3]_esd 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[2][2]_esd 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.T[2][3]_esd 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[3][3]_esd 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[1][1]_esd 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][2]_esd 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[1][3]_esd 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[2][2]_esd 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.L[2][3]_esd 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[3][3]_esd 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][1]_esd 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][2]_esd 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[1][3]_esd 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][1]_esd 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][2]_esd 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][3]_esd 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][1]_esd 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][2]_esd 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[3][3]_esd 
1 'X-RAY DIFFRACTION' ? refined 3.73364874447 30.5233078564 12.9871314983 0.584604823124 ? 0.044370754351    ? -0.0469500860741 ? 
0.543027258357 ? -0.02375346869    ? 0.660599349522 ? 0.0973396778144 ? 0.113861638535  ? -0.00257650127215 ? 0.127677430525  ? 
-0.0310707173773 ? 0.114725834974  ? -0.292289094756   ? -0.939379024906  ? 0.172714974508  ? -0.162124744842 ? 0.416114040507   ? 
0.0170446549874  ? 0.443185766227   ? -0.0544315538845 ? 0.00358087660414  ? 
2 'X-RAY DIFFRACTION' ? refined 14.356393932  34.6135642241 17.6371652156 0.387606491834 ? -0.00618417827592 ? 0.0277351795026  ? 
0.272387513726 ? -0.00582115518221 ? 0.348366811455 ? 0.0633575315835 ? 0.119399755056  ? -0.0192778699205  ? 0.315832029415  ? 
-0.425135959949  ? 0.774876940768  ? 0.048539714596    ? -0.0612669590071 ? 0.0659627350955 ? -0.229867716272 ? 0.0939177168852  ? 
0.00738539850952 ? -0.140598469439  ? 0.115243956148   ? 0.00058296102121  ? 
3 'X-RAY DIFFRACTION' ? refined 9.91215936178 38.7855215105 24.6697529503 0.339446784209 ? 0.056409897494    ? 0.0645697053205  ? 
0.436688028155 ? 0.0719518757098   ? 0.417036181051 ? 0.0854473460101 ? -0.17923641193  ? 0.15400957788     ? 0.543695981051  ? 
-0.162225723378  ? 0.150727125903  ? 0.381681380083    ? 0.0274020974037  ? -0.988940944283 ? -0.313332818153 ? -0.0477543090053 ? 
-0.0851889490966 ? -0.251854660273  ? -0.239416871981  ? 0.00766864880909  ? 
4 'X-RAY DIFFRACTION' ? refined 21.0249953565 30.3979981586 39.6390682653 0.273897558212 ? 0.0141870554731   ? -0.0245662696472 ? 
0.53774484617  ? 0.0420931025543   ? 0.357133145269 ? 1.59054747554   ? 0.542771017803  ? -0.525264955228   ? 0.97415888996   ? 
-0.125300654674  ? 0.162176651847  ? 0.230134728571    ? -0.396710493789  ? -0.264368785199 ? 0.115495254896  ? -0.052308485375  ? 
-0.215660351422  ? 0.0726052179145  ? 0.771908189841   ? 0.00105496933819  ? 
5 'X-RAY DIFFRACTION' ? refined 14.9123901313 22.6519038667 46.5417180496 0.503294434598 ? -0.0291747663426  ? -0.0533780458388 ? 
0.626549269455 ? 0.244238649395    ? 0.551566555136 ? 0.786172149748  ? -0.302065803675 ? 0.018892665768    ? 0.192820820513  ? 
0.077649436328   ? 0.109558643232  ? 0.055889883261    ? -0.99234675478   ? -1.32031619781  ? 1.33383659604   ? 0.208627981394   ? 
-0.567211497243  ? 0.604662608573   ? -0.165792403141  ? -0.0472309100408  ? 
6 'X-RAY DIFFRACTION' ? refined 13.9769586546 32.0985541205 50.6031328413 0.533397835181 ? -0.182495340497   ? 0.0683765129142  ? 
0.82869119315  ? 0.121260149552    ? 0.340997898608 ? 1.57381626853   ? -1.35032124127  ? 0.183689497226    ? 1.53595504492   ? 
0.0625493399856  ? 0.262017252659  ? -0.54292058995    ? -1.19961540675   ? 0.211863120529  ? 0.764922109625  ? 0.700724555017   ? 
-0.206699286735  ? 0.13442956675    ? -1.09427780801   ? 0.0687775466863   ? 
