data_7AV6 # _entry.id 7AV6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.384 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7AV6 pdb_00007av6 10.2210/pdb7av6/pdb WWPDB D_1292112082 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-06-09 2 'Structure model' 1 1 2024-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7AV6 _pdbx_database_status.recvd_initial_deposition_date 2020-11-04 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Bukhdruker, S.' 1 0000-0002-0157-532X 'Remeeva, A.' 2 0000-0003-3977-3679 'Ruchkin, D.' 3 ? 'Gorbachev, D.' 4 ? 'Povarova, N.' 5 ? 'Mineev, K.' 6 0000-0002-2418-9421 'Goncharuk, S.' 7 0000-0002-0263-6462 'Baranov, M.' 8 0000-0002-9339-7603 'Mishin, A.' 9 0000-0003-3759-380X 'Borshchevskiy, V.' 10 0000-0003-4398-9712 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Chem Sci' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-6520 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 12 _citation.language ? _citation.page_first 6719 _citation.page_last 6725 _citation.title 'NanoFAST: structure-based design of a small fluorogen-activating protein with only 98 amino acids.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1039/d1sc01454d _citation.pdbx_database_id_PubMed 34040747 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mineev, K.S.' 1 0000-0002-2418-9421 primary 'Goncharuk, S.A.' 2 ? primary 'Goncharuk, M.V.' 3 ? primary 'Povarova, N.V.' 4 ? primary 'Sokolov, A.I.' 5 ? primary 'Baleeva, N.S.' 6 ? primary 'Smirnov, A.Y.' 7 0000-0002-1545-6604 primary 'Myasnyanko, I.N.' 8 0000-0002-2168-3555 primary 'Ruchkin, D.A.' 9 ? primary 'Bukhdruker, S.' 10 ? primary 'Remeeva, A.' 11 ? primary 'Mishin, A.' 12 0000-0003-3759-380X primary 'Borshchevskiy, V.' 13 ? primary 'Gordeliy, V.' 14 ? primary 'Arseniev, A.S.' 15 ? primary 'Gorbachev, D.A.' 16 ? primary 'Gavrikov, A.S.' 17 ? primary 'Mishin, A.S.' 18 0000-0002-4935-7030 primary 'Baranov, M.S.' 19 0000-0002-9339-7603 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Photoactive yellow protein' 15249.174 1 ? ? ? FAST 2 non-polymer syn 'FORMIC ACID' 46.025 2 ? ? ? ? 3 water nat water 18.015 21 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PYP; FAST' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPGTDSPEFYGKFK EGVASGNLNTMFEWMIPTSRGPTKVKVHMKKALSGDSYWVFVKRVKLAAALEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPGTDSPEFYGKFK EGVASGNLNTMFEWMIPTSRGPTKVKVHMKKALSGDSYWVFVKRVKLAAALEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'FORMIC ACID' FMT 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 HIS n 1 4 VAL n 1 5 ALA n 1 6 PHE n 1 7 GLY n 1 8 SER n 1 9 GLU n 1 10 ASP n 1 11 ILE n 1 12 GLU n 1 13 ASN n 1 14 THR n 1 15 LEU n 1 16 ALA n 1 17 LYS n 1 18 MET n 1 19 ASP n 1 20 ASP n 1 21 GLY n 1 22 GLN n 1 23 LEU n 1 24 ASP n 1 25 GLY n 1 26 LEU n 1 27 ALA n 1 28 PHE n 1 29 GLY n 1 30 ALA n 1 31 ILE n 1 32 GLN n 1 33 LEU n 1 34 ASP n 1 35 GLY n 1 36 ASP n 1 37 GLY n 1 38 ASN n 1 39 ILE n 1 40 LEU n 1 41 GLN n 1 42 TYR n 1 43 ASN n 1 44 ALA n 1 45 ALA n 1 46 GLU n 1 47 GLY n 1 48 ASP n 1 49 ILE n 1 50 THR n 1 51 GLY n 1 52 ARG n 1 53 ASP n 1 54 PRO n 1 55 LYS n 1 56 GLN n 1 57 VAL n 1 58 ILE n 1 59 GLY n 1 60 LYS n 1 61 ASN n 1 62 PHE n 1 63 PHE n 1 64 LYS n 1 65 ASP n 1 66 VAL n 1 67 ALA n 1 68 PRO n 1 69 GLY n 1 70 THR n 1 71 ASP n 1 72 SER n 1 73 PRO n 1 74 GLU n 1 75 PHE n 1 76 TYR n 1 77 GLY n 1 78 LYS n 1 79 PHE n 1 80 LYS n 1 81 GLU n 1 82 GLY n 1 83 VAL n 1 84 ALA n 1 85 SER n 1 86 GLY n 1 87 ASN n 1 88 LEU n 1 89 ASN n 1 90 THR n 1 91 MET n 1 92 PHE n 1 93 GLU n 1 94 TRP n 1 95 MET n 1 96 ILE n 1 97 PRO n 1 98 THR n 1 99 SER n 1 100 ARG n 1 101 GLY n 1 102 PRO n 1 103 THR n 1 104 LYS n 1 105 VAL n 1 106 LYS n 1 107 VAL n 1 108 HIS n 1 109 MET n 1 110 LYS n 1 111 LYS n 1 112 ALA n 1 113 LEU n 1 114 SER n 1 115 GLY n 1 116 ASP n 1 117 SER n 1 118 TYR n 1 119 TRP n 1 120 VAL n 1 121 PHE n 1 122 VAL n 1 123 LYS n 1 124 ARG n 1 125 VAL n 1 126 LYS n 1 127 LEU n 1 128 ALA n 1 129 ALA n 1 130 ALA n 1 131 LEU n 1 132 GLU n 1 133 HIS n 1 134 HIS n 1 135 HIS n 1 136 HIS n 1 137 HIS n 1 138 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 138 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene pyp _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Halorhodospira halophila' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1053 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET-24b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FMT non-polymer . 'FORMIC ACID' ? 