data_7C7Y # _entry.id 7C7Y # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7C7Y pdb_00007c7y 10.2210/pdb7c7y/pdb WWPDB D_1300017156 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-10-28 2 'Structure model' 1 1 2020-12-16 3 'Structure model' 1 2 2021-03-17 4 'Structure model' 1 3 2024-10-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' citation 3 3 'Structure model' citation_author 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_entry_details 8 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.pdbx_database_id_DOI' 2 2 'Structure model' '_citation.pdbx_database_id_PubMed' 3 3 'Structure model' '_citation.journal_volume' 4 3 'Structure model' '_citation.page_first' 5 3 'Structure model' '_citation.page_last' 6 3 'Structure model' '_citation.pdbx_database_id_PubMed' 7 3 'Structure model' '_citation_author.identifier_ORCID' 8 4 'Structure model' '_database_2.pdbx_DOI' 9 4 'Structure model' '_database_2.pdbx_database_accession' 10 4 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7C7Y _pdbx_database_status.recvd_initial_deposition_date 2020-05-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _audit_author.name 'Hayashi, I.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID 0000-0003-4784-8933 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Biol.Chem. _citation.journal_id_ASTM JBCHA3 _citation.journal_id_CSD 0071 _citation.journal_id_ISSN 1083-351X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 295 _citation.language ? _citation.page_first 17770 _citation.page_last 17780 _citation.title 'The C-terminal region of the plasmid partitioning protein TubY is a tetramer that can bind membranes and DNA.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1074/jbc.RA120.014705 _citation.pdbx_database_id_PubMed 33454013 _citation.unpublished_flag ? # _citation_author.citation_id primary _citation_author.name 'Hayashi, I.' _citation_author.ordinal 1 _citation_author.identifier_ORCID ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Uncharacterized protein' 9423.053 4 ? ? ? ? 2 water nat water 18.015 17 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;GSH(MSE)QQVNPDFIEALTEKITEEVTAKVTEELTKQN(MSE)EFFAAVAKQSQDNFDRINKRLEERDEKL(MSE)STI RLIQEQKSANAQ ; _entity_poly.pdbx_seq_one_letter_code_can GSHMQQVNPDFIEALTEKITEEVTAKVTEELTKQNMEFFAAVAKQSQDNFDRINKRLEERDEKLMSTIRLIQEQKSANAQ _entity_poly.pdbx_strand_id A,B,C,D _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MSE n 1 5 GLN n 1 6 GLN n 1 7 VAL n 1 8 ASN n 1 9 PRO n 1 10 ASP n 1 11 PHE n 1 12 ILE n 1 13 GLU n 1 14 ALA n 1 15 LEU n 1 16 THR n 1 17 GLU n 1 18 LYS n 1 19 ILE n 1 20 THR n 1 21 GLU n 1 22 GLU n 1 23 VAL n 1 24 THR n 1 25 ALA n 1 26 LYS n 1 27 VAL n 1 28 THR n 1 29 GLU n 1 30 GLU n 1 31 LEU n 1 32 THR n 1 33 LYS n 1 34 GLN n 1 35 ASN n 1 36 MSE n 1 37 GLU n 1 38 PHE n 1 39 PHE n 1 40 ALA n 1 41 ALA n 1 42 VAL n 1 43 ALA n 1 44 LYS n 1 45 GLN n 1 46 SER n 1 47 GLN n 1 48 ASP n 1 49 ASN n 1 50 PHE n 1 51 ASP n 1 52 ARG n 1 53 ILE n 1 54 ASN n 1 55 LYS n 1 56 ARG n 1 57 LEU n 1 58 GLU