7 'X-RAY DIFFRACTION' ? refined 28.1517752947 45.4601051052 48.5129448002 0.681529601209 ? -0.0272396867467  ? -0.0285508800117 ? 
0.710500971275 ? 0.105040433809    ? 0.609529345996 ? 0.254867754389  ? 0.0268681269841 ? -0.0533457512575  ? 0.0292454462794 ? 
0.032131709183   ? 0.0530553395994 ? -1.0715341425     ? 0.271601275896   ? -1.12806567494  ? -0.107134510899 ? -0.021359400449  ? 
-0.154301974901  ? -0.979895061631  ? 0.741123771681   ? -0.0029056868104  ? 
8 'X-RAY DIFFRACTION' ? refined 12.4130470332 35.0328623092 48.2524056989 0.371966399539 ? -0.0133431443115  ? -0.0063590951102 ? 
0.670625810874 ? 0.029206213045    ? 0.437346819408 ? 0.472325725351  ? -0.525238308686 ? 0.323816917592    ? 0.487902921902  ? 
-0.288542280686  ? 0.421339640516  ? -0.0962492120038  ? -0.344727059132  ? 0.353259427686  ? 0.121487649563  ? -0.142307326522  ? 
0.270672024068   ? 0.402557501162   ? -0.395285230262  ? 0.000851064173329 ? 
9 'X-RAY DIFFRACTION' ? refined 7.5123416506  32.5736453639 42.8319617961 0.308176290288 ? -0.00338455851548 ? -0.0021595923116 ? 
0.49920655182  ? 0.00376242186648  ? 0.449210932762 ? 0.860675849031  ? -0.530303625824 ? 0.202931846476    ? 0.427605519912  ? 
-0.490465362065  ? 1.00421674531   ? -0.00612221781742 ? -0.989476649236  ? -0.38125887639  ? 0.0248290422434 ? 0.119039473545   ? 
0.615880916474   ? -0.0999033809439 ? -0.793454534324  ? 0.013016431181    ? 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_PDB_ins_code 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_PDB_ins_code 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
1 'X-RAY DIFFRACTION' 1 A 1  A 25  ? A 5   A 29  ? ? 
;chain 'A' and (resid 25 through 29 )
;
2 'X-RAY DIFFRACTION' 2 A 6  A 30  ? A 21  A 44  ? ? 
;chain 'A' and (resid 30 through 44 )
;
3 'X-RAY DIFFRACTION' 3 A 22 A 48  ? A 31  A 56  ? ? 
;chain 'A' and (resid 48 through 56 )
;
4 'X-RAY DIFFRACTION' 4 A 32 A 57  ? A 51  A 75  ? ? 
;chain 'A' and (resid 57 through 75 )
;
5 'X-RAY DIFFRACTION' 5 A 52 A 76  ? A 62  A 85  ? ? 
;chain 'A' and (resid 76 through 85 )
;
6 'X-RAY DIFFRACTION' 6 A 63 A 86  ? A 73  A 96  ? ? 
;chain 'A' and (resid 86 through 96 )
;
7 'X-RAY DIFFRACTION' 7 A 74 A 97  ? A 79  A 102 ? ? 
;chain 'A' and (resid 97 through 102 )
;
8 'X-RAY DIFFRACTION' 8 A 80 A 103 ? A 88  A 111 ? ? 
;chain 'A' and (resid 103 through 111 )
;
9 'X-RAY DIFFRACTION' 9 A 89 A 112 ? A 103 A 126 ? ? 
