data_7BGH # _entry.id 7BGH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.394 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7BGH pdb_00007bgh 10.2210/pdb7bgh/pdb WWPDB D_1292113337 ? ? BMRB 34589 ? 10.13018/BMR34589 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-01-19 2 'Structure model' 1 1 2023-05-24 3 'Structure model' 1 2 2024-06-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.pdbx_database_id_PubMed' 7 2 'Structure model' '_citation.title' 8 2 'Structure model' '_citation.year' 9 3 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7BGH _pdbx_database_status.recvd_initial_deposition_date 2021-01-07 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution structure of the chloroplast outer envelope channel OEP21' _pdbx_database_related.db_id 34589 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Hagn, F.' 1 0000-0002-1315-459X 'Haeusler, E.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Nat.Struct.Mol.Biol. _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1545-9985 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structural basis of metabolite transport by the chloroplast outer envelope channel OEP21.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41594-023-00984-y _citation.pdbx_database_id_PubMed 37156968 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gunsel, U.' 1 0000-0002-3109-4826 primary 'Klopfer, K.' 2 ? primary 'Hausler, E.' 3 ? primary 'Hitzenberger, M.' 4 ? primary 'Bolter, B.' 5 ? primary 'Sperl, L.E.' 6 ? primary 'Zacharias, M.' 7 0000-0001-5163-2663 primary 'Soll, J.' 8 ? primary 'Hagn, F.' 9 0000-0002-1315-459X # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Outer envelope pore protein 21, chloroplastic' _entity.formula_weight 22098.742 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details 'C-terminal His-10 Tag with a two-amino-acid spacer (LE).' # _entity_name_com.entity_id 1 _entity_name_com.name 'Chloroplastic outer envelope pore protein of 21 kDa,gOEP21' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;METSLRYGGDSKALKIHAKEKLRIDTNTFFQVRGGLDTKTGQPSSGSALIRHFYPNFSATLGVGVRYDKQDSVGVRYAKN DKLRYTVLAKKTFPVTNDGLVNFKIKGGCDVDQDFKEWKSRGGAEFSWNVFNFQKDQDVRLRIGYEAFEQVPYLQIRENN WTFNADYKGRWNVRYDLLEHHHHHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;METSLRYGGDSKALKIHAKEKLRIDTNTFFQVRGGLDTKTGQPSSGSALIRHFYPNFSATLGVGVRYDKQDSVGVRYAKN DKLRYTVLAKKTFPVTNDGLVNFKIKGGCDVDQDFKEWKSRGGAEFSWNVFNFQKDQDVRLRIGYEAFEQVPYLQIRENN WTFNADYKGRWNVRYDLLEHHHHHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 THR n 1 4 SER n 1 5 LEU n 1 6 ARG n 1 7 TYR n 1 8 GLY n 1 9 GLY n 1 10 ASP n 1 11 SER n 1 12 LYS n 1 13 ALA n 1 14 LEU n 1 15 LYS n 1 16 ILE n 1 17 HIS n 1 18 ALA n 1 19 LYS n 1 20 GLU n 1 21 LYS n 1 22 LEU n 1 23 ARG n 1 24 ILE n 1 25 ASP n 1 26 THR n 1 27 ASN n 1 28 THR n 1 29 PHE n 1 30 PHE n 1 31 GLN n 1 32 VAL n 1 33 ARG n 1 34 GLY n 1 35 GLY n 1 36 LEU n 1 37 ASP n 1 38 THR n 1 39 LYS n 1 40 THR n 1 41 GLY n 1 42 GLN n 1 43 PRO n 1 44 SER n 1 45 SER n 1 46 GLY n 1 47 SER n 1 48 ALA n 1 49 LEU n 1 50 ILE n 1 51 ARG n 1 52 HIS n 1 53 PHE n 1 54 TYR n 1 55 PRO n 1 56 ASN n 1 57 PHE n 1 58 SER n 1 59 ALA n 1 60 THR n 1 61 LEU n 1 62 GLY n 1 63 VAL n 1 64 GLY n 1 65 VAL n 1 66 ARG n 1 67 TYR n 1 68 ASP n 1 69 LYS n 1 70 GLN n 1 71 ASP n 1 72 SER n 1 73 VAL n 1 74 GLY n 