'C H2 O2' 46.025 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLU 2 2 ? ? ? A . n A 1 3 HIS 3 3 ? ? ? A . n A 1 4 VAL 4 4 ? ? ? A . n A 1 5 ALA 5 5 ? ? ? A . n A 1 6 PHE 6 6 ? ? ? A . n A 1 7 GLY 7 7 ? ? ? A . n A 1 8 SER 8 8 ? ? ? A . n A 1 9 GLU 9 9 ? ? ? A . n A 1 10 ASP 10 10 ? ? ? A . n A 1 11 ILE 11 11 ? ? ? A . n A 1 12 GLU 12 12 ? ? ? A . n A 1 13 ASN 13 13 ? ? ? A . n A 1 14 THR 14 14 ? ? ? A . n A 1 15 LEU 15 15 ? ? ? A . n A 1 16 ALA 16 16 ? ? ? A . n A 1 17 LYS 17 17 ? ? ? A . n A 1 18 MET 18 18 ? ? ? A . n A 1 19 ASP 19 19 ? ? ? A . n A 1 20 ASP 20 20 ? ? ? A . n A 1 21 GLY 21 21 ? ? ? A . n A 1 22 GLN 22 22 ? ? ? A . n A 1 23 LEU 23 23 ? ? ? A . n A 1 24 ASP 24 24 ? ? ? A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 ALA 45 45 ? ? ? A . n A 1 46 GLU 46 46 ? ? ? A . n A 1 47 GLY 47 47 ? ? ? A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 PHE 62 62 62 PHE PHE A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 PRO 68 68 68 PRO PRO A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 TYR 76 76 76 TYR TYR A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 ASN 87 87 87 ASN ASN A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 MET 91 91 91 MET MET A . n A 1 92 PHE 92 92 92 PHE PHE A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 TRP 94 94 94 TRP TRP A . n A 1 95 MET 95 95 95 MET MET A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 PRO 97 97 97 PRO PRO A . n A 1 98 THR 98 98 98 THR THR A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 ARG 100 100 100 ARG ARG A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 THR 103 103 103 THR THR A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 HIS 108 108 108 HIS HIS A . n A 1 109 MET 109 109 109 MET MET A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 GLY 115 115 115 GLY GLY A . n A 1 116 ASP 116 116 116 ASP ASP A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 TYR 118 118 118 TYR TYR A . n A 1 119 TRP 119 119 119 TRP TRP A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 PHE 121 121 121 PHE PHE A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 ARG 124 124 124 ARG ARG A . n A 1 125 VAL 125 125 125 VAL VAL A . n A 1 126 LYS 126 126 126 LYS LYS A . n A 1 127 LEU 127 127 ? ? ? A . n A 1 128 ALA 128 128 ? ? ? A . n A 1 129 ALA 129 129 ? ? ? A . n A 1 130 ALA 130 130 ? ? ? A . n A 1 131 LEU 131 131 ? ? ? A . n A 1 132 GLU 132 132 ? ? ? A . n A 1 133 HIS 133 133 ? ? ? A . n A 1 134 HIS 134 134 ? ? ? A . n A 1 135 HIS 135 135 ? ? ? A . n A 1 136 HIS 136 136 ? ? ? A . n A 1 137 HIS 137 137 ? ? ? A . n A 1 138 HIS 138 138 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 FMT 1 201 201 FMT FMT A . C 2 FMT 1 202 202 FMT FMT A . D 3 HOH 1 301 302 HOH HOH A . D 3 HOH 2 302 318 HOH HOH A . D 3 HOH 3 303 301 HOH HOH A . D 3 HOH 4 304 311 HOH HOH A . D 3 HOH 5 305 305 HOH HOH A . D 3 HOH 6 306 312 HOH HOH A . D 3 HOH 7 307 315 HOH HOH A . D 3 HOH 8 308 306 HOH HOH A . D 3 HOH 9 309 320 HOH HOH A . D 3 HOH 10 310 309 HOH HOH A . D 3 HOH 11 311 314 HOH HOH A . D 3 HOH 12 312 310 HOH HOH A . D 3 HOH 13 313 321 HOH HOH A . D 3 HOH 14 314 319 HOH HOH A . D 3 HOH 15 315 308 HOH HOH A . D 3 HOH 16 316 317 HOH HOH A . D 3 HOH 17 317 304 HOH HOH A . D 3 HOH 18 318 307 HOH HOH A . D 3 HOH 19 319 316 HOH HOH A . D 3 HOH 20 320 303 HOH HOH A . D 3 HOH 21 321 313 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LEU 26 ? CD1 ? A LEU 26 CD1 2 1 Y 1 A LEU 26 ? CD2 ? A LEU 26 CD2 3 1 Y 1 A ASP 48 ? CG ? A ASP 48 CG 4 1 Y 1 A ASP 48 ? OD1 ? A ASP 48 OD1 5 1 Y 1 A ASP 48 ? OD2 ? A ASP 48 OD2 6 1 Y 1 A LYS 55 ? NZ ? A LYS 55 NZ 7 1 Y 1 A LYS 64 ? CE ? A LYS 64 CE 8 1 Y 1 A LYS 64 ? NZ ? A LYS 64 NZ 9 1 Y 1 A LYS 80 ? NZ ? A LYS 80 NZ 10 1 Y 1 A ARG 100 ? CD ? A ARG 100 CD 11 1 Y 1 A ARG 100 ? NE ? A ARG 100 NE 12 1 Y 1 A ARG 100 ? CZ ? A ARG 100 CZ 13 1 Y 1 A ARG 100 ? NH1 ? A ARG 100 NH1 14 1 Y 1 A ARG 100 ? NH2 ? A ARG 100 NH2 15 1 Y 1 A LYS 104 ? CE ? A LYS 104 CE 16 1 Y 1 A LYS 104 ? NZ ? A LYS 104 NZ 17 1 Y 1 A LYS 106 ? CD ? A LYS 106 CD 18 1 Y 1 A LYS 106 ? CE ? A LYS 106 CE 19 1 Y 1 A LYS 106 ? NZ ? A LYS 106 NZ 20 1 Y 1 A LYS 110 ? CD ? A LYS 110 CD 21 1 Y 1 A LYS 110 ? CE ? A LYS 110 CE 22 1 Y 1 A LYS 110 ? NZ ? A LYS 110 NZ 23 1 Y 1 A LYS 111 ? NZ ? A LYS 111 NZ 24 1 Y 1 A LYS 123 ? CG ? A LYS 123 CG 25 1 Y 1 A LYS 123 ? CD ? A LYS 123 CD 26 1 Y 1 A LYS 123 ? CE ? A LYS 123 CE 27 1 Y 1 A LYS 123 ? NZ ? A LYS 123 NZ 28 1 Y 1 A ARG 124 ? CG ? A ARG 124 CG 29 1 Y 1 A ARG 124 ? CD ? A ARG 124 CD 30 1 Y 1 A ARG 124 ? NE ? A ARG 124 NE 31 1 Y 1 A ARG 124 ? CZ ? A ARG 124 CZ 32 1 Y 1 A ARG 124 ? NH1 ? A ARG 124 NH1 33 1 Y 1 A ARG 124 ? NH2 ? A ARG 124 NH2 34 1 Y 1 A LYS 126 ? CD ? A LYS 126 CD 35 1 Y 1 A LYS 126 ? CE ? A LYS 126 CE 36 1 Y 1 A LYS 126 ? NZ ? A LYS 126 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? MxCuBE ? ? ? 3 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 20200131 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? 