;chain 'A' and (resid 112 through 126 )
;
# 
_pdbx_entry_details.entry_id                 7AV6 
_pdbx_entry_details.has_ligand_of_interest   N 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A GLU 2   ? A GLU 2   
3  1 Y 1 A HIS 3   ? A HIS 3   
4  1 Y 1 A VAL 4   ? A VAL 4   
5  1 Y 1 A ALA 5   ? A ALA 5   
6  1 Y 1 A PHE 6   ? A PHE 6   
7  1 Y 1 A GLY 7   ? A GLY 7   
8  1 Y 1 A SER 8   ? A SER 8   
9  1 Y 1 A GLU 9   ? A GLU 9   
10 1 Y 1 A ASP 10  ? A ASP 10  
11 1 Y 1 A ILE 11  ? A ILE 11  
12 1 Y 1 A GLU 12  ? A GLU 12  
13 1 Y 1 A ASN 13  ? A ASN 13  
14 1 Y 1 A THR 14  ? A THR 14  
15 1 Y 1 A LEU 15  ? A LEU 15  
16 1 Y 1 A ALA 16  ? A ALA 16  
17 1 Y 1 A LYS 17  ? A LYS 17  
18 1 Y 1 A MET 18  ? A MET 18  
19 1 Y 1 A ASP 19  ? A ASP 19  
20 1 Y 1 A ASP 20  ? A ASP 20  
21 1 Y 1 A GLY 21  ? A GLY 21  
22 1 Y 1 A GLN 22  ? A GLN 22  
23 1 Y 1 A LEU 23  ? A LEU 23  
24 1 Y 1 A ASP 24  ? A ASP 24  
25 1 Y 1 A ALA 45  ? A ALA 45  
26 1 Y 1 A GLU 46  ? A GLU 46  
27 1 Y 1 A GLY 47  ? A GLY 47  
28 1 Y 1 A LEU 127 ? A LEU 127 
29 1 Y 1 A ALA 128 ? A ALA 128 
30 1 Y 1 A ALA 129 ? A ALA 129 
31 1 Y 1 A ALA 130 ? A ALA 130 
32 1 Y 1 A LEU 131 ? A LEU 131 
33 1 Y 1 A GLU 132 ? A GLU 132 
34 1 Y 1 A HIS 133 ? A HIS 133 
35 1 Y 1 A HIS 134 ? A HIS 134 
36 1 Y 1 A HIS 135 ? A HIS 135 
37 1 Y 1 A HIS 136 ? A HIS 136 
38 1 Y 1 A HIS 137 ? A HIS 137 
39 1 Y 1 A HIS 138 ? A HIS 138 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
CYS N    N N N 74  
CYS CA   C N R 75  
CYS C    C N N 76  
CYS O    O N N 77  
CYS CB   C N N 78  
CYS SG   S N N 79  
CYS OXT  O N N 80  
CYS H    H N N 81  
CYS H2   H N N 82  
CYS HA   H N N 83  
CYS HB2  H N N 84  
CYS HB3  H N N 85  
CYS HG   H N N 86  
CYS HXT  H N N 87  
FMT C    C N N 88  
FMT O1   O N N 89  
FMT O2   O N N 90  
FMT H    H N N 91  
FMT HO2  H N N 92  
GLN N    N N N 93  
GLN CA   C N S 94  
GLN C    C N N 95  
GLN O    O N N 96  
GLN CB   C N N 97  
GLN CG   C N N 98  
GLN CD   C N N 99  
GLN OE1  O N N 100 
GLN NE2  N N N 101 
GLN OXT  O N N 102 
GLN H    H N N 103 
GLN H2   H N N 104 
GLN HA   H N N 105 
GLN HB2  H N N 106 
GLN HB3  H N N 107 
GLN HG2  H N N 108 
GLN HG3  H N N 109 
GLN HE21 H N N 110 
GLN HE22 H N N 111 
GLN HXT  H N N 112 
GLU N    N N N 113 
GLU CA   C N S 114 
GLU C    C N N 115 
GLU O    O N N 116 
GLU CB   C N N 117 
GLU CG   C N N 118 
GLU CD   C N N 119 
GLU OE1  O N N 120 
GLU OE2  O N N 121 
GLU OXT  O N N 122 
GLU H    H N N 123 
GLU H2   H N N 124 
GLU HA   H N N 125 
GLU HB2  H N N 126 
GLU HB3  H N N 127 
GLU HG2  H N N 128 
GLU HG3  H N N 129 
GLU HE2  H N N 130 
GLU HXT  H N N 131 
GLY N    N N N 132 
GLY CA   C N N 133 
GLY C    C N N 134 
GLY O    O N N 135 
GLY OXT  O N N 136 
GLY H    H N N 137 
GLY H2   H N N 138 
GLY HA2  H N N 139 
GLY HA3  H N N 140 
GLY HXT  H N N 141 
HIS N    N N N 142 
HIS CA   C N S 143 
HIS C    C N N 144 
HIS O    O N N 145 