1 75 VAL n 1 76 ARG n 1 77 TYR n 1 78 ALA n 1 79 LYS n 1 80 ASN n 1 81 ASP n 1 82 LYS n 1 83 LEU n 1 84 ARG n 1 85 TYR n 1 86 THR n 1 87 VAL n 1 88 LEU n 1 89 ALA n 1 90 LYS n 1 91 LYS n 1 92 THR n 1 93 PHE n 1 94 PRO n 1 95 VAL n 1 96 THR n 1 97 ASN n 1 98 ASP n 1 99 GLY n 1 100 LEU n 1 101 VAL n 1 102 ASN n 1 103 PHE n 1 104 LYS n 1 105 ILE n 1 106 LYS n 1 107 GLY n 1 108 GLY n 1 109 CYS n 1 110 ASP n 1 111 VAL n 1 112 ASP n 1 113 GLN n 1 114 ASP n 1 115 PHE n 1 116 LYS n 1 117 GLU n 1 118 TRP n 1 119 LYS n 1 120 SER n 1 121 ARG n 1 122 GLY n 1 123 GLY n 1 124 ALA n 1 125 GLU n 1 126 PHE n 1 127 SER n 1 128 TRP n 1 129 ASN n 1 130 VAL n 1 131 PHE n 1 132 ASN n 1 133 PHE n 1 134 GLN n 1 135 LYS n 1 136 ASP n 1 137 GLN n 1 138 ASP n 1 139 VAL n 1 140 ARG n 1 141 LEU n 1 142 ARG n 1 143 ILE n 1 144 GLY n 1 145 TYR n 1 146 GLU n 1 147 ALA n 1 148 PHE n 1 149 GLU n 1 150 GLN n 1 151 VAL n 1 152 PRO n 1 153 TYR n 1 154 LEU n 1 155 GLN n 1 156 ILE n 1 157 ARG n 1 158 GLU n 1 159 ASN n 1 160 ASN n 1 161 TRP n 1 162 THR n 1 163 PHE n 1 164 ASN n 1 165 ALA n 1 166 ASP n 1 167 TYR n 1 168 LYS n 1 169 GLY n 1 170 ARG n 1 171 TRP n 1 172 ASN n 1 173 VAL n 1 174 ARG n 1 175 TYR n 1 176 ASP n 1 177 LEU n 1 178 LEU n 1 179 GLU n 1 180 HIS n 1 181 HIS n 1 182 HIS n 1 183 HIS n 1 184 HIS n 1 185 HIS n 1 186 HIS n 1 187 HIS n 1 188 HIS n 1 189 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 189 _entity_src_gen.gene_src_common_name 'Garden pea' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene OEP21 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pisum sativum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3888 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 HIS 17 17 17 HIS HIS A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 GLN 31 31 31 GLN GLN A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 HIS 52 52 52 HIS HIS A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 PHE 57 57 57 PHE PHE A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 TYR 67 67 67 TYR TYR A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 TYR 77 77 77 TYR TYR A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 ASN 80 80 80 ASN ASN A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 TYR 85 85 85 TYR TYR A . n A 1 86 THR 86 86 86 THR THR A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 THR 92 92 92 THR THR A . n A 1 93 PHE 93 93 93 PHE PHE A . n A 1 94 PRO 94 94 94 PRO PRO A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 THR 96 96 96 THR THR A . n A 1 97 ASN 97 97 97 ASN ASN A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 ASN 102 102 102 ASN ASN A . n A 1 103 PHE 103 103 103 PHE PHE A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 ILE 105 105 105 ILE ILE A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 CYS 109 109 109 CYS CYS A . n A 1 110 ASP 110 110 110 ASP ASP A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 ASP 112 112 112 ASP ASP A . n A 1 113 GLN 113 113 113 GLN GLN A . n A 1 114 ASP 114 114 114 ASP ASP A . n A 1 115 PHE 115 115 115 PHE PHE A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 GLU 117 117 117 GLU GLU A . n A 1 118 TRP 118 118 118 TRP TRP A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 SER 120 120 120 SER SER A . n A 1 121 ARG 121 121 121 ARG ARG A . n A 1 122 GLY 