n 1 59 GLU n 1 60 ARG n 1 61 ASP n 1 62 GLU n 1 63 LYS n 1 64 LEU n 1 65 MSE n 1 66 SER n 1 67 THR n 1 68 ILE n 1 69 ARG n 1 70 LEU n 1 71 ILE n 1 72 GLN n 1 73 GLU n 1 74 GLN n 1 75 LYS n 1 76 SER n 1 77 ALA n 1 78 ASN n 1 79 ALA n 1 80 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 80 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene BCE_A0068 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 10987 / NRS 248' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus cereus (strain ATCC 10987 / NRS 248)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 222523 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 103 ? ? ? A . n A 1 2 SER 2 104 ? ? ? A . n A 1 3 HIS 3 105 ? ? ? A . n A 1 4 MSE 4 106 ? ? ? A . n A 1 5 GLN 5 107 ? ? ? A . n A 1 6 GLN 6 108 ? ? ? A . n A 1 7 VAL 7 109 ? ? ? A . n A 1 8 ASN 8 110 110 ASN ASN A . n A 1 9 PRO 9 111 111 PRO PRO A . n A 1 10 ASP 10 112 112 ASP ASP A . n A 1 11 PHE 11 113 113 PHE PHE A . n A 1 12 ILE 12 114 114 ILE ILE A . n A 1 13 GLU 13 115 115 GLU GLU A . n A 1 14 ALA 14 116 116 ALA ALA A . n A 1 15 LEU 15 117 117 LEU LEU A . n A 1 16 THR 16 118 118 THR THR A . n A 1 17 GLU 17 119 119 GLU GLU A . n A 1 18 LYS 18 120 120 LYS LYS A . n A 1 19 ILE 19 121 121 ILE ILE A . n A 1 20 THR 20 122 122 THR THR A . n A 1 21 GLU 21 123 123 GLU GLU A . n A 1 22 GLU 22 124 124 GLU GLU A . n A 1 23 VAL 23 125 125 VAL VAL A . n A 1 24 THR 24 126 126 THR THR A . n A 1 25 ALA 25 127 127 ALA ALA A . n A 1 26 LYS 26 128 128 LYS LYS A . n A 1 27 VAL 27 129 129 VAL VAL A . n A 1 28 THR 28 130 130 THR THR A . n A 1 29 GLU 29 131 131 GLU GLU A . n A 1 30 GLU 30 132 132 GLU GLU A . n A 1 31 LEU 31 133 133 LEU LEU A . n A 1 32 THR 32 134 134 THR THR A . n A 1 33 LYS 33 135 135 LYS LYS A . n A 1 34 GLN 34 136 136 GLN GLN A . n A 1 35 ASN 35 137 137 ASN ASN A . n A 1 36 MSE 36 138 138 MSE MSE A . n A 1 37 GLU 37 139 139 GLU GLU A . n A 1 38 PHE 38 140 140 PHE PHE A . n A 1 39 PHE 39 141 141 PHE PHE A . n A 1 40 ALA 40 142 142 ALA ALA A . n A 1 41 ALA 41 143 143 ALA ALA A . n A 1 42 VAL 42 144 144 VAL VAL A . n A 1 43 ALA 43 145 145 ALA ALA A . n A 1 44 LYS 44 146 146 LYS LYS A . n A 1 45 GLN 45 147 147 GLN GLN A . n A 1 46 SER 46 148 148 SER SER A . n A 1 47 GLN 47 149 149 GLN GLN A . n A 1 48 ASP 48 150 150 ASP ASP A . n A 1 49 ASN 49 151 151 ASN ASN A . n A 1 50 PHE 50 152 152 PHE PHE A . n A 1 51 ASP 51 153 153 ASP ASP A . n A 1 52 ARG 52 154 154 ARG ARG A . n A 1 53 ILE 53 155 155 ILE ILE A . n A 1 54 ASN 54 156 156 ASN ASN A . n A 1 55 LYS 55 157 157 LYS LYS A . n A 1 56 ARG 56 158 158 ARG ARG A . n A 1 57 LEU 57 159 159 LEU LEU A . n A 1 58 GLU 58 160 160 GLU GLU A . n A 1 59 GLU 59 161 161 GLU GLU A . n A 1 60 ARG 60 162 162 ARG ARG A . n A 1 61 ASP 61 163 163 ASP ASP A . n A 1 62 GLU 62 164 164 GLU GLU A . n A 1 63 LYS 63 165 165 LYS LYS A . n A 1 64 LEU 64 166 166 LEU LEU A . n A 1 65 MSE 65 167 167 MSE MSE A . n A 1 66 SER 66 168 168 SER SER A . n A 1 67 THR 67 169 169 THR THR A . n A 1 68 ILE 68 170 170 ILE ILE A . n A 1 69 ARG 69 171 