HIS CB   C N N 146 
HIS CG   C Y N 147 
HIS ND1  N Y N 148 
HIS CD2  C Y N 149 
HIS CE1  C Y N 150 
HIS NE2  N Y N 151 
HIS OXT  O N N 152 
HIS H    H N N 153 
HIS H2   H N N 154 
HIS HA   H N N 155 
HIS HB2  H N N 156 
HIS HB3  H N N 157 
HIS HD1  H N N 158 
HIS HD2  H N N 159 
HIS HE1  H N N 160 
HIS HE2  H N N 161 
HIS HXT  H N N 162 
HOH O    O N N 163 
HOH H1   H N N 164 
HOH H2   H N N 165 
ILE N    N N N 166 
ILE CA   C N S 167 
ILE C    C N N 168 
ILE O    O N N 169 
ILE CB   C N S 170 
ILE CG1  C N N 171 
ILE CG2  C N N 172 
ILE CD1  C N N 173 
ILE OXT  O N N 174 
ILE H    H N N 175 
ILE H2   H N N 176 
ILE HA   H N N 177 
ILE HB   H N N 178 
ILE HG12 H N N 179 
ILE HG13 H N N 180 
ILE HG21 H N N 181 
ILE HG22 H N N 182 
ILE HG23 H N N 183 
ILE HD11 H N N 184 
ILE HD12 H N N 185 
ILE HD13 H N N 186 
ILE HXT  H N N 187 
LEU N    N N N 188 
LEU CA   C N S 189 
LEU C    C N N 190 
LEU O    O N N 191 
LEU CB   C N N 192 
LEU CG   C N N 193 
LEU CD1  C N N 194 
LEU CD2  C N N 195 
LEU OXT  O N N 196 
LEU H    H N N 197 
LEU H2   H N N 198 
LEU HA   H N N 199 
LEU HB2  H N N 200 
LEU HB3  H N N 201 
LEU HG   H N N 202 
LEU HD11 H N N 203 
LEU HD12 H N N 204 
LEU HD13 H N N 205 
LEU HD21 H N N 206 
LEU HD22 H N N 207 
LEU HD23 H N N 208 
LEU HXT  H N N 209 
LYS N    N N N 210 
LYS CA   C N S 211 
LYS C    C N N 212 
LYS O    O N N 213 
LYS CB   C N N 214 
LYS CG   C N N 215 
LYS CD   C N N 216 
LYS CE   C N N 217 
LYS NZ   N N N 218 
LYS OXT  O N N 219 
LYS H    H N N 220 
LYS H2   H N N 221 
LYS HA   H N N 222 
LYS HB2  H N N 223 
LYS HB3  H N N 224 
LYS HG2  H N N 225 
LYS HG3  H N N 226 
LYS HD2  H N N 227 
LYS HD3  H N N 228 
LYS HE2  H N N 229 
LYS HE3  H N N 230 
LYS HZ1  H N N 231 
LYS HZ2  H N N 232 
LYS HZ3  H N N 233 
LYS HXT  H N N 234 
MET N    N N N 235 
MET CA   C N S 236 
MET C    C N N 237 
MET O    O N N 238 
MET CB   C N N 239 
MET CG   C N N 240 
MET SD   S N N 241 
MET CE   C N N 242 
MET OXT  O N N 243 
MET H    H N N 244 
MET H2   H N N 245 
MET HA   H N N 246 
MET HB2  H N N 247 
MET HB3  H N N 248 
MET HG2  H N N 249 
MET HG3  H N N 250 
MET HE1  H N N 251 
MET HE2  H N N 252 
MET HE3  H N N 253 
MET HXT  H N N 254 
PHE N    N N N 255 
PHE CA   C N S 256 
PHE C    C N N 257 
PHE O    O N N 258 
PHE CB   C N N 259 
PHE CG   C Y N 260 
PHE CD1  C Y N 261 
PHE CD2  C Y N 262 
PHE CE1  C Y N 263 
PHE CE2  C Y N 264 
PHE CZ   C Y N 265 
PHE OXT  O N N 266 
PHE H    H N N 267 
PHE H2   H N N 268 
PHE HA   H N N 269 
PHE HB2  H N N 270 
PHE HB3  H N N 271 
PHE HD1  H N N 272 
PHE HD2  H N N 273 
PHE HE1  H N N 274 
PHE HE2  H N N 275 
PHE HZ   H N N 276 
PHE HXT  H N N 277 
PRO N    N N N 278 
PRO CA   C N S 279 
PRO C    C N N 280 
PRO O    O N N 281 
PRO CB   C N N 282 
PRO CG   C N N 283 
PRO CD   C N N 284 
PRO OXT  O N N 285 
PRO H    H N N 286 
PRO HA   H N N 287 
PRO HB2  H N N 288 
PRO HB3  H N N 289 
PRO HG2  H N N 290 
PRO HG3  H N N 291 