122 122 122 GLY GLY A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 GLU 125 125 125 GLU GLU A . n A 1 126 PHE 126 126 126 PHE PHE A . n A 1 127 SER 127 127 127 SER SER A . n A 1 128 TRP 128 128 128 TRP TRP A . n A 1 129 ASN 129 129 129 ASN ASN A . n A 1 130 VAL 130 130 130 VAL VAL A . n A 1 131 PHE 131 131 131 PHE PHE A . n A 1 132 ASN 132 132 132 ASN ASN A . n A 1 133 PHE 133 133 133 PHE PHE A . n A 1 134 GLN 134 134 134 GLN GLN A . n A 1 135 LYS 135 135 135 LYS LYS A . n A 1 136 ASP 136 136 136 ASP ASP A . n A 1 137 GLN 137 137 137 GLN GLN A . n A 1 138 ASP 138 138 138 ASP ASP A . n A 1 139 VAL 139 139 139 VAL VAL A . n A 1 140 ARG 140 140 140 ARG ARG A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 ARG 142 142 142 ARG ARG A . n A 1 143 ILE 143 143 143 ILE ILE A . n A 1 144 GLY 144 144 144 GLY GLY A . n A 1 145 TYR 145 145 145 TYR TYR A . n A 1 146 GLU 146 146 146 GLU GLU A . n A 1 147 ALA 147 147 147 ALA ALA A . n A 1 148 PHE 148 148 148 PHE PHE A . n A 1 149 GLU 149 149 149 GLU GLU A . n A 1 150 GLN 150 150 150 GLN GLN A . n A 1 151 VAL 151 151 151 VAL VAL A . n A 1 152 PRO 152 152 152 PRO PRO A . n A 1 153 TYR 153 153 153 TYR TYR A . n A 1 154 LEU 154 154 154 LEU LEU A . n A 1 155 GLN 155 155 155 GLN GLN A . n A 1 156 ILE 156 156 156 ILE ILE A . n A 1 157 ARG 157 157 157 ARG ARG A . n A 1 158 GLU 158 158 158 GLU GLU A . n A 1 159 ASN 159 159 159 ASN ASN A . n A 1 160 ASN 160 160 160 ASN ASN A . n A 1 161 TRP 161 161 161 TRP TRP A . n A 1 162 THR 162 162 162 THR THR A . n A 1 163 PHE 163 163 163 PHE PHE A . n A 1 164 ASN 164 164 164 ASN ASN A . n A 1 165 ALA 165 165 165 ALA ALA A . n A 1 166 ASP 166 166 166 ASP ASP A . n A 1 167 TYR 167 167 167 TYR TYR A . n A 1 168 LYS 168 168 168 LYS LYS A . n A 1 169 GLY 169 169 169 GLY GLY A . n A 1 170 ARG 170 170 170 ARG ARG A . n A 1 171 TRP 171 171 171 TRP TRP A . n A 1 172 ASN 172 172 172 ASN ASN A . n A 1 173 VAL 173 173 173 VAL VAL A . n A 1 174 ARG 174 174 174 ARG ARG A . n A 1 175 TYR 175 175 175 TYR TYR A . n A 1 176 ASP 176 176 176 ASP ASP A . n A 1 177 LEU 177 177 177 LEU LEU A . n A 1 178 LEU 178 178 ? ? ? A . n A 1 179 GLU 179 179 ? ? ? A . n A 1 180 HIS 180 180 ? ? ? A . n A 1 181 HIS 181 181 ? ? ? A . n A 1 182 HIS 182 182 ? ? ? A . n A 1 183 HIS 183 183 ? ? ? A . n A 1 184 HIS 184 184 ? ? ? A . n A 1 185 HIS 185 185 ? ? ? A . n A 1 186 HIS 186 186 ? ? ? A . n A 1 187 HIS 187 187 ? ? ? A . n A 1 188 HIS 188 188 ? ? ? A . n A 1 189 HIS 189 189 ? ? ? A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7BGH _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7BGH _struct.title 'Solution structure of the chloroplast outer envelope channel OEP21' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7BGH _struct_keywords.text 'anion channel beta-barrel triosephosphate ATP, MEMBRANE PROTEIN' _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code OEP21_PEA _struct_ref.pdbx_db_accession Q9SM57 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;METSLRYGGDSKALKIHAKEKLRIDTNTFFQVRGGLDTKTGQPSSGSALIRHFYPNFSATLGVGVRYDKQDSVGVRYAKN DKLRYTVLAKKTFPVTNDGLVNFKIKGGCDVDQDFKEWKSRGGAEFSWNVFNFQKDQDVRLRIGYEAFEQVPYLQIRENN WTFNADYKGRWNVRYDL ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7BGH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 177 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9SM57 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 177 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 177 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7BGH LEU A 178 ? UNP Q9SM57 ? ? 