20200131 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MoRDa ? ? ? 1.3.02 4 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? ARP/wARP ? ? ? 8.0 5 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.18_3855 6 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7AV6 _cell.details ? _cell.formula_units_Z ? _cell.length_a 45.920 _cell.length_a_esd ? _cell.length_b 45.920 _cell.length_b_esd ? _cell.length_c 105.040 _cell.length_c_esd ? _cell.volume 221492.218 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7AV6 _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall 'P 4abw 2nw' _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7AV6 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.78 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 31.1 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M magnesium formate, 20 % w/v PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-09-27 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9772 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID23-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9772 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID23-1 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 36.93 _reflns.entry_id 7AV6 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.50 _reflns.d_resolution_low 42.09 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 18549 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.5 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 25.4 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 32.8 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.007 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 1.50 1.54 ? 0.7 ? ? ? ? 1274 96.6 ? ? ? ? ? ? ? ? ? ? ? ? ? 23.9 ? ? ? ? ? 0.726 ? 1 1 0.325 ? ? 1.54 1.58 ? 1.2 ? ? ? ? 1283 97.3 ? ? ? ? ? ? ? ? ? ? ? ? ? 26.1 ? ? ? ? ? 0.485 ? 2 1 0.585 ? ? 1.58 1.62 ? 1.8 ? ? ? ? 1276 97.6 ? ? ? ? ? ? ? ? ? ? ? ? ? 27.1 ? ? ? ? ? 0.348 ? 3 1 0.723 ? ? 1.62 1.68 ? 2.7 ? ? ? ? 1269 97.8 ? ? ? ? ? ? ? ? ? ? ? ? ? 26.9 ? ? ? ? ? 0.248 ? 4 1 0.842 ? ? 1.68 1.74 ? 4.3 ? ? ? ? 1298 98.2 ? ? ? ? ? ? ? ? ? ? ? ? ? 26.2 ? ? ? ? ? 0.163 ? 5 1 0.934 ? ? 1.74 1.81 ? 7.0 ? ? ? ? 1300 98.1 ? ? ? ? ? ? ? ? ? ? ? ? ? 25.0 ? ? ? ? ? 0.101 ? 6 1 0.977 ? ? 1.81 1.89 ? 10.9 ? ? ? ? 1298 98.6 ? ? ? ? ? ? ? ? ? ? ? ? ? 25.9 ? ? ? ? ? 0.065 ? 7 1 0.990 ? ? 1.89 1.99 ? 18.1 ? ? ? ? 1317 98.5 ? ? ? ? ? ? ? ? ? ? ? ? ? 26.9 ? ? ? ? ? 0.039 ? 8 1 0.997 ? ? 1.99 2.11 ? 29.0 ? ? ? ? 1319 98.9 ? ? ? ? ? ? ? ? ? ? ? ? ? 26.4 ? ? ? ? ? 0.024 ? 9 1 0.998 ? ? 2.11 2.28 ? 41.3 ? ? ? ? 1320 99.1 ? ? ? ? ? ? ? ? ? ? ? ? ? 24.8 ? ? ? ? ? 0.016 ? 10 1 0.999 ? ? 2.28 2.50 ? 56.4 ? ? ? ? 1353 99.2 ? ? ? ? ? ? ? ? ? ? ? ? ? 25.4 ? ? ? ? ? 0.012 ? 11 1 0.999 ? ? 2.50 2.87 ? 73.4 ? ? ? ? 1362 99.6 ? ? ? ? ? ? ? ? ? ? ? ? ? 25.8 ? ? ? ? ? 0.009 ? 12 1 1 ? ? 2.87 3.61 ? 89.5 ? ? ? ? 1386 99.9 ? ? ? ? ? ? ? ? ? ? ? ? ? 23.1 ? ? ? ? ? 0.007 ? 13 1 1 ? ? 3.61 42.09 ? 103.7 ? ? ? ? 1494 99.9 ? ? ? ? ? ? ? ? ? ? ? ? ? 23.0 ? ? ? ? ? 0.006 ? 14 1 1 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 50.54 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7AV6 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.50 _refine.ls_d_res_low 42.08 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 18518 _refine.ls_number_reflns_R_free 927 _refine.ls_number_reflns_R_work 17591 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.48 _refine.ls_percent_reflns_R_free 5.01 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2153 _refine.ls_R_factor_R_free 0.2372 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2141 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.33 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1ODV _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 30.4480 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2024 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.50 _refine_hist.d_res_low 42.08 _refine_hist.number_atoms_solvent 21 _refine_hist.number_atoms_total 762 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 735 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 6 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0053 ? 789 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.7360 ? 1068 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0717 ? 112 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0055 ? 141 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 17.8633 ? 275 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.50 1.58 . . 128 2419 96.59 . . . 0.3721 . 0.3451 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.58 1.68 . . 127 2410 97.65 . . . 0.3216 . 0.2806 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.68 1.81 . . 131 2473 98.15 . . . 0.2824 . 0.2520 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.81 1.99 . . 130 2482 98.53 . . . 0.2614 . 0.2313 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.99 2.28 . . 132 2502 98.95 . . . 0.2432 . 0.2273 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.28 2.87 . . 135 2574 99.41 . . . 0.2768 . 0.2455 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.87 42.08 . . 144 2731 99.90 . . . 0.2166 . 0.1960 . . . . . . . . . . . # _struct.entry_id 7AV6 _struct.title 'FAST in a domain-swapped dimer form' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7AV6 _struct_keywords.text 'fluorescence, fluorogen, fluorogen-activating protein, fluorescent labelling, FAST, FLUORESCENT PROTEIN' _struct_keywords.pdbx_keywords 'FLUORESCENT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PYP_HALHA _struct_ref.pdbx_db_accession P16113 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFK EGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7AV6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 125 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P16113 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 125 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 125 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7AV6 GLY A 69 ? UNP P16113 CYS 69 'engineered mutation' 69 1 1 7AV6 TRP A 94 ? UNP P16113 TYR 94 'engineered mutation' 94 2 1 7AV6 MET A 95 ? UNP P16113 THR 95 'engineered mutation' 95 3 1 7AV6 ILE A 96 ? UNP P16113 PHE 96 'engineered mutation' 96 4 1 7AV6 PRO A 97 ? UNP P16113 ASP 97 'engineered mutation' 97 5 1 7AV6 THR A 98 ? UNP P16113 TYR 98 'engineered mutation' 98 6 1 7AV6 SER A 99 ? UNP P16113 GLN 99 'engineered mutation' 99 7 1 7AV6 ARG A 100 ? UNP P16113 MET 100 'engineered mutation' 100 8 1 7AV6 GLY A 101 ? UNP P16113 THR 101 'engineered mutation' 101 9 1 7AV6 LYS A 126 ? UNP P16113 ? ? 'expression tag' 126 10 1 7AV6 LEU A 127 ? UNP P16113 ? ? 'expression tag' 127 11 1 7AV6 ALA A 128 ? UNP P16113 ? ? 'expression tag' 128 12 1 7AV6 ALA A 129 ? UNP P16113 ? ? 'expression tag' 129 13 1 7AV6 ALA A 130 ? UNP P16113 ? ? 'expression tag' 130 14 1 7AV6 LEU A 131 ? UNP P16113 ? ? 'expression tag' 131 15 1 7AV6 GLU A 132 ? UNP P16113 ? ? 'expression tag' 132 16 1 7AV6 HIS A 133 ? UNP P16113 ? ? 'expression tag' 133 17 1 7AV6 HIS A 134 ? UNP P16113 ? ? 'expression tag' 134 18 1 7AV6 HIS A 135 ? UNP P16113 ? ? 'expression tag' 135 19 1 7AV6 HIS A 136 ? UNP P16113 ? ? 'expression tag' 136 20 1 7AV6 HIS A 137 ? UNP P16113 ? ? 'expression tag' 137 21 1 7AV6 HIS A 138 ? UNP P16113 ? ? 'expression tag' 138 22 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4150 ? 1 MORE -28 ? 1 'SSA (A^2)' 11100 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_665 -y+1,-x+1,-z+1/2 0.0000000000 -1.0000000000 0.0000000000 45.9200000000 -1.0000000000 0.0000000000 0.0000000000 45.9200000000 0.0000000000 0.0000000000 -1.0000000000 52.5200000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 67 ? ASP A 71 ? ALA A 67 ASP A 71 5 ? 5 HELX_P HELX_P2 AA2 PHE A 75 ? GLY A 86 ? PHE A 75 GLY A 86 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ALA A 30 ? LEU A 33 ? ALA A 30 LEU A 33 AA1 2 ILE A 39 ? ASN A 43 ? ILE A 39 ASN A 43 AA1 3 THR A 50 ? GLY A 51 ? THR A 50 GLY A 51 AA2 1 ASN A 89 ? ILE A 96 ? ASN A 89 ILE A 96 AA2 2 THR A 103 ? LYS A 111 ? THR A 103 LYS A 111 AA2 3 TYR A 118 ? ARG A 124 ? TYR A 118 ARG A 124 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLN A 32 ? N GLN A 32 O LEU A 40 ? O LEU A 40 AA1 2 3 N TYR A 42 ? N TYR A 42 O GLY A 51 ? O GLY A 51 AA2 1 2 N PHE A 92 ? N PHE A 92 O VAL A 107 ? O VAL A 107 AA2 2 3 N LYS A 106 ? N LYS A 106 O LYS A 123 ? O LYS A 123 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A FMT 201 ? 2 'binding site for residue FMT A 201' AC2 Software A FMT 202 ? 5 'binding site for residue FMT A 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 HIS A 108 ? HIS A 108 . ? 1_555 ? 2 AC1 2 PHE A 121 ? PHE A 121 . ? 1_555 ? 3 AC2 5 ALA A 67 ? ALA A 67 . ? 1_555 ? 4 AC2 5 PRO A 68 ? PRO A 68 . ? 1_555 ? 5 AC2 5 GLY A 69 ? GLY A 69 . ? 1_555 ? 6 AC2 5 TRP A 119 ? TRP A 119 . ? 6_565 ? 7 AC2 5 HOH D . ? HOH A 307 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 53 ? ? -151.26 71.23 2 1 ASP A 53 ? ? -153.62 71.23 3 1 PHE A 75 ? ? -139.68 -75.61 4 1 ASN A 89 ? ? -163.49 85.90 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y+1/2,x+1/2,z+1/4 3 y+1/2,-x+1/2,z+3/4 4 x+1/2,-y+1/2,-z+3/4 5 -x+1/2,y+1/2,-z+1/4 6 -x,-y,z+1/2 7 y,x,-z 8 -y,-x,-z+1/2 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 3.73364874447 30.5233078564 12.9871314983 0.584604823124 ? 0.044370754351 ? -0.0469500860741 ? 0.543027258357 ? -0.02375346869 ? 0.660599349522 ? 0.0973396778144 ? 0.113861638535 ? -0.00257650127215 ? 0.127677430525 ? -0.0310707173773 ? 0.114725834974 ? -0.292289094756 ? -0.939379024906 ? 0.172714974508 ? -0.162124744842 ? 0.416114040507 ? 0.0170446549874 ? 0.443185766227 ? -0.0544315538845 ? 0.00358087660414 ? 2 'X-RAY DIFFRACTION' ? refined 14.356393932 34.6135642241 17.6371652156 0.387606491834 ? -0.00618417827592 ? 0.0277351795026 ? 0.272387513726 ? -0.00582115518221 ? 0.348366811455 ? 0.0633575315835 ? 0.119399755056 ? -0.0192778699205 ? 0.315832029415 ? -0.425135959949 ? 0.774876940768 ? 0.048539714596 ? -0.0612669590071 ? 0.0659627350955 ? -0.229867716272 ? 0.0939177168852 ? 0.00738539850952 ? -0.140598469439 ? 0.115243956148 ? 0.00058296102121 ? 3 'X-RAY DIFFRACTION' ? refined 9.91215936178 38.7855215105 24.6697529503 0.339446784209 ? 0.056409897494 ? 0.0645697053205 ? 0.436688028155 ? 0.0719518757098 ? 0.417036181051 ? 0.0854473460101 ? -0.17923641193 ? 0.15400957788 ? 0.543695981051 ? -0.162225723378 ? 0.150727125903 ? 0.381681380083 ? 0.0274020974037 ? -0.988940944283 ? -0.313332818153 ? -0.0477543090053 ? -0.0851889490966 ? -0.251854660273 ? -0.239416871981 ? 0.00766864880909 ? 4 'X-RAY DIFFRACTION' ? refined 21.0249953565 30.3979981586 39.6390682653 0.273897558212 ? 0.0141870554731 ? -0.0245662696472 ? 0.53774484617 ? 0.0420931025543 ? 0.357133145269 ? 1.59054747554 ? 0.542771017803 ? -0.525264955228 ? 0.97415888996 ? -0.125300654674 ? 0.162176651847 ? 0.230134728571 ? -0.396710493789 ? -0.264368785199 ? 0.115495254896 ? -0.052308485375 ? -0.215660351422 ? 0.0726052179145 ? 0.771908189841 ? 0.00105496933819 ? 5 'X-RAY DIFFRACTION' ? refined 14.9123901313 22.6519038667 46.5417180496 0.503294434598 ? -0.0291747663426 ? -0.0533780458388 ? 0.626549269455 ? 0.244238649395 ? 0.551566555136 ? 0.786172149748 ? -0.302065803675 ? 0.018892665768 ? 0.192820820513 ? 0.077649436328 ? 0.109558643232 ? 0.055889883261 ? -0.99234675478 ? -1.32031619781 ? 1.33383659604 ? 0.208627981394 ? -0.567211497243 ? 0.604662608573 ? -0.165792403141 ? -0.0472309100408 ? 6 'X-RAY DIFFRACTION' ? refined 13.9769586546 32.0985541205 50.6031328413 0.533397835181 ? -0.182495340497 ? 0.0683765129142 ? 0.82869119315 ? 0.121260149552 ? 0.340997898608 ? 1.57381626853 ? -1.35032124127 ? 0.183689497226 ? 1.53595504492 ? 0.0625493399856 ? 0.262017252659 ? -0.54292058995 ? -1.19961540675 ? 0.211863120529 ? 0.764922109625 ? 0.700724555017 ? -0.206699286735 ? 0.13442956675 ? -1.09427780801 ? 0.0687775466863 ? 7 'X-RAY DIFFRACTION' ? refined 28.1517752947 45.4601051052 48.5129448002 0.681529601209 ? -0.0272396867467 ? -0.0285508800117 ? 0.710500971275 ? 0.105040433809 ? 0.609529345996 ? 0.254867754389 ? 0.0268681269841 ? -0.0533457512575 ? 0.0292454462794 ? 0.032131709183 ? 0.0530553395994 ? -1.0715341425 ? 0.271601275896 ? -1.12806567494 ? -0.107134510899 ? -0.021359400449 ? -0.154301974901 ? -0.979895061631 ? 0.741123771681 ? -0.0029056868104 ? 8 'X-RAY DIFFRACTION' ? refined 12.4130470332 35.0328623092 48.2524056989 0.371966399539 ? -0.0133431443115 ? -0.0063590951102 ? 0.670625810874 ? 0.029206213045 ? 0.437346819408 ? 0.472325725351 ? -0.525238308686 ? 0.323816917592 ? 0.487902921902 ? -0.288542280686 ? 0.421339640516 ? -0.0962492120038 ? -0.344727059132 ? 0.353259427686 ? 0.121487649563 ? -0.142307326522 ? 0.270672024068 ? 0.402557501162 ? -0.395285230262 ? 0.000851064173329 ? 9 'X-RAY DIFFRACTION' ? refined 7.5123416506 32.5736453639 42.8319617961 0.308176290288 ? -0.00338455851548 ? -0.0021595923116 ? 0.49920655182 ? 0.00376242186648 ? 0.449210932762 ? 0.860675849031 ? -0.530303625824 ? 0.202931846476 ? 0.427605519912 ? -0.490465362065 ? 1.00421674531 ? -0.00612221781742 ? -0.989476649236 ? -0.38125887639 ? 0.0248290422434 ? 0.119039473545 ? 0.615880916474 ? -0.0999033809439 ? -0.793454534324 ? 0.013016431181 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 A 1 A 25 ? A 5 A 29 ? ? ;chain 'A' and (resid 25 through 29 ) ; 2 'X-RAY DIFFRACTION' 2 A 6 A 30 ? A 21 A 44 ? ? ;chain 'A' and (resid 30 through 44 ) ; 3 'X-RAY DIFFRACTION' 3 A 22 A 48 ? A 31 A 56 ? ? ;chain 'A' and (resid 48 through 56 ) ; 4 'X-RAY DIFFRACTION' 4 A 32 A 57 ? A 51 A 75 ? ? ;chain 'A' and (resid 57 through 75 ) ; 5 'X-RAY DIFFRACTION' 5 A 52 A 76 ? A 62 A 85 ? ? ;chain 'A' and (resid 76 through 85 ) ; 6 'X-RAY DIFFRACTION' 6 A 63 A 86 ? A 73 A 96 ? ? ;chain 'A' and (resid 86 through 96 ) ; 7 'X-RAY DIFFRACTION' 7 A 74 A 97 ? A 79 A 102 ? ? ;chain 'A' and (resid 97 through 102 ) ; 8 'X-RAY DIFFRACTION' 8 A 80 A 103 ? A 88 A 111 ? ? ;chain 'A' and (resid 103 through 111 ) ; 9 'X-RAY DIFFRACTION' 9 A 89 A 112 ? A 103 A 126 ? ? ;chain 'A' and (resid 112 