PRO HD2  H N N 292 
PRO HD3  H N N 293 
PRO HXT  H N N 294 
SER N    N N N 295 
SER CA   C N S 296 
SER C    C N N 297 
SER O    O N N 298 
SER CB   C N N 299 
SER OG   O N N 300 
SER OXT  O N N 301 
SER H    H N N 302 
SER H2   H N N 303 
SER HA   H N N 304 
SER HB2  H N N 305 
SER HB3  H N N 306 
SER HG   H N N 307 
SER HXT  H N N 308 
THR N    N N N 309 
THR CA   C N S 310 
THR C    C N N 311 
THR O    O N N 312 
THR CB   C N R 313 
THR OG1  O N N 314 
THR CG2  C N N 315 
THR OXT  O N N 316 
THR H    H N N 317 
THR H2   H N N 318 
THR HA   H N N 319 
THR HB   H N N 320 
THR HG1  H N N 321 
THR HG21 H N N 322 
THR HG22 H N N 323 
THR HG23 H N N 324 
THR HXT  H N N 325 
TRP N    N N N 326 
TRP CA   C N S 327 
TRP C    C N N 328 
TRP O    O N N 329 
TRP CB   C N N 330 
TRP CG   C Y N 331 
TRP CD1  C Y N 332 
TRP CD2  C Y N 333 
TRP NE1  N Y N 334 
TRP CE2  C Y N 335 
TRP CE3  C Y N 336 
TRP CZ2  C Y N 337 
TRP CZ3  C Y N 338 
TRP CH2  C Y N 339 
TRP OXT  O N N 340 
TRP H    H N N 341 
TRP H2   H N N 342 
TRP HA   H N N 343 
TRP HB2  H N N 344 
TRP HB3  H N N 345 
TRP HD1  H N N 346 
TRP HE1  H N N 347 
TRP HE3  H N N 348 
TRP HZ2  H N N 349 
TRP HZ3  H N N 350 
TRP HH2  H N N 351 
TRP HXT  H N N 352 
TYR N    N N N 353 
TYR CA   C N S 354 
TYR C    C N N 355 
TYR O    O N N 356 
TYR CB   C N N 357 
TYR CG   C Y N 358 
TYR CD1  C Y N 359 
TYR CD2  C Y N 360 
TYR CE1  C Y N 361 
TYR CE2  C Y N 362 
TYR CZ   C Y N 363 
TYR OH   O N N 364 
TYR OXT  O N N 365 
TYR H    H N N 366 
TYR H2   H N N 367 
TYR HA   H N N 368 
TYR HB2  H N N 369 
TYR HB3  H N N 370 
TYR HD1  H N N 371 
TYR HD2  H N N 372 
TYR HE1  H N N 373 
TYR HE2  H N N 374 
TYR HH   H N N 375 
TYR HXT  H N N 376 
VAL N    N N N 377 
VAL CA   C N S 378 
VAL C    C N N 379 
VAL O    O N N 380 
VAL CB   C N N 381 
VAL CG1  C N N 382 
VAL CG2  C N N 383 
VAL OXT  O N N 384 
VAL H    H N N 385 
VAL H2   H N N 386 
VAL HA   H N N 387 
VAL HB   H N N 388 
VAL HG11 H N N 389 
VAL HG12 H N N 390 
VAL HG13 H N N 391 
VAL HG21 H N N 392 
VAL HG22 H N N 393 
VAL HG23 H N N 394 
VAL HXT  H N N 395 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
FMT C   O1   doub N N 83  
FMT C   O2   sing N N 84  
FMT C   H    sing N N 85  
FMT O2  HO2  sing N N 86  
GLN N   CA   sing N N 87  
GLN N   H    sing N N 88  
GLN N   H2   sing N N 89  
GLN CA  C    sing N N 90  
GLN CA  CB   sing N N 91  
GLN CA  HA   sing N N 92  
GLN C   O    doub N N 93  
GLN C   OXT  sing N N 94  
GLN CB  CG   sing N N 95  
GLN CB  HB2  sing N N 96  
GLN CB  HB3  sing N N 97  
GLN CG  CD   sing N N 98  
GLN CG  HG2  sing N N 99  
GLN CG  HG3  sing N N 100 
GLN CD  OE1  doub N N 101 
GLN CD  NE2  sing N N 102 
GLN NE2 HE21 sing N N 103 
GLN NE2 HE22 sing N N 104 
GLN OXT HXT  sing N N 105 
GLU N   CA   sing N N 106 
GLU N   H    sing N N 107 
GLU N   H2   sing N N 108 
GLU CA  C    sing N N 109 
GLU CA  CB   sing N N 110 