'expression tag' 178 1 1 7BGH GLU A 179 ? UNP Q9SM57 ? ? 'expression tag' 179 2 1 7BGH HIS A 180 ? UNP Q9SM57 ? ? 'expression tag' 180 3 1 7BGH HIS A 181 ? UNP Q9SM57 ? ? 'expression tag' 181 4 1 7BGH HIS A 182 ? UNP Q9SM57 ? ? 'expression tag' 182 5 1 7BGH HIS A 183 ? UNP Q9SM57 ? ? 'expression tag' 183 6 1 7BGH HIS A 184 ? UNP Q9SM57 ? ? 'expression tag' 184 7 1 7BGH HIS A 185 ? UNP Q9SM57 ? ? 'expression tag' 185 8 1 7BGH HIS A 186 ? UNP Q9SM57 ? ? 'expression tag' 186 9 1 7BGH HIS A 187 ? UNP Q9SM57 ? ? 'expression tag' 187 10 1 7BGH HIS A 188 ? UNP Q9SM57 ? ? 'expression tag' 188 11 1 7BGH HIS A 189 ? UNP Q9SM57 ? ? 'expression tag' 189 12 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 13200 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support cross-linking _pdbx_struct_assembly_auth_evidence.details 'Homodimerization or higher oligomers' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 13 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA1 9 10 ? anti-parallel AA1 10 11 ? anti-parallel AA1 11 12 ? anti-parallel AA1 12 13 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 2 ? GLY A 9 ? GLU A 2 GLY A 9 AA1 2 LEU A 14 ? ASP A 25 ? LEU A 14 ASP A 25 AA1 3 THR A 28 ? LEU A 36 ? THR A 28 LEU A 36 AA1 4 SER A 44 ? TYR A 54 ? SER A 44 TYR A 54 AA1 5 ALA A 59 ? ASP A 68 ? ALA A 59 ASP A 68 AA1 6 LYS A 82 ? VAL A 95 ? LYS A 82 VAL A 95 AA1 7 VAL A 101 ? GLN A 113 ? VAL A 101 GLN A 113 AA1 8 TRP A 118 ? SER A 127 ? TRP A 118 SER A 127 AA1 9 ARG A 140 ? GLU A 146 ? ARG A 140 GLU A 146 AA1 10 VAL A 151 ? GLU A 158 ? VAL A 151 GLU A 158 AA1 11 TRP A 161 ? ASP A 166 ? TRP A 161 ASP A 166 AA1 12 ARG A 170 ? ASP A 176 ? ARG A 170 ASP A 176 AA1 13 GLU A 2 ? GLY A 9 ? GLU A 2 GLY A 9 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ARG A 6 ? N ARG A 6 O LYS A 15 ? O LYS A 15 AA1 2 3 N LEU A 22 ? N LEU A 22 O PHE A 30 ? O PHE A 30 AA1 3 4 N ARG A 33 ? N ARG A 33 O SER A 47 ? O SER A 47 AA1 4 5 N TYR A 54 ? N TYR A 54 O ALA A 59 ? O ALA A 59 AA1 5 6 N THR A 60 ? N THR A 60 O LYS A 90 ? O LYS A 90 AA1 6 7 N LEU A 83 ? N LEU A 83 O GLN A 113 ? O GLN A 113 AA1 7 8 N ASN A 102 ? N ASN A 102 O SER A 127 ? O SER A 127 AA1 8 9 O ALA A 124 ? O ALA A 124 N TYR A 145 ? N TYR A 145 AA1 9 10 N ARG A 142 ? N ARG A 142 O GLN A 155 ? O GLN A 155 AA1 10 11 N LEU A 154 ? N LEU A 154 O ALA A 165 ? O ALA A 165 AA1 11 12 N ASP A 166 ? N ASP A 166 O ARG A 170 ? O ARG A 170 AA1 12 13 O TYR A 175 ? O TYR A 175 N LEU A 5 ? N LEU A 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 11 ? ? -177.85 -77.12 2 1 ALA A 13 ? ? -73.23 -71.57 3 1 THR A 40 ? ? 82.66 107.22 4 1 PRO A 43 ? ? -54.29 178.73 5 1 SER A 44 ? ? -150.10 -53.16 6 1 PRO A 55 ? ? -80.70 -71.70 7 1 SER A 58 ? ? -50.25 95.50 8 1 ASP A 71 ? ? -134.75 -71.49 9 1 ASP A 81 ? ? 55.81 78.01 10 1 LYS A 82 ? ? -177.30 140.19 11 1 ASN A 97 ? ? 63.65 -80.26 12 1 LEU A 100 ? ? -164.08 6.65 13 1 ASP A 114 ? ? 169.77 -39.31 14 1 LYS A 116 ? ? -53.20 77.45 15 1 PHE A 131 ? ? -170.69 -66.34 16 1 PHE A 148 ? ? 171.38 -64.72 17 1 GLU A 149 ? ? -175.48 63.09 18 1 GLN A 150 ? ? -141.77 -80.10 19 1 ASN A 159 ? ? 60.74 -84.06 20 1 ASN A 160 ? ? -159.30 31.02 21 2 ASP A 10 ? ? 179.49 -46.18 22 2 LYS A 12 ? ? -57.08 98.41 23 2 THR A 40 ? ? -127.86 -57.04 24 2 PRO A 43 ? ? -47.98 172.44 25 2 SER A 44 ? ? -149.29 -53.00 26 2 SER A 58 ? ? -51.82 96.53 27 2 SER A 72 ? ? 63.83 139.42 28 2 ALA A 78 ? ? -177.23 89.83 29 2 ASN A 80 ? ? 54.01 -167.81 30 2 ASP A 81 ? ? 54.61 78.59 31 2 LEU A 100 ? ? -160.24 8.54 32 2 ASP A 114 ? ? 169.43 -46.02 33 2 LYS A 116 ? ? -51.18 71.14 34 2 PHE A 148 ? ? 179.46 64.31 35 2 GLN A 150 ? ? -108.24 -82.94 36 2 VAL A 151 ? ? -173.97 118.47 37 2 ASN A 159 ? ? 57.12 -87.62 38 2 ASN A 160 ? ? -150.49 30.21 39 3 ALA A 13 ? ? -160.66 118.12 40 3 THR A 38 ? ? 59.03 105.50 41 3 PRO A 43 ? ? -49.03 166.41 42 3 SER A 44 ? ? -148.10 -57.89 43 3 PRO A 55 ? ? -44.88 164.14 44 3 PHE A 57 ? ? 58.30 -73.10 45 3 SER A 58 ? ? 51.68 -86.49 46 3 ALA A 78 ? ? -176.81 -175.18 47 3 ASN A 80 ? ? -57.63 -168.17 48 3 ASP A 81 ? ? 55.89 85.89 49 3 LYS A 82 ? ? -179.14 147.86 50 3 LEU A 100 ? ? -96.31 -65.94 51 3 ASP A 114 ? ? 171.68 -41.34 52 3 LYS A 116 ? ? -51.36 76.42 53 3 VAL A 130 ? ? -147.09 -38.92 54 3 PHE A 148 ? ? 156.87 -56.51 55 3 GLU A 149 ? ? -147.51 -25.01 56 3 GLN A 150 ? ? -64.92 -78.16 57 3 VAL A 151 ? ? -179.55 127.94 58 3 ASN A 159 ? ? 56.85 -87.23 59 3 ASN A 160 ? ? -151.59 30.33 60 4 SER A 11 ? ? -177.59 -164.68 61 4 GLN A 42 ? ? 155.24 -49.76 62 4 SER A 44 ? ? -159.17 -49.85 63 4 ASN A 56 ? ? 57.09 -88.73 64 4 SER A 58 ? ? -46.27 105.07 65 4 GLN A 70 ? ? -65.84 -174.33 66 4 ASP A 81 ? ? 61.23 132.90 67 4 LYS A 82 ? ? 178.64 145.09 68 4 LEU A 100 ? ? -170.75 15.91 69 4 ASP A 114 ? ? 163.36 -38.10 70 4 LYS A 116 ? ? -51.81 74.55 71 4 PHE A 133 ? ? -174.83 -49.32 72 4 PHE A 148 ? ? 176.47 -63.32 73 4 GLU A 149 ? ? -163.94 43.31 74 4 GLN A 150 ? ? -117.31 -77.85 75 4 VAL A 151 ? ? -172.96 122.23 76 4 ASN A 159 ? ? 60.16 -84.61 77 4 ASN A 160 ? ? -158.75 32.50 78 5 ASP A 10 ? ? 179.53 -46.69 79 5 LYS A 12 ? ? -56.67 108.87 80 5 GLN A 42 ? ? -168.98 -53.87 81 5 SER A 44 ? ? -163.22 -65.23 82 5 PRO A 55 ? ? -57.97 -164.47 83 5 ASN A 56 ? ? 69.49 64.32 84 5 PHE A 57 ? ? 65.46 -73.31 85 5 SER A 58 ? ? -173.41 108.20 86 5 ASP A 81 ? ? 54.24 88.15 87 5 LYS A 82 ? ? -176.67 143.80 88 5 LEU A 100 ? ? -164.20 11.45 89 5 ASP A 114 ? ? 172.67 -41.04 90 5 LYS A 116 ? ? -46.66 74.80 91 5 LYS A 135 ? ? 59.96 84.14 92 5 ASP A 138 ? ? 43.25 93.36 93 5 PHE A 148 ? ? 169.77 -62.47 94 5 GLU A 149 ? ? -172.58 65.55 95 5 GLN A 150 ? ? -139.89 -78.49 96 5 ASN A 159 ? ? 54.85 -88.00 97 5 ASN A 160 ? ? -151.72 33.04 98 6 PRO A 43 ? ? -48.38 174.39 99 6 SER A 44 ? ? -142.98 -52.26 100 6 PRO A 55 ? ? -62.15 -153.41 101 6 PHE A 57 ? ? 69.46 -72.00 102 6 SER A 58 ? ? -174.80 108.24 103 6 ASP A 71 ? ? -176.01 -32.42 104 6 ARG A 76 ? ? -87.21 34.14 105 6 ASN A 80 ? ? 178.18 -21.19 106 6 ASP A 81 ? ? 48.09 70.20 107 6 LEU A 100 ? ? -170.57 17.01 108 6 ASP A 114 ? ? 168.11 -36.47 109 6 LYS A 116 ? ? -50.94 73.67 110 6 PHE A 133 ? ? -157.61 -63.17 111 6 GLU A 149 ? ? -147.15 -69.59 112 6 GLN A 150 ? ? -132.49 -49.95 113 6 VAL A 151 ? ? -178.28 138.77 114 6 ASN A 159 ? ? 59.73 -84.81 115 6 ASN A 160 ? ? -157.81 30.97 116 7 ALA A 13 ? ? -162.17 119.41 117 7 ILE A 24 ? ? -93.91 -60.35 118 7 ASP A 25 ? ? 177.36 164.29 119 7 THR A 38 ? ? -56.47 91.98 120 7 LYS A 39 ? ? 45.70 24.88 121 7 PRO A 43 ? ? -50.84 175.83 122 7 SER A 44 ? ? -148.55 -49.65 123 7 PRO A 55 ? ? -51.12 174.47 124 7 PHE A 57 ? ? 57.74 -74.26 125 7 SER A 58 ? ? 51.72 -86.78 126 7 SER A 72 ? ? 53.29 84.74 127 7 VAL A 73 ? ? -151.01 -32.53 128 7 ALA A 78 ? ? 176.98 -78.39 129 7 ASN A 80 ? ? -160.05 96.93 130 7 LYS A 82 ? ? -178.20 144.42 131 7 ASN A 102 ? ? -163.78 119.25 132 7 ASP A 114 ? ? 170.26 -44.51 133 7 LYS A 116 ? ? -50.60 68.25 134 7 VAL A 130 ? ? -136.23 -45.12 135 7 LYS A 135 ? ? -175.49 93.05 136 7 ASP A 136 ? ? -147.19 -74.81 137 7 GLU A 149 ? ? -166.35 -47.33 138 7 GLN A 150 ? ? -99.28 -73.90 139 7 VAL A 151 ? ? -177.78 138.83 140 7 ASN A 159 ? ? 59.67 -84.46 141 7 ASN A 160 ? ? -155.97 29.78 142 8 ASP A 10 ? ? 179.02 -46.82 143 8 ALA A 13 ? ? -167.31 89.60 144 8 THR A 40 ? ? -139.65 -68.44 145 8 GLN A 42 ? ? 110.90 -39.06 146 8 SER A 44 ? ? -155.66 -49.03 147 8 PRO A 55 ? ? -58.38 -160.48 148 8 ASN A 56 ? ? 67.62 65.12 149 8 PHE A 57 ? ? 64.57 -74.99 150 8 SER A 58 ? ? -176.31 109.24 151 8 ALA A 78 ? ? -152.08 50.00 152 8 ASN A 80 ? ? -57.82 -173.80 153 8 LEU A 100 ? ? -167.67 14.92 154 8 ASP A 114 ? ? 169.21 -41.25 155 8 LYS A 116 ? ? -50.54 70.75 156 8 ASP A 136 ? ? -155.37 76.20 157 8 PHE A 148 ? ? 103.65 -146.70 158 8 GLN A 150 ? ? -53.40 -95.56 159 8 ASN A 159 ? ? 58.57 -86.09 160 8 ASN A 160 ? ? -153.97 29.69 161 9 ASP A 10 ? ? -164.61 -43.91 162 9 SER A 11 ? ? -178.91 73.33 163 9 LYS A 12 ? ? 60.42 107.86 164 9 ALA A 13 ? ? -170.21 100.56 165 9 THR A 40 ? ? 71.10 39.71 166 9 GLN A 42 ? ? 157.49 -60.34 167 9 PRO A 43 ? ? -42.97 157.92 168 9 SER A 44 ? ? 161.35 55.08 169 9 PRO A 55 ? ? -62.11 -154.63 170 9 ASN A 56 ? ? 63.85 60.34 171 9 PHE A 57 ? ? 67.68 -71.98 172 9 SER A 58 ? ? -174.26 108.70 173 9 ARG A 76 ? ? -147.80 -70.41 174 9 ALA A 78 ? ? 178.22 36.90 175 9 LYS A 79 ? ? -102.68 69.71 176 9 ASN A 80 ? ? -161.19 107.40 177 9 LEU A 100 ? ? -98.57 -66.32 178 9 ASP A 114 ? ? 168.42 -45.41 179 9 LYS A 116 ? ? -50.63 67.49 180 9 GLN A 134 ? ? -173.83 80.67 181 9 LYS A 135 ? ? -170.91 147.00 182 9 PHE A 148 ? ? 177.06 -63.89 183 9 GLU A 149 ? ? -145.28 -26.66 184 9 GLN A 150 ? ? -52.48 -79.47 185 9 VAL A 151 ? ? -174.89 123.36 186 9 ASN A 159 ? ? 57.92 -84.85 187 9 ASN A 160 ? ? -152.14 26.05 188 10 ASP A 10 ? ? -150.25 -41.61 189 10 SER A 11 ? ? -160.47 48.80 190 10 GLN A 42 ? ? -169.14 -53.68 191 10 SER A 44 ? ? -162.30 -62.21 192 10 PRO A 55 ? ? -51.52 175.38 193 10 PHE A 57 ? ? 59.69 -73.56 194 10 SER A 58 ? ? 50.00 -87.06 195 10 LEU A 100 ? ? -170.65 16.93 196 10 ASP A 114 ? ? 169.47 -40.97 197 10 LYS A 116 ? ? -53.46 75.44 198 10 GLN A 134 ? ? -153.28 -76.43 199 10 ASP A 136 ? ? -160.27 36.76 200 10 GLN A 137 ? ? 62.35 129.81 201 10 PHE A 148 ? ? 173.99 -68.46 202 10 GLU A 149 ? ? -148.43 -13.20 203 10 GLN A 150 ? ? -56.24 -76.01 204 10 VAL A 151 ? ? -175.94 129.45 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 4 _pdbx_validate_peptide_omega.auth_comp_id_1 ARG _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 142 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 ILE _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 143 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega -147.19 # _pdbx_nmr_ensemble.entry_id 7BGH _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7BGH _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 ;0.4 mM [U-13C; U-15N; U-2H] OEP21, 300 mM [U-100% 2H] LDAO, 20 mM sodium phosphate, 50 mM sodium chloride, 5 mM DTT, 0.5 mM EDTA, 95% H2O/5% D2O ; '95% H2O/5% D2O' DCN micelle '2H,13C,15N-labeled OEP21 in deuterated LDAO micelles' 3 ;0.4 mM [ U-15N; U-2H],ILVAFY OEP21, 300 mM [U-100% 2H] LDAO, 20 mM sodium phosphate, 50 mM sodium chloride, 5 mM DTT, 0.5 mM EDTA, 95% H2O/5% D2O ; '95% H2O/5% D2O' ILVAFY micelle ;2H,15N-labeled OEP21 with stereospecific ILVA 1H,13C-methyl labeled amino acids: pro-S for Leu and Val, delta1 for Ile, beta for Ala, including 1H,15N-labeled aromatic amino acids Phe and Tyr in deuterated LDAO micelles ; # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 OEP21 0.4 ? mM '[U-13C; U-15N; U-2H]' 1 LDAO 300 ? mM '[U-100% 2H]' 1 'sodium phosphate' 20 ? mM 'natural abundance' 1 'sodium chloride' 50 ? mM 'natural abundance' 1 DTT 5 ? mM 'natural abundance' 1 EDTA 0.5 ? mM 'natural abundance' 3 OEP21 0.4 ? mM '[ U-15N; U-2H],ILVAFY' 3 LDAO 300 ? mM '[U-100% 2H]' 3 'sodium phosphate' 20 ? mM 'natural abundance' 3 'sodium chloride' 50 ? mM 'natural abundance' 3 DTT 5 ? mM 'natural abundance' 3 EDTA 0.5 ? mM 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 308 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label condition_1 _pdbx_nmr_exptl_sample_conditions.pH_err 0.1 _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N TROSY HSQC' 3 isotropic 2 1 1 '3D HNCA' 3 isotropic 3 1 1 '3D HNCACB' 3 isotropic 4 1 1 '3D HNCO' 3 isotropic 10 1 1 '3D HNCACO' 3 isotropic 5 1 1 '3D HN(CO)CA' 3 isotropic 6 1 1 '3D 1H-15N NOESY' 3 isotropic 13 1 3 '2D 1H-15N TROSY HSQC' 2 isotropic 11 1 3 '2D 1H-13C HMQC' 2 isotropic 7 1 3 '3D 1H-15N NOESY' 2 isotropic 8 1 3 '3D 1H-13C NOESY aliphatic' 2 isotropic 9 1 3 '3D 13C-13C NOESY aliphatic' 3 isotropic 12 1 3 '3D 13C-15N NOESY aliphatic' 3 isotropic # _pdbx_nmr_refine.entry_id 7BGH _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 7 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection TopSpin ? 'Bruker Biospin' 2 processing TopSpin ? 'Bruker Biospin' 5 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 6 processing hmsIST ? 'Wagner Lab, Harvard Medical School' 3 'chemical shift assignment' NMRFAM-SPARKY ? 'Univ of Wisconsin' 4 'peak picking' NMRFAM-SPARKY ? 'Univ of Wisconsin' 7 'structure calculation' 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' 8 refinement 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LEU 178 ? A LEU 178 2 1 Y 1 A GLU 179 ? A GLU 179 3 1 Y 1 A HIS 180 ? A HIS 180 4 1 Y 1 A HIS 181 ? A HIS 181 5 1 Y 1 A HIS 182 ? A HIS 182 6 1 Y 1 A HIS 183 ? A HIS 183 7 1 Y 1 A HIS 184 ? A HIS 184 8 1 Y 1 A HIS 185 ? A HIS 185 9 1 Y 1 A HIS 186 ? A HIS 186 10 1 Y 1 A HIS 187 ? A HIS 187 11 1 Y 1 A HIS 188 ? A HIS 188 12 1 Y 1 A HIS 189 ? A HIS 189 13 2 Y 1 A LEU 178 ? A LEU 178 14 2 Y 1 A GLU 179 ? A GLU 179 15 2 Y 1 A HIS 180 ? A HIS 180 16 2 Y 1 A HIS 181 ? A HIS 181 17 2 Y 1 A HIS 182 ? A HIS 182 18 2 Y 1 A HIS 183 ? A HIS 183 19 2 Y 1 A HIS 184 ? A HIS 184 20 2 Y 1 A HIS 185 ? A HIS 185 21 2 Y 1 A HIS 186 ? A HIS 186 22 2 Y 1 A HIS 187 ? A HIS 187 23 2 Y 1 A HIS 188 ? A HIS 188 24 2 Y 1 A HIS 189 ? A HIS 189 25 3 Y 1 A LEU 178 ? A LEU 178 26 3 Y 1 A GLU 179 ? A GLU 179 