through 126 ) ; # _pdbx_entry_details.entry_id 7AV6 _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLU 2 ? A GLU 2 3 1 Y 1 A HIS 3 ? A HIS 3 4 1 Y 1 A VAL 4 ? A VAL 4 5 1 Y 1 A ALA 5 ? A ALA 5 6 1 Y 1 A PHE 6 ? A PHE 6 7 1 Y 1 A GLY 7 ? A GLY 7 8 1 Y 1 A SER 8 ? A SER 8 9 1 Y 1 A GLU 9 ? A GLU 9 10 1 Y 1 A ASP 10 ? A ASP 10 11 1 Y 1 A ILE 11 ? A ILE 11 12 1 Y 1 A GLU 12 ? A GLU 12 13 1 Y 1 A ASN 13 ? A ASN 13 14 1 Y 1 A THR 14 ? A THR 14 15 1 Y 1 A LEU 15 ? A LEU 15 16 1 Y 1 A ALA 16 ? A ALA 16 17 1 Y 1 A LYS 17 ? A LYS 17 18 1 Y 1 A MET 18 ? A MET 18 19 1 Y 1 A ASP 19 ? A ASP 19 20 1 Y 1 A ASP 20 ? A ASP 20 21 1 Y 1 A GLY 21 ? A GLY 21 22 1 Y 1 A GLN 22 ? A GLN 22 23 1 Y 1 A LEU 23 ? A LEU 23 24 1 Y 1 A ASP 24 ? A ASP 24 25 1 Y 1 A ALA 45 ? A ALA 45 26 1 Y 1 A GLU 46 ? A GLU 46 27 1 Y 1 A GLY 47 ? A GLY 47 28 1 Y 1 A LEU 127 ? A LEU 127 29 1 Y 1 A ALA 128 ? A ALA 128 30 1 Y 1 A ALA 129 ? A ALA 129 31 1 Y 1 A ALA 130 ? A ALA 130 32 1 Y 1 A LEU 131 ? A LEU 131 33 1 Y 1 A GLU 132 ? A GLU 132 34 1 Y 1 A HIS 133 ? A HIS 133 35 1 Y 1 A HIS 134 ? A HIS 134 36 1 Y 1 A HIS 135 ? A HIS 135 37 1 Y 1 A HIS 136 ? A HIS 136 38 1 Y 1 A HIS 137 ? A HIS 137 39 1 Y 1 A HIS 138 ? A HIS 138 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 FMT C C N N 88 FMT O1 O N N 89 FMT O2 O N N 90 FMT H H N N 91 FMT HO2 H N N 92 GLN N N N N 93 GLN CA C N S 94 GLN C C N N 95 GLN O O N N 96 GLN CB C N N 97 GLN CG C N N 98 GLN CD C N N 99 GLN OE1 O N N 100 GLN NE2 N N N 101 GLN OXT O N N 102 GLN H H N N 103 GLN H2 H N N 104 GLN HA H N N 105 GLN HB2 H N N 106 GLN HB3 H N N 107 GLN HG2 H N N 108 GLN HG3 H N N 109 GLN HE21 H N N 110 GLN HE22 H N N 111 GLN HXT H N N 112 GLU N N N N 113 GLU CA C N S 114 GLU C C N N 115 GLU O O N N 116 GLU CB C N N 117 GLU CG C N N 118 GLU CD C N N 119 GLU OE1 O N N 120 GLU OE2 O N N 121 GLU OXT O N N 122 GLU H H N N 123 GLU H2 H N N 124 GLU HA H N N 125 GLU HB2 H N N 126 GLU HB3 H N N 127 GLU HG2 H N N 128 GLU HG3 H N N 129 GLU HE2 H N N 130 GLU HXT H N N 131 GLY N N N N 132 GLY CA C N N 133 GLY C C N N 134 GLY O O N N 135 GLY OXT O N N 136 GLY H H N N 137 GLY H2 H N N 138 GLY HA2 H N N 139 GLY HA3 H N N 140 GLY HXT H N N 141 HIS N N N N 142 HIS CA C N S 143 HIS C C N N 144 HIS O O N N 145 HIS CB C N N 146 HIS CG C Y N 147 HIS ND1 N Y N 148 HIS CD2 C Y N 149 HIS CE1 C Y N 150 HIS NE2 N Y N 151 HIS OXT O N N 152 HIS H H N N 153 HIS H2 H N N 154 HIS HA H N N 155 HIS HB2 H N N 156 HIS HB3 H N N 157 HIS HD1 H N N 158 HIS HD2 H N N 159 HIS HE1 H N N 160 HIS HE2 H N N 161 HIS HXT H N N 162 HOH O O N N 163 HOH H1 H N N 164 HOH H2 H N N 165 ILE N N N N 166 ILE CA C N S 167 ILE C C N N 168 ILE O O N N 169 ILE CB C N S 170 ILE CG1 C N N 171 ILE CG2 C N N 172 ILE CD1 C N N 173 ILE OXT O N N 174 ILE H H N N 175 ILE H2 H N N 176 ILE HA H N N 177 ILE HB H N N 178 ILE HG12 H N N 179 ILE HG13 H N N 180 ILE HG21 H N N 181 ILE HG22 H N N 182 ILE HG23 H N N 183 ILE HD11 H N N 184 ILE HD12 H N N 185 ILE HD13 H N N 186 ILE HXT H N N 187 LEU N N N N 188 LEU CA C N S 189 LEU C C N N 190 LEU O O N N 191 LEU CB C N N 192 LEU CG C N N 193 LEU CD1 C N N 194 LEU CD2 C N N 195 LEU OXT O N N 196 LEU H H N N 197 LEU H2 H N N 198 LEU HA H N N 199 LEU HB2 H N N 200 LEU HB3 H N N 201 LEU HG H N N 202 LEU HD11 H N N 203 LEU HD12 H N N 204 LEU HD13 H N N 205 LEU HD21 H N N 206 LEU HD22 H N N 207 LEU HD23 H N N 208 LEU HXT H N N 209 LYS N N N N 210 LYS CA C N S 211 LYS C C N N 212 LYS O O N N 213 LYS CB C N N 214 LYS CG C N N 215 LYS CD C N N 216 LYS CE C N N 217 LYS NZ N N N 218 LYS OXT O N N 219 LYS H H N N 220 LYS H2 H N N 221 LYS HA H N N 222 LYS HB2 H N N 223 LYS HB3 H N N 224 LYS HG2 H N N 225 LYS HG3 H N N 226 LYS HD2 H N N 227 LYS HD3 H N N 228 LYS HE2 H N N 229 LYS HE3 H N N 230 LYS HZ1 H N N 231 LYS HZ2 H N N 232 LYS HZ3 H N N 233 LYS HXT H N N 234 MET N N N N 235 MET CA C N S 236 MET C C N N 237 MET O O N N 238 MET CB C N N 239 MET CG C N N 240 MET SD S N N 241 MET CE C N N 242 MET OXT O N N 243 MET H H N N 244 MET H2 H N N 245 MET HA H N N 246 MET HB2 H N N 247 MET HB3 H N N 248 MET HG2 H N N 249 MET HG3 H N N 250 MET HE1 H N N 251 MET HE2 H N N 252 MET HE3 H N N 253 MET HXT H N N 254 PHE N N N N 255 PHE CA C N S 256 PHE C C N N 257 PHE O O N N 258 PHE CB C N N 259 PHE CG C Y N 260 PHE CD1 C Y N 261 PHE CD2 C Y N 262 PHE CE1 C Y N 263 PHE CE2 C Y N 264 PHE CZ C Y N 265 PHE OXT O N N 266 PHE H H N N 267 PHE H2 H N N 268 PHE HA H N N 269 PHE HB2 H N N 270 PHE HB3 H N N 271 PHE HD1 H N N 272 PHE HD2 H N N 273 PHE HE1 H N N 274 PHE HE2 H N N 275 PHE HZ H N N 276 PHE HXT H N N 277 PRO N N N N 278 PRO CA C N S 279 PRO C C N N 280 PRO O O N N 281 PRO CB C N N 282 PRO CG C N N 283 PRO CD C N N 284 PRO OXT O N N 285 PRO H H N N 286 PRO HA H N