GLU CA  HA   sing N N 111 
GLU C   O    doub N N 112 
GLU C   OXT  sing N N 113 
GLU CB  CG   sing N N 114 
GLU CB  HB2  sing N N 115 
GLU CB  HB3  sing N N 116 
GLU CG  CD   sing N N 117 
GLU CG  HG2  sing N N 118 
GLU CG  HG3  sing N N 119 
GLU CD  OE1  doub N N 120 
GLU CD  OE2  sing N N 121 
GLU OE2 HE2  sing N N 122 
GLU OXT HXT  sing N N 123 
GLY N   CA   sing N N 124 
GLY N   H    sing N N 125 
GLY N   H2   sing N N 126 
GLY CA  C    sing N N 127 
GLY CA  HA2  sing N N 128 
GLY CA  HA3  sing N N 129 
GLY C   O    doub N N 130 
GLY C   OXT  sing N N 131 
GLY OXT HXT  sing N N 132 
HIS N   CA   sing N N 133 
HIS N   H    sing N N 134 
HIS N   H2   sing N N 135 
HIS CA  C    sing N N 136 
HIS CA  CB   sing N N 137 
HIS CA  HA   sing N N 138 
HIS C   O    doub N N 139 
HIS C   OXT  sing N N 140 
HIS CB  CG   sing N N 141 
HIS CB  HB2  sing N N 142 
HIS CB  HB3  sing N N 143 
HIS CG  ND1  sing Y N 144 
HIS CG  CD2  doub Y N 145 
HIS ND1 CE1  doub Y N 146 
HIS ND1 HD1  sing N N 147 
HIS CD2 NE2  sing Y N 148 
HIS CD2 HD2  sing N N 149 
HIS CE1 NE2  sing Y N 150 
HIS CE1 HE1  sing N N 151 
HIS NE2 HE2  sing N N 152 
HIS OXT HXT  sing N N 153 
HOH O   H1   sing N N 154 
HOH O   H2   sing N N 155 
ILE N   CA   sing N N 156 
ILE N   H    sing N N 157 
ILE N   H2   sing N N 158 
ILE CA  C    sing N N 159 
ILE CA  CB   sing N N 160 
ILE CA  HA   sing N N 161 
ILE C   O    doub N N 162 
ILE C   OXT  sing N N 163 
ILE CB  CG1  sing N N 164 
ILE CB  CG2  sing N N 165 
ILE CB  HB   sing N N 166 
ILE CG1 CD1  sing N N 167 
ILE CG1 HG12 sing N N 168 
ILE CG1 HG13 sing N N 169 
ILE CG2 HG21 sing N N 170 
ILE CG2 HG22 sing N N 171 
ILE CG2 HG23 sing N N 172 
ILE CD1 HD11 sing N N 173 
ILE CD1 HD12 sing N N 174 
ILE CD1 HD13 sing N N 175 
ILE OXT HXT  sing N N 176 
LEU N   CA   sing N N 177 
LEU N   H    sing N N 178 
LEU N   H2   sing N N 179 
LEU CA  C    sing N N 180 
LEU CA  CB   sing N N 181 
LEU CA  HA   sing N N 182 
LEU C   O    doub N N 183 
LEU C   OXT  sing N N 184 
LEU CB  CG   sing N N 185 
LEU CB  HB2  sing N N 186 
LEU CB  HB3  sing N N 187 
LEU CG  CD1  sing N N 188 
LEU CG  CD2  sing N N 189 
LEU CG  HG   sing N N 190 
LEU CD1 HD11 sing N N 191 
LEU CD1 HD12 sing N N 192 
LEU CD1 HD13 sing N N 193 
LEU CD2 HD21 sing N N 194 
LEU CD2 HD22 sing N N 195 
LEU CD2 HD23 sing N N 196 
LEU OXT HXT  sing N N 197 
LYS N   CA   sing N N 198 
LYS N   H    sing N N 199 
LYS N   H2   sing N N 200 
LYS CA  C    sing N N 201 
LYS CA  CB   sing N N 202 
LYS CA  HA   sing N N 203 
LYS C   O    doub N N 204 
LYS C   OXT  sing N N 205 
LYS CB  CG   sing N N 206 
LYS CB  HB2  sing N N 207 
LYS CB  HB3  sing N N 208 
LYS CG  CD   sing N N 209 
LYS CG  HG2  sing N N 210 
LYS CG  HG3  sing N N 211 
LYS CD  CE   sing N N 212 
LYS CD  HD2  sing N N 213 
LYS CD  HD3  sing N N 214 
LYS CE  NZ   sing N N 215 
LYS CE  HE2  sing N N 216 
LYS CE  HE3  sing N N 217 
LYS NZ  HZ1  sing N N 218 