27 3 Y 1 A HIS 180 ? A HIS 180 28 3 Y 1 A HIS 181 ? A HIS 181 29 3 Y 1 A HIS 182 ? A HIS 182 30 3 Y 1 A HIS 183 ? A HIS 183 31 3 Y 1 A HIS 184 ? A HIS 184 32 3 Y 1 A HIS 185 ? A HIS 185 33 3 Y 1 A HIS 186 ? A HIS 186 34 3 Y 1 A HIS 187 ? A HIS 187 35 3 Y 1 A HIS 188 ? A HIS 188 36 3 Y 1 A HIS 189 ? A HIS 189 37 4 Y 1 A LEU 178 ? A LEU 178 38 4 Y 1 A GLU 179 ? A GLU 179 39 4 Y 1 A HIS 180 ? A HIS 180 40 4 Y 1 A HIS 181 ? A HIS 181 41 4 Y 1 A HIS 182 ? A HIS 182 42 4 Y 1 A HIS 183 ? A HIS 183 43 4 Y 1 A HIS 184 ? A HIS 184 44 4 Y 1 A HIS 185 ? A HIS 185 45 4 Y 1 A HIS 186 ? A HIS 186 46 4 Y 1 A HIS 187 ? A HIS 187 47 4 Y 1 A HIS 188 ? A HIS 188 48 4 Y 1 A HIS 189 ? A HIS 189 49 5 Y 1 A LEU 178 ? A LEU 178 50 5 Y 1 A GLU 179 ? A GLU 179 51 5 Y 1 A HIS 180 ? A HIS 180 52 5 Y 1 A HIS 181 ? A HIS 181 53 5 Y 1 A HIS 182 ? A HIS 182 54 5 Y 1 A HIS 183 ? A HIS 183 55 5 Y 1 A HIS 184 ? A HIS 184 56 5 Y 1 A HIS 185 ? A HIS 185 57 5 Y 1 A HIS 186 ? A HIS 186 58 5 Y 1 A HIS 187 ? A HIS 187 59 5 Y 1 A HIS 188 ? A HIS 188 60 5 Y 1 A HIS 189 ? A HIS 189 61 6 Y 1 A LEU 178 ? A LEU 178 62 6 Y 1 A GLU 179 ? A GLU 179 63 6 Y 1 A HIS 180 ? A HIS 180 64 6 Y 1 A HIS 181 ? A HIS 181 65 6 Y 1 A HIS 182 ? A HIS 182 66 6 Y 1 A HIS 183 ? A HIS 183 67 6 Y 1 A HIS 184 ? A HIS 184 68 6 Y 1 A HIS 185 ? A HIS 185 69 6 Y 1 A HIS 186 ? A HIS 186 70 6 Y 1 A HIS 187 ? A HIS 187 71 6 Y 1 A HIS 188 ? A HIS 188 72 6 Y 1 A HIS 189 ? A HIS 189 73 7 Y 1 A LEU 178 ? A LEU 178 74 7 Y 1 A GLU 179 ? A GLU 179 75 7 Y 1 A HIS 180 ? A HIS 180 76 7 Y 1 A HIS 181 ? A HIS 181 77 7 Y 1 A HIS 182 ? A HIS 182 78 7 Y 1 A HIS 183 ? A HIS 183 79 7 Y 1 A HIS 184 ? A HIS 184 80 7 Y 1 A HIS 185 ? A HIS 185 81 7 Y 1 A HIS 186 ? A HIS 186 82 7 Y 1 A HIS 187 ? A HIS 187 83 7 Y 1 A HIS 188 ? A HIS 188 84 7 Y 1 A HIS 189 ? A HIS 189 85 8 Y 1 A LEU 178 ? A LEU 178 86 8 Y 1 A GLU 179 ? A GLU 179 87 8 Y 1 A HIS 180 ? A HIS 180 88 8 Y 1 A HIS 181 ? A HIS 181 89 8 Y 1 A HIS 182 ? A HIS 182 90 8 Y 1 A HIS 183 ? A HIS 183 91 8 Y 1 A HIS 184 ? A HIS 184 92 8 Y 1 A HIS 185 ? A HIS 185 93 8 Y 1 A HIS 186 ? A HIS 186 94 8 Y 1 A HIS 187 ? A HIS 187 95 8 Y 1 A HIS 188 ? A HIS 188 96 8 Y 1 A HIS 189 ? A HIS 189 97 9 Y 1 A LEU 178 ? A LEU 178 98 9 Y 1 A GLU 179 ? A GLU 179 99 9 Y 1 A HIS 180 ? A HIS 180 100 9 Y 1 A HIS 181 ? A HIS 181 101 9 Y 1 A HIS 182 ? A HIS 182 102 9 Y 1 A HIS 183 ? A HIS 183 103 9 Y 1 A HIS 184 ? A HIS 184 104 9 Y 1 A HIS 185 ? A HIS 185 105 9 Y 1 A HIS 186 ? A HIS 186 106 9 Y 1 A HIS 187 ? A HIS 187 107 9 Y 1 A HIS 188 ? A HIS 188 108 9 Y 1 A HIS 189 ? A HIS 189 109 10 Y 1 A LEU 178 ? A LEU 178 110 10 Y 1 A GLU 179 ? A GLU 179 111 10 Y 1 A HIS 180 ? A HIS 180 112 10 Y 1 A HIS 181 ? A HIS 181 113 10 Y 1 A HIS 182 ? A HIS 182 114 10 Y 1 A HIS 183 ? A HIS 183 115 10 Y 1 A HIS 184 ? A HIS 184 116 10 Y 1 A HIS 185 ? A HIS 185 117 10 Y 1 A HIS 186 ? A HIS 186 118 10 Y 1 A HIS 187 ? A HIS 187 119 10 Y 1 A HIS 188 ? A HIS 188 120 10 Y 1 A HIS 189 ? A HIS 189 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Helmholtz Association' Germany VG-NG-1035 1 'European Commission' 'European Union' 291763 2 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 2 'AVANCE III HD' ? Bruker 900 ? 3 'AVANCE III HD' ? Bruker 800 ? # _atom_sites.entry_id 7BGH _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_