171 ARG ARG A . n A 1 70 LEU 70 172 172 LEU LEU A . n A 1 71 ILE 71 173 173 ILE ILE A . n A 1 72 GLN 72 174 174 GLN GLN A . n A 1 73 GLU 73 175 175 GLU GLU A . n A 1 74 GLN 74 176 ? ? ? A . n A 1 75 LYS 75 177 ? ? ? A . n A 1 76 SER 76 178 ? ? ? A . n A 1 77 ALA 77 179 ? ? ? A . n A 1 78 ASN 78 180 ? ? ? A . n A 1 79 ALA 79 181 ? ? ? A . n A 1 80 GLN 80 182 ? ? ? A . n B 1 1 GLY 1 103 ? ? ? B . n B 1 2 SER 2 104 ? ? ? B . n B 1 3 HIS 3 105 ? ? ? B . n B 1 4 MSE 4 106 ? ? ? B . n B 1 5 GLN 5 107 ? ? ? B . n B 1 6 GLN 6 108 ? ? ? B . n B 1 7 VAL 7 109 ? ? ? B . n B 1 8 ASN 8 110 110 ASN ASN B . n B 1 9 PRO 9 111 111 PRO PRO B . n B 1 10 ASP 10 112 112 ASP ASP B . n B 1 11 PHE 11 113 113 PHE PHE B . n B 1 12 ILE 12 114 114 ILE ILE B . n B 1 13 GLU 13 115 115 GLU GLU B . n B 1 14 ALA 14 116 116 ALA ALA B . n B 1 15 LEU 15 117 117 LEU LEU B . n B 1 16 THR 16 118 118 THR THR B . n B 1 17 GLU 17 119 119 GLU GLU B . n B 1 18 LYS 18 120 120 LYS LYS B . n B 1 19 ILE 19 121 121 ILE ILE B . n B 1 20 THR 20 122 122 THR THR B . n B 1 21 GLU 21 123 123 GLU GLU B . n B 1 22 GLU 22 124 124 GLU GLU B . n B 1 23 VAL 23 125 125 VAL VAL B . n B 1 24 THR 24 126 126 THR THR B . n B 1 25 ALA 25 127 127 ALA ALA B . n B 1 26 LYS 26 128 128 LYS LYS B . n B 1 27 VAL 27 129 129 VAL VAL B . n B 1 28 THR 28 130 130 THR THR B . n B 1 29 GLU 29 131 131 GLU GLU B . n B 1 30 GLU 30 132 132 GLU GLU B . n B 1 31 LEU 31 133 133 LEU LEU B . n B 1 32 THR 32 134 134 THR THR B . n B 1 33 LYS 33 135 135 LYS LYS B . n B 1 34 GLN 34 136 136 GLN GLN B . n B 1 35 ASN 35 137 137 ASN ASN B . n B 1 36 MSE 36 138 138 MSE MSE B . n B 1 37 GLU 37 139 139 GLU GLU B . n B 1 38 PHE 38 140 140 PHE PHE B . n B 1 39 PHE 39 141 141 PHE PHE B . n B 1 40 ALA 40 142 142 ALA ALA B . n B 1 41 ALA 41 143 143 ALA ALA B . n B 1 42 VAL 42 144 144 VAL VAL B . n B 1 43 ALA 43 145 145 ALA ALA B . n B 1 44 LYS 44 146 146 LYS LYS B . n B 1 45 GLN 45 147 147 GLN GLN B . n B 1 46 SER 46 148 148 SER SER B . n B 1 47 GLN 47 149 149 GLN GLN B . n B 1 48 ASP 48 150 150 ASP ASP B . n B 1 49 ASN 49 151 151 ASN ASN B . n B 1 50 PHE 50 152 152 PHE PHE B . n B 1 51 ASP 51 153 153 ASP ASP B . n B 1 52 ARG 52 154 154 ARG ARG B . n B 1 53 ILE 53 155 155 ILE ILE B . n B 1 54 ASN 54 156 156 ASN ASN B . n B 1 55 LYS 55 157 157 LYS LYS B . n B 1 56 ARG 56 158 158 ARG ARG B . n B 1 57 LEU 57 159 159 LEU LEU B . n B 1 58 GLU 58 160 160 GLU GLU B . n B 1 59 GLU 59 161 161 GLU GLU B . n B 1 60 ARG 60 162 162 ARG ARG B . n B 1 61 ASP 61 163 163 ASP ASP B . n B 1 62 GLU 62 164 164 GLU GLU B . n B 1 63 LYS 63 165 165 LYS LYS B . n B 1 64 LEU 64 166 166 LEU LEU B . n B 1 65 MSE 65 167 167 MSE MSE B . n B 1 66 SER 66 168 168 SER SER B . n B 1 67 THR 67 169 169 THR THR B . n B 1 68 ILE 68 170 170 ILE ILE B . n B 1 69 ARG 69 171 171 ARG ARG B . n B 1 70 LEU 70 172 172 LEU LEU B . n B 1 71 ILE 71 173 173 ILE ILE B . n B 1 72 GLN 72 174 174 GLN GLN B . n B 1 73 GLU 73 175 175 GLU GLU B . n B 1 74 GLN 74 176 ? ? ? B . n B 1 75 LYS 75 177 ? ? ? B . n B 1 76 SER 76 178 ? ? ? B . n B 