LYS NZ  HZ2  sing N N 219 
LYS NZ  HZ3  sing N N 220 
LYS OXT HXT  sing N N 221 
MET N   CA   sing N N 222 
MET N   H    sing N N 223 
MET N   H2   sing N N 224 
MET CA  C    sing N N 225 
MET CA  CB   sing N N 226 
MET CA  HA   sing N N 227 
MET C   O    doub N N 228 
MET C   OXT  sing N N 229 
MET CB  CG   sing N N 230 
MET CB  HB2  sing N N 231 
MET CB  HB3  sing N N 232 
MET CG  SD   sing N N 233 
MET CG  HG2  sing N N 234 
MET CG  HG3  sing N N 235 
MET SD  CE   sing N N 236 
MET CE  HE1  sing N N 237 
MET CE  HE2  sing N N 238 
MET CE  HE3  sing N N 239 
MET OXT HXT  sing N N 240 
PHE N   CA   sing N N 241 
PHE N   H    sing N N 242 
PHE N   H2   sing N N 243 
PHE CA  C    sing N N 244 
PHE CA  CB   sing N N 245 
PHE CA  HA   sing N N 246 
PHE C   O    doub N N 247 
PHE C   OXT  sing N N 248 
PHE CB  CG   sing N N 249 
PHE CB  HB2  sing N N 250 
PHE CB  HB3  sing N N 251 
PHE CG  CD1  doub Y N 252 
PHE CG  CD2  sing Y N 253 
PHE CD1 CE1  sing Y N 254 
PHE CD1 HD1  sing N N 255 
PHE CD2 CE2  doub Y N 256 
PHE CD2 HD2  sing N N 257 
PHE CE1 CZ   doub Y N 258 
PHE CE1 HE1  sing N N 259 
PHE CE2 CZ   sing Y N 260 
PHE CE2 HE2  sing N N 261 
PHE CZ  HZ   sing N N 262 
PHE OXT HXT  sing N N 263 
PRO N   CA   sing N N 264 
PRO N   CD   sing N N 265 
PRO N   H    sing N N 266 
PRO CA  C    sing N N 267 
PRO CA  CB   sing N N 268 
PRO CA  HA   sing N N 269 
PRO C   O    doub N N 270 
PRO C   OXT  sing N N 271 
PRO CB  CG   sing N N 272 
PRO CB  HB2  sing N N 273 
PRO CB  HB3  sing N N 274 
PRO CG  CD   sing N N 275 
PRO CG  HG2  sing N N 276 
PRO CG  HG3  sing N N 277 
PRO CD  HD2  sing N N 278 
PRO CD  HD3  sing N N 279 
PRO OXT HXT  sing N N 280 
SER N   CA   sing N N 281 
SER N   H    sing N N 282 
SER N   H2   sing N N 283 
SER CA  C    sing N N 284 
SER CA  CB   sing N N 285 
SER CA  HA   sing N N 286 
SER C   O    doub N N 287 
SER C   OXT  sing N N 288 
SER CB  OG   sing N N 289 
SER CB  HB2  sing N N 290 
SER CB  HB3  sing N N 291 
SER OG  HG   sing N N 292 
SER OXT HXT  sing N N 293 
THR N   CA   sing N N 294 
THR N   H    sing N N 295 
THR N   H2   sing N N 296 
THR CA  C    sing N N 297 
THR CA  CB   sing N N 298 
THR CA  HA   sing N N 299 
THR C   O    doub N N 300 
THR C   OXT  sing N N 301 
THR CB  OG1  sing N N 302 
THR CB  CG2  sing N N 303 
THR CB  HB   sing N N 304 
THR OG1 HG1  sing N N 305 
THR CG2 HG21 sing N N 306 
THR CG2 HG22 sing N N 307 
THR CG2 HG23 sing N N 308 
THR OXT HXT  sing N N 309 
TRP N   CA   sing N N 310 
TRP N   H    sing N N 311 
TRP N   H2   sing N N 312 
TRP CA  C    sing N N 313 
TRP CA  CB   sing N N 314 
TRP CA  HA   sing N N 315 
TRP C   O    doub N N 316 
TRP C   OXT  sing N N 317 
TRP CB  CG   sing N N 318 
TRP CB  HB2  sing N N 319 
TRP CB  HB3  sing N N 320 
TRP CG  CD1  doub Y N 321 
TRP CG  CD2  sing Y N 322 
TRP CD1 NE1  sing Y N 323 
TRP CD1 HD1  sing N N 324 
TRP CD2 CE2  doub Y N 325 
TRP CD2 CE3  sing Y N 326 
TRP NE1 CE2  sing Y N 327 
TRP NE1 HE1  sing N N 328 
TRP CE2 CZ2  sing Y N 329 
TRP CE3 CZ3  doub Y N 330 
TRP CE3 HE3  sing N N 331 
TRP CZ2 CH2  doub Y N 332 
TRP CZ2 HZ2  sing N N 333 
TRP CZ3 CH2  sing Y N 334 
TRP CZ3 HZ3  sing N N 335 
TRP CH2 HH2  sing N N 336 
TRP OXT HXT  sing N N 337 
TYR N   CA   sing N N 338 
TYR N   H    sing N N 339 
TYR N   H2   sing N N 340 
TYR CA  C    sing N N 341 
TYR CA  CB   sing N N 342 
TYR CA  HA   sing N N 343 
TYR C   O    doub N N 344 
TYR C   OXT  sing N N 345 
TYR CB  CG   sing N N 346 
TYR CB  HB2  sing N N 347 
TYR CB  HB3  sing N N 348 
TYR CG  CD1  doub Y N 349 
TYR CG  CD2  sing Y N 350 
TYR CD1 CE1  sing Y N 351 
TYR CD1 HD1  sing N N 352 
TYR CD2 CE2  doub Y N 353 
TYR CD2 HD2  sing N N 354 
TYR CE1 CZ   doub Y N 355 
TYR CE1 HE1  sing N N 356 
TYR CE2 CZ   sing Y N 357 
TYR CE2 HE2  sing N N 358 
TYR CZ  OH   sing N N 359 
TYR OH  HH   sing N N 360 
TYR OXT HXT  sing N N 361 
VAL N   CA   sing N N 362 
VAL N   H    sing N N 363 
VAL N   H2   sing N N 364 
VAL CA  C    sing N N 365 
VAL CA  CB   sing N N 366 
VAL CA  HA   sing N N 367 
VAL C   O    doub N N 368 
VAL C   OXT  sing N N 369 
VAL CB  CG1  sing N N 370 
VAL CB  CG2  sing N N 371 
VAL CB  HB   sing N N 372 
VAL CG1 HG11 sing N N 373 
VAL CG1 HG12 sing N N 374 
VAL CG1 HG13 sing N N 375 
VAL CG2 HG21 sing N N 376 
VAL CG2 HG22 sing N N 377 
VAL CG2 HG23 sing N N 378 
VAL OXT HXT  sing N N 379 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'experimental model' 
_pdbx_initial_refinement_model.source_name      PDB 
_pdbx_initial_refinement_model.accession_code   1ODV 
_pdbx_initial_refinement_model.details          ? 
# 
_space_group.name_H-M_alt     'P 41 21 2' 
_space_group.name_Hall        'P 4abw 2nw' 
_space_group.IT_number        92 
_space_group.crystal_system   tetragonal 
_space_group.id               1 
# 
_atom_sites.entry_id                    7AV6 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.021777 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.021777 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009520 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
_atom_type.scat_dispersion_real 
_atom_type.scat_dispersion_imag 
_atom_type.scat_Cromer_Mann_a1 
_atom_type.scat_Cromer_Mann_a2 
_atom_type.scat_Cromer_Mann_a3 
_atom_type.scat_Cromer_Mann_a4 
_atom_type.scat_Cromer_Mann_b1 
_atom_type.scat_Cromer_Mann_b2 
_atom_type.scat_Cromer_Mann_b3 
_atom_type.scat_Cromer_Mann_b4 
_atom_type.scat_Cromer_Mann_c 
_atom_type.scat_source 
_atom_type.scat_dispersion_source 
C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364  ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589  ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748  ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
S ? ? 9.55732 6.39887 ? ? 1.23737  29.19336 ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
# 
loop_