N 287 PRO HB2 H N N 288 PRO HB3 H N N 289 PRO HG2 H N N 290 PRO HG3 H N N 291 PRO HD2 H N N 292 PRO HD3 H N N 293 PRO HXT H N N 294 SER N N N N 295 SER CA C N S 296 SER C C N N 297 SER O O N N 298 SER CB C N N 299 SER OG O N N 300 SER OXT O N N 301 SER H H N N 302 SER H2 H N N 303 SER HA H N N 304 SER HB2 H N N 305 SER HB3 H N N 306 SER HG H N N 307 SER HXT H N N 308 THR N N N N 309 THR CA C N S 310 THR C C N N 311 THR O O N N 312 THR CB C N R 313 THR OG1 O N N 314 THR CG2 C N N 315 THR OXT O N N 316 THR H H N N 317 THR H2 H N N 318 THR HA H N N 319 THR HB H N N 320 THR HG1 H N N 321 THR HG21 H N N 322 THR HG22 H N N 323 THR HG23 H N N 324 THR HXT H N N 325 TRP N N N N 326 TRP CA C N S 327 TRP C C N N 328 TRP O O N N 329 TRP CB C N N 330 TRP CG C Y N 331 TRP CD1 C Y N 332 TRP CD2 C Y N 333 TRP NE1 N Y N 334 TRP CE2 C Y N 335 TRP CE3 C Y N 336 TRP CZ2 C Y N 337 TRP CZ3 C Y N 338 TRP CH2 C Y N 339 TRP OXT O N N 340 TRP H H N N 341 TRP H2 H N N 342 TRP HA H N N 343 TRP HB2 H N N 344 TRP HB3 H N N 345 TRP HD1 H N N 346 TRP HE1 H N N 347 TRP HE3 H N N 348 TRP HZ2 H N N 349 TRP HZ3 H N N 350 TRP HH2 H N N 351 TRP HXT H N N 352 TYR N N N N 353 TYR CA C N S 354 TYR C C N N 355 TYR O O N N 356 TYR CB C N N 357 TYR CG C Y N 358 TYR CD1 C Y N 359 TYR CD2 C Y N 360 TYR CE1 C Y N 361 TYR CE2 C Y N 362 TYR CZ C Y N 363 TYR OH O N N 364 TYR OXT O N N 365 TYR H H N N 366 TYR H2 H N N 367 TYR HA H N N 368 TYR HB2 H N N 369 TYR HB3 H N N 370 TYR HD1 H N N 371 TYR HD2 H N N 372 TYR HE1 H N N 373 TYR HE2 H N N 374 TYR HH H N N 375 TYR HXT H N N 376 VAL N N N N 377 VAL CA C N S 378 VAL C C N N 379 VAL O O N N 380 VAL CB C N N 381 VAL CG1 C N N 382 VAL CG2 C N N 383 VAL OXT O N N 384 VAL H H N N 385 VAL H2 H N N 386 VAL HA H N N 387 VAL HB H N N 388 VAL HG11 H N N 389 VAL HG12 H N N 390 VAL HG13 H N N 391 VAL HG21 H N N 392 VAL HG22 H N N 393 VAL HG23 H N N 394 VAL HXT H N N 395 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 FMT C O1 doub N N 83 FMT C O2 sing N N 84 FMT C H sing N N 85 FMT O2 HO2 sing N N 86 GLN N CA sing N N 87 GLN N H sing N N 88 GLN N H2 sing N N 89 GLN CA C sing N N 90 GLN CA CB sing N N 91 GLN CA HA sing N N 92 GLN C O doub N N 93 GLN C OXT sing N N 94 GLN CB CG sing N N 95 GLN CB HB2 sing N N 96 GLN CB HB3 sing N N 97 GLN CG CD sing N N 98 GLN CG HG2 sing N N 99 GLN CG HG3 sing N N 100 GLN CD OE1 doub N N 101 GLN CD NE2 sing N N 102 GLN NE2 HE21 sing N N 103 GLN NE2 HE22 sing N N 104 GLN OXT HXT sing N N 105 GLU N CA sing N N 106 GLU N H sing N N 107 GLU N H2 sing N N 108 GLU CA C sing N N 109 GLU CA CB sing N N 110 GLU CA HA sing N N 111 GLU C O doub N N 112 GLU C OXT sing N N 113 GLU CB CG sing N N 114 GLU CB HB2 sing N N 115 GLU CB HB3 sing N N 116 GLU CG CD sing N N 117 GLU CG HG2 sing N N 118 GLU CG HG3 sing N N 119 GLU CD OE1 doub N N 120 GLU CD OE2 sing N N 121 GLU OE2 HE2 sing N N 122 GLU OXT HXT sing N N 123 GLY N CA sing N N 124 GLY N H sing N N 125 GLY N H2 sing N N 126 GLY CA C sing N N 127 GLY CA HA2 sing N N 128 GLY CA HA3 sing N N 129 GLY C O doub N N 130 GLY C OXT sing N N 131 GLY OXT HXT sing N N 132 HIS N CA sing N N 133 HIS N H sing N N 134 HIS N H2 sing N N 135 HIS CA C sing N N 136 HIS CA CB sing N N 137 HIS CA HA sing N N 138 HIS C O doub N N 139 HIS C OXT sing N N 140 HIS CB CG sing N N 141 HIS CB HB2 sing N N 142 HIS CB HB3 sing N N 143 HIS CG ND1 sing Y N 144 HIS CG CD2 doub Y N 145 HIS ND1 CE1 doub Y N 146 HIS ND1 HD1 sing N N 147 HIS CD2 NE2 sing Y N 148 HIS CD2 HD2 sing N N 149 HIS CE1 NE2 sing Y N 150 HIS CE1 HE1 sing N N 151 HIS NE2 HE2 sing N N 152 HIS OXT HXT sing N N 153 HOH O H1 sing N N 154 HOH O H2 sing N N 155 ILE N CA sing N N 156 ILE N H sing N N 157 ILE N H2 sing N N 158 ILE CA C sing N N 159 ILE CA CB sing N N 160 ILE CA HA sing N N 161 ILE C O doub N N 162 ILE C OXT sing N N 163 ILE CB CG1 sing N N 164 ILE CB CG2 sing N N 165 ILE CB HB sing N N 166 ILE CG1 CD1 sing N N 167 ILE CG1 HG12 sing N N 168 ILE CG1 HG13 sing N N 169 ILE CG2 HG21 sing N N 170 ILE CG2 HG22 sing N N 171 ILE CG2 HG23 sing N N 172 ILE CD1 HD11 sing N N 173 ILE CD1 HD12 sing N N 174 ILE CD1 HD13 sing N N 175 ILE OXT HXT sing N N 176 LEU N CA sing N N 177 LEU N H sing N N 178 LEU N H2 sing N N 179 LEU CA C sing N N 180 LEU CA CB sing N N 181 LEU CA HA sing N N 182 LEU C O doub N N 183 LEU C OXT sing N N 184 LEU CB CG sing N N 185 LEU CB HB2 sing N N 186 LEU CB HB3 sing N N 187 LEU CG CD1 sing N N 188 LEU CG CD2 sing N N 189 LEU CG HG sing N N 190 LEU CD1 HD11 sing N N 191 LEU CD1 HD12 sing N N 192 LEU CD1 HD13 sing N N 193 LEU CD2 HD21 sing N N 194 LEU CD2 HD22 sing N N 195 LEU CD2 HD23 sing N N 196 LEU OXT HXT sing N N 197 LYS N CA sing N N 198 LYS N H sing N N 199 LYS N H2 sing N N 200 LYS CA C sing N N 201 LYS CA CB sing N N 202 LYS CA HA sing N N 203 LYS C O doub N N 204 LYS C OXT sing N N 205 LYS CB CG sing N N 206 LYS CB HB2 sing N N 207 LYS CB HB3 sing N N 208 LYS CG CD sing N N 209 LYS CG HG2 sing N N 210 LYS CG HG3 sing N N 211 LYS CD CE sing N N 212 LYS CD HD2 sing N N 213 LYS CD HD3 sing N N 214 LYS CE NZ sing N N 215 LYS CE HE2 sing N N 216 LYS CE HE3 sing N N 217 LYS NZ HZ1 sing N N 218 LYS NZ HZ2 sing N N 219 LYS NZ HZ3 sing N N 220 LYS OXT HXT sing N N 221 MET N CA sing N N 222 MET N H sing N N 223 MET N H2 sing N N 224 MET CA C sing N N 225 MET CA CB sing N N 226 MET CA HA sing N N 227 MET C O doub N N 228 MET C OXT sing N N 229 MET CB CG sing N N 230 MET CB HB2 sing N N 231 MET CB HB3 sing N N 232 MET CG SD sing N N 233 MET CG HG2 sing N N 234 MET CG HG3 sing N N 235 MET SD CE sing N N 236 MET CE HE1 sing N N 237 MET CE HE2 sing N N 238 MET CE HE3 sing N N 239 MET OXT HXT sing N N 240 PHE N CA sing N N 241 PHE N H sing N N 242 PHE N H2 sing N N 243 PHE CA C sing N N 244 PHE CA CB sing N N 245 PHE CA HA sing N N 246 PHE C O doub N N 247 PHE C OXT sing N N 248 PHE CB CG sing N N 249 PHE CB HB2 sing N N 250 PHE CB HB3 sing N N 251 PHE CG CD1 doub Y N 252 PHE CG CD2 sing Y N 253 PHE CD1 CE1 sing Y N 254 PHE CD1 HD1 sing N N 255 PHE CD2 CE2 doub Y N 256 PHE CD2 HD2 sing N N 257 PHE CE1 CZ doub Y N 258 PHE CE1 HE1 sing N N 259 PHE CE2 CZ sing Y N 260 PHE CE2 HE2 sing N N 261 PHE CZ HZ sing N N 262 PHE OXT HXT sing N N 263 PRO N CA sing N N 264 PRO N CD sing N N 265 PRO N H sing N N 266 PRO CA C sing N N 267 PRO CA CB sing N N 268 PRO CA HA sing N N 269 PRO C O doub N N 270 PRO C OXT sing N N 271 PRO CB CG sing N N 272 PRO CB HB2 sing N N 273 PRO CB HB3 sing N N 274 PRO CG CD sing N N 275 PRO CG HG2 sing N N 276 PRO CG HG3 sing N N 277 PRO CD HD2 sing N N 278 PRO CD HD3 sing N N 279 PRO OXT HXT sing N N 280 SER N CA sing N N 281 SER N H sing N N 282 SER N H2 sing N N 283 SER CA C sing N N 284 SER CA CB sing N N 285 SER CA HA sing N N 286 SER C O doub N N 287 SER C OXT sing N N 288 SER CB OG sing N N 289 SER CB HB2 sing N N 290 SER CB HB3 sing N N 291 SER OG HG sing N N 292 SER OXT HXT sing N N 293 THR N CA sing N N 294 THR N H sing N N 295 THR N H2 sing N N 296 THR CA C sing N N 297 THR CA CB sing N N 298 THR CA HA sing N N 299 THR C O doub N N 300 THR C OXT sing N N 301 THR CB OG1 sing N N 302 THR CB CG2 sing N N 303 THR CB HB sing N N 304 THR OG1 HG1 sing N N 305 THR CG2 HG21 sing N N 306 THR CG2 HG22 sing N N 307 THR CG2 HG23 sing N N 308 THR OXT HXT sing N N 309 TRP N CA sing N N 310 TRP N H sing N N 311 TRP N H2 sing N N 312 TRP CA C sing N N 313 TRP CA CB sing N N 314 TRP CA HA sing N N 315 TRP C O doub N N 316 TRP C OXT sing N N 317 TRP CB CG sing N N 318 TRP CB HB2 sing N N 319 TRP CB HB3 sing N N 320 TRP CG CD1 doub Y N 321 TRP CG CD2 sing Y N 322 TRP CD1 NE1 sing Y N 323 TRP CD1 HD1 sing N N 324 TRP CD2 CE2 doub Y N 325 TRP CD2 CE3 sing Y N 326 TRP NE1 CE2 sing Y N 327 TRP NE1 HE1 sing N N 328 TRP CE2 CZ2 sing Y N 329 TRP CE3 CZ3 doub Y N 330 TRP CE3 HE3 sing N N 331 TRP CZ2 CH2 doub Y N 332 TRP CZ2 HZ2 sing N N 333 TRP CZ3 CH2 sing Y N 334 TRP CZ3 HZ3 sing N N 335 TRP CH2 HH2 sing N N 336 TRP OXT HXT sing N N 337 TYR N CA sing N N 338 TYR N H sing N N 339 TYR N H2 sing N N 340 TYR CA C sing N N 341 TYR CA CB sing N N 342 TYR CA HA sing N N 343 TYR C O doub N N 344 TYR C OXT sing N N 345 TYR CB CG sing N N 346 TYR CB HB2 sing N N 347 TYR CB HB3 sing N N 348 TYR CG CD1 doub Y N 349 TYR CG CD2 sing Y N 350 TYR CD1 CE1 sing Y N 351 TYR CD1 HD1 sing N N 352 TYR CD2 CE2 doub Y N 353 TYR CD2 HD2 sing N N 354 TYR CE1 CZ doub Y N 355 TYR CE1 HE1 sing N N 356 TYR CE2 CZ sing Y N 357 TYR CE2 HE2 sing N N 358 TYR CZ OH sing N N 359 TYR OH HH sing N N 360 TYR OXT HXT sing N N 361 VAL N CA sing N N 362 VAL N H sing N N 363 VAL N H2 sing N N 364 VAL CA C sing N N 365 VAL CA CB sing N N 366 VAL CA HA sing N N 367 VAL C O doub N N 368 VAL C OXT sing N N 369 VAL CB CG1 sing N N 370 VAL CB CG2 sing N N 371 VAL CB HB sing N N 372 VAL CG1 HG11 sing N N 373 VAL CG1 HG12 sing N N 374 VAL CG1 HG13 sing N N 375 VAL CG2 HG21 sing N N 376 VAL CG2 HG22 sing N N 377 VAL CG2 HG23 sing N N 378 VAL OXT HXT sing N N 379 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1ODV _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 41 21 2' _space_group.name_Hall 'P 4abw 2nw' _space_group.IT_number 92 _space_group.crystal_system tetragonal _space_group.id 1 # _atom_sites.entry_id 7AV6 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.021777 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021777 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009520 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_