1 77 ALA 77 179 ? ? ? B . n B 1 78 ASN 78 180 ? ? ? B . n B 1 79 ALA 79 181 ? ? ? B . n B 1 80 GLN 80 182 ? ? ? B . n C 1 1 GLY 1 103 ? ? ? C . n C 1 2 SER 2 104 ? ? ? C . n C 1 3 HIS 3 105 ? ? ? C . n C 1 4 MSE 4 106 ? ? ? C . n C 1 5 GLN 5 107 ? ? ? C . n C 1 6 GLN 6 108 ? ? ? C . n C 1 7 VAL 7 109 ? ? ? C . n C 1 8 ASN 8 110 110 ASN ALA C . n C 1 9 PRO 9 111 111 PRO PRO C . n C 1 10 ASP 10 112 112 ASP ASP C . n C 1 11 PHE 11 113 113 PHE PHE C . n C 1 12 ILE 12 114 114 ILE ILE C . n C 1 13 GLU 13 115 115 GLU GLU C . n C 1 14 ALA 14 116 116 ALA ALA C . n C 1 15 LEU 15 117 117 LEU LEU C . n C 1 16 THR 16 118 118 THR THR C . n C 1 17 GLU 17 119 119 GLU GLU C . n C 1 18 LYS 18 120 120 LYS LYS C . n C 1 19 ILE 19 121 121 ILE ILE C . n C 1 20 THR 20 122 122 THR THR C . n C 1 21 GLU 21 123 123 GLU GLU C . n C 1 22 GLU 22 124 124 GLU GLU C . n C 1 23 VAL 23 125 125 VAL VAL C . n C 1 24 THR 24 126 126 THR THR C . n C 1 25 ALA 25 127 127 ALA ALA C . n C 1 26 LYS 26 128 128 LYS LYS C . n C 1 27 VAL 27 129 129 VAL VAL C . n C 1 28 THR 28 130 130 THR THR C . n C 1 29 GLU 29 131 131 GLU GLU C . n C 1 30 GLU 30 132 132 GLU GLU C . n C 1 31 LEU 31 133 133 LEU LEU C . n C 1 32 THR 32 134 134 THR THR C . n C 1 33 LYS 33 135 135 LYS LYS C . n C 1 34 GLN 34 136 136 GLN GLN C . n C 1 35 ASN 35 137 137 ASN ASN C . n C 1 36 MSE 36 138 138 MSE MSE C . n C 1 37 GLU 37 139 139 GLU GLU C . n C 1 38 PHE 38 140 140 PHE PHE C . n C 1 39 PHE 39 141 141 PHE PHE C . n C 1 40 ALA 40 142 142 ALA ALA C . n C 1 41 ALA 41 143 143 ALA ALA C . n C 1 42 VAL 42 144 144 VAL VAL C . n C 1 43 ALA 43 145 145 ALA ALA C . n C 1 44 LYS 44 146 146 LYS LYS C . n C 1 45 GLN 45 147 147 GLN GLN C . n C 1 46 SER 46 148 148 SER SER C . n C 1 47 GLN 47 149 149 GLN GLN C . n C 1 48 ASP 48 150 150 ASP ASP C . n C 1 49 ASN 49 151 151 ASN ASN C . n C 1 50 PHE 50 152 152 PHE PHE C . n C 1 51 ASP 51 153 153 ASP ASP C . n C 1 52 ARG 52 154 154 ARG ARG C . n C 1 53 ILE 53 155 155 ILE ILE C . n C 1 54 ASN 54 156 156 ASN ASN C . n C 1 55 LYS 55 157 157 LYS LYS C . n C 1 56 ARG 56 158 158 ARG ARG C . n C 1 57 LEU 57 159 159 LEU LEU C . n C 1 58 GLU 58 160 160 GLU GLU C . n C 1 59 GLU 59 161 161 GLU GLU C . n C 1 60 ARG 60 162 162 ARG ARG C . n C 1 61 ASP 61 163 163 ASP ASP C . n C 1 62 GLU 62 164 164 GLU GLU C . n C 1 63 LYS 63 165 165 LYS LYS C . n C 1 64 LEU 64 166 166 LEU LEU C . n C 1 65 MSE 65 167 167 MSE MSE C . n C 1 66 SER 66 168 168 SER SER C . n C 1 67 THR 67 169 169 THR THR C . n C 1 68 ILE 68 170 170 ILE ILE C . n C 1 69 ARG 69 171 171 ARG ARG C . n C 1 70 LEU 70 172 172 LEU LEU C . n C 1 71 ILE 71 173 173 ILE ILE C . n C 1 72 GLN 72 174 174 GLN GLN C . n C 1 73 GLU 73 175 175 GLU GLU C . n C 1 74 GLN 74 176 176 GLN GLN C . n C 1 75 LYS 75 177 ? ? ? C . n C 1 76 SER 76 178 ? ? ? C . n C 1 77 ALA 77 179 ? ? ? C . n C 1 78 ASN 78 180 ? ? ? C . n C 1 79 ALA 79 181 ? ? ? C . n C 1 80 GLN 80 182 ? ? ? C . n D 1 1 GLY 1 103 ? ? ? D . n D 1 2 SER 2 104 ? ? ? D . n D 1 3 HIS 3 105 ? ? ? D . n D 1 4 MSE 4 106 ? ? ? D . n D 1 5 GLN 5 107 ? ? ? D . n D 1 6 GLN 6 108 ? ? ? D . n D 1 7 VAL 7 109 ? ? ? D . n D 1 8 ASN 8 110 ? ? ? D . n D 1 9 PRO 9 111 111 PRO PRO D . n D 1 10 ASP 10 112 112 ASP ASP D . n D 1 11 PHE 11 113 113 PHE PHE D . n D 1 12 ILE 12 114 114 ILE ILE D . n D 1 13 GLU 13 115 115 GLU GLU D . n D 1 14 ALA 14 116 116 ALA ALA D . n D 1 15 LEU 15 117 117 LEU LEU D . n D 1 16 THR 16 118 118 THR THR D . n D 1 17 GLU 17 119 119 GLU GLU D . n D 1 18 LYS 18 120 120 LYS LYS D . n D 1 19 ILE 19 121 121 ILE ILE D . n D 1 20 THR 20 122 122 THR THR D . n D 1 21 GLU 21 123 123 GLU GLU D . n D 1 22 GLU 22 124 124 GLU GLU D . n D 1 23 VAL 23 125 125 VAL VAL D . n D 1 24 THR 24 126 126 THR THR D . n D 1 25 ALA 25 127 127 ALA ALA D . n D 1 26 LYS 26 128 128 LYS LYS D . n D 1 27 VAL 27 129 129 VAL VAL D . n D 1 28 THR 28 130 130 THR THR D . n D 1 29 GLU 29 131 131 GLU GLU D . n D 1 30 GLU 30 132 132 GLU GLU D . n D 1 31 LEU 31 133 133 LEU LEU D . n D 1 32 THR 32 134 134 THR THR D . n D 1 33 LYS 33 135 135 LYS LYS D . n D 1 34 GLN 34 136 136 GLN GLN D . n D 1 35 ASN 35 137 137 ASN ASN D . n D 1 36 MSE 36 138 138 MSE MSE D . n D 1 37 GLU 37 139 139 GLU GLU D . n D 1 38 PHE 38 140 140 PHE PHE D . n D 1 39 PHE 39 141 141 PHE PHE D . n D 1 40 ALA 40 142 142 ALA ALA D . n D 1 41 ALA 41 143 143 ALA ALA D . n D 1 42 VAL 42 144 144 VAL VAL D . n D 1 43 ALA 43 145 145 ALA ALA D . n D 1 44 LYS 44 146 146 LYS LYS D . n D 1 45 GLN 45 147 147 GLN GLN D . n D 1 46 SER 46 148 148 SER SER D . n D 1 47 GLN 47 149 149 GLN GLN D . n D 1 48 ASP 48 150 150 ASP ASP D . n D 1 49 ASN 49 151 151 ASN ASN D . n D 1 50 PHE 50 152 152 PHE PHE D . n D 1 51 ASP 51 153 153 ASP ASP D . n D 1 52 ARG 52 154 154 ARG ARG D . n D 1 53 ILE 53 155 155 ILE ILE D . n D 1 54 ASN 54 156 156 ASN ASN D . n D 1 55 LYS 55 157 157 LYS LYS D . n D 1 56 ARG 56 158 158 ARG ARG D . n D 1 57 LEU 57 159 159 LEU LEU D . n D 1 58 GLU 58 160 160 GLU GLU D . n D 1 59 GLU 59 161 161 GLU GLU D . n D 1 60 ARG 60 162 162 ARG ARG D . n D 1 61 ASP 61 163 163 ASP ASP D . n D 1 62 GLU 62 164 164 GLU GLU D . n D 1 63 LYS 63 165 165 LYS LYS D . n D 1 64 LEU 64 166 166 LEU LEU D . n D 1 65 MSE 65 167 167 MSE MSE D . n D 1 66 SER 66 168 168 SER SER D . n D 1 67 THR 67 169 169 THR THR D . n D 1 68 ILE 68 170 170 ILE ILE D . n D 1 69 ARG 69 171 171 ARG ARG D . n D 1 70 LEU 70 172 172 LEU LEU D . n D 1 71 ILE 71 173 173 ILE ILE D . n D 1 72 GLN 72 174 174 GLN GLN D . n D 1 73 GLU 73 175 ? ? ? D . n D 1 74 GLN 74 176 ? ? ? D . n D 1 75 LYS 75 177 ? ? ? D . n D 1 76 SER 76 178 ? ? ? D . n D 1 77 ALA 77 179 ? ? ? D . n D 1 78 ASN 78 180 ? ? ? D . n D 1 79 ALA 79 181 ? ? ? D . n D 1 80 GLN 80 182 ? ? ? D . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id MSE _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id MSE _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code E 2 HOH 1 201 16 HOH HOH A . E 2 HOH 2 202 4 HOH HOH A . E 2 HOH 3 203 13 HOH HOH A . E 2 HOH 4 204 12 HOH HOH A . E 2 HOH 5 205 11 HOH HOH A . F 2 HOH 1 201 3 HOH HOH B . F 2 HOH 2 202 15 HOH HOH B . F 2 HOH 3 203 1 HOH HOH B . F 2 HOH 4 204 14 HOH HOH B . F 2 HOH 5 205 10 HOH HOH B . G 2 HOH 1 201 5 HOH HOH C . G 2 HOH 2 202 7 HOH HOH C . G 2 HOH 3 203 2 HOH HOH C . G 2 HOH 4 204 17 HOH HOH C . G 2 HOH 5 205 6 HOH HOH C . G 2 HOH 6 206 8 HOH HOH C . G 2 HOH 7 207 9 HOH HOH C . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 C ASN 110 ? CG ? C ASN 8 CG 2 1 Y 1 C ASN 110 ? OD1 ? C ASN 8 OD1 3 1 Y 1 C ASN 110 ? ND2 ? C ASN 8 ND2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0258 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? AutoSol ? ? ? . 4 # _cell.angle_alpha 101.97 _cell.angle_alpha_esd ? _cell.angle_beta 94.22 _cell.angle_beta_esd ? _cell.angle_gamma 98.52 _cell.angle_gamma_esd ? _cell.entry_id 7C7Y _cell.details ? _cell.formula_units_Z ? _cell.length_a 27.053 _cell.length_a_esd ? _cell.length_b 40.282 _cell.length_b_esd ? _cell.length_c 80.669 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7C7Y _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7C7Y _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.24 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 45.17 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details PEG400 _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-06-25 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97911 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PHOTON FACTORY BEAMLINE AR-NW12A' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97911 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline AR-NW12A _diffrn_source.pdbx_synchrotron_site 'Photon Factory' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7C7Y _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.6 _reflns.d_resolution_low 30 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9894 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.9 _reflns.pdbx_Rmerge_I_obs 0.064 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 27.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.60 _reflns_shell.d_res_low 2.64 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 485 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.33 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 6.02 _refine.aniso_B[1][2] 0.85 _refine.aniso_B[1][3] -3.65 _refine.aniso_B[2][2] 2.30 _refine.aniso_B[2][3] -2.84 _refine.aniso_B[3][3] -5.76 _refine.B_iso_max ? _refine.B_iso_mean 60.024 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.948 _refine.correlation_coeff_Fo_to_Fc_free 0.909 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7C7Y _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.60 _refine.ls_d_res_low 26.16 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9399 _refine.ls_number_reflns_R_free 466 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.80 _refine.ls_percent_reflns_R_free 4.7 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.22674 _refine.ls_R_factor_R_free 0.27720 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.22430 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 1.077 _refine.pdbx_overall_ESU_R_Free 0.356 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 12.552 _refine.overall_SU_ML 0.257 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.details ? _refine_hist.d_res_high 2.60 _refine_hist.d_res_low 26.16 _refine_hist.number_atoms_solvent 17 _refine_hist.number_atoms_total 2182 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2165 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 0.013 2181 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 2082 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.519 1.670 2920 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.307 1.586 4856 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 4.927 5.000 259 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 39.412 24.203 138 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 19.629 15.000 434 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 19.957 15.000 16 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.060 0.200 307 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 0.020 2384 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 416 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 4.840 5.691 1048 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 4.839 5.690 1047 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 6.901 8.535 1303 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 6.899 8.536 1304 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 7.573 6.925 1133 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 7.562 6.921 1131 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 11.513 9.923 1617 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 12.678 71.584 2516 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 12.676 71.601 2517 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.600 _refine_ls_shell.d_res_low 2.667 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 37 _refine_ls_shell.number_reflns_R_work 700 _refine_ls_shell.percent_reflns_obs 95.96 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.264 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work ? _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7C7Y _struct.title 'C-terminal domain of B. cereus TubY' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7C7Y _struct_keywords.text 'DNA binding protein, DNA segregation' _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 1 ? E N N 2 ? F N N 2 ? G N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q74P26_BACC1 _struct_ref.pdbx_db_accession Q74P26 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code QQVNPDFIEALTEKITEEVTAKVTEELTKQNMEFFAAVAKQSQDNFDRINKRLEERDEKLMSTIRLIQEQKSANAQ _struct_ref.pdbx_align_begin 107 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7C7Y A 5 ? 80 ? Q74P26 107 ? 182 ? 107 182 2 1 7C7Y B 5 ? 80 ? Q74P26 107 ? 182 ? 107 182 3 1 7C7Y C 5 ? 80 ? Q74P26 107 ? 182 ? 107 182 4 1 7C7Y D 5 ? 80 ? Q74P26 107 ? 182 ? 107 182 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7C7Y GLY A 1 ? UNP Q74P26 ? ? 'expression tag' 103 1 1 7C7Y SER A 2 ? UNP Q74P26 ? ? 'expression tag' 104 2 1 7C7Y HIS A 3 ? UNP Q74P26 ? ? 'expression tag' 105 3 1 7C7Y MSE A 4 ? UNP Q74P26 ? ? 'expression tag' 106 4 2 7C7Y GLY B 1 ? UNP Q74P26 ? ? 'expression tag' 103 5 2 7C7Y SER B 2 ? UNP Q74P26 ? ? 'expression tag' 104 6 2 7C7Y HIS B 3 ? UNP Q74P26 ? ? 'expression tag' 105 7 2 7C7Y MSE B 4 ? UNP Q74P26 ? ? 'expression tag' 106 8 3 7C7Y GLY C 1 ? UNP Q74P26 ? ? 'expression tag' 103 9 3 7C7Y SER C 2 ? UNP Q74P26 ? ? 'expression tag' 104 10 3 7C7Y HIS C 3 ? UNP Q74P26 ? ? 'expression tag' 105 11 3 7C7Y MSE C 4 ? UNP Q74P26 ? ? 'expression tag' 106 12 4 7C7Y GLY D 1 ? UNP Q74P26 ? ? 'expression tag' 103 13 4 7C7Y SER D 2 ? UNP Q74P26 ? ? 'expression tag' 104 14 4 7C7Y HIS D 3 ? UNP Q74P26 ? ? 'expression tag' 105 15 4 7C7Y MSE D 4 ? UNP Q74P26 ? ? 'expression tag' 106 16 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 11230 ? 1 MORE -94 ? 1 'SSA (A^2)' 15140 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 8 ? GLU A 73 ? ASN A 110 GLU A 175 1 ? 66 HELX_P HELX_P2 AA2 PRO B 9 ? GLU B 73 ? PRO B 111 GLU B 175 1 ? 65 HELX_P HELX_P3 AA3 PRO C 9 ? GLU C 73 ? PRO C 111 GLU C 175 1 ? 65 HELX_P HELX_P4 AA4 ASP D 10 ? GLN D 72 ? ASP D 112 GLN D 174 1 ? 63 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ASN 35 C ? ? ? 1_555 A MSE 36 N ? ? A ASN 137 A MSE 138 1_555 ? ? ? ? ? ? ? 1.344 ? ? covale2 covale both ? A MSE 36 C ? ? ? 1_555 A GLU 37 N ? ? A MSE 138 A GLU 139 1_555 ? ? ? ? ? ? ? 1.336 ? ? covale3 covale both ? A LEU 64 C ? ? ? 1_555 A MSE 65 N ? ? A LEU 166 A MSE 167 1_555 ? ? ? ? ? ? ? 1.337 ? ? covale4 covale both ? A MSE 65 C ? ? ? 1_555 A SER 66 N ? ? A MSE 167 A SER 168 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale5 covale both ? B ASN 35 C ? ? ? 1_555 B MSE 36 N ? ? B ASN 137 B MSE 138 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale6 covale both ? B MSE 36 C ? ? ? 1_555 B GLU 37 N ? ? B MSE 138 B GLU 139 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale7 covale both ? B LEU 64 C ? ? ? 1_555 B MSE 65 N ? ? B LEU 166 B MSE 167 1_555 ? ? ? ? ? ? ? 1.336 ? ? covale8 covale both ? B MSE 65 C ? ? ? 1_555 B SER 66 N ? ? B MSE 167 B SER 168 1_555 ? ? ? ? ? ? ? 1.341 ? ? covale9 covale both ? C ASN 35 C ? ? ? 1_555 C MSE 36 N ? ? C ASN 137 C MSE 138 1_555 ? ? ? ? ? ? ? 1.342 ? ? covale10 covale both ? C MSE 36 C ? ? ? 1_555 C GLU 37 N ? ? C MSE 138 C GLU 139 1_555 ? ? ? ? ? ? ? 1.339 ? ? covale11 covale both ? C LEU 64 C ? ? ? 1_555 C MSE 65 N ? ? C LEU 166 C MSE 167 1_555 ? ? ? ? ? ? ? 1.336 ? ? covale12 covale both ? C MSE 65 C ? ? ? 1_555 C SER 66 N ? ? C MSE 167 C SER 168 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale13 covale both ? D ASN 35 C ? ? ? 1_555 D MSE 36 N ? ? D ASN 137 D MSE 138 1_555 ? ? ? ? ? ? ? 1.337 ? ? covale14 covale both ? D MSE 36 C ? ? ? 1_555 D GLU 37 N ? ? D MSE 138 D GLU 139 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale15 covale both ? D LEU 64 C ? ? ? 1_555 D MSE 65 N ? ? D LEU 166 D MSE 167 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale16 covale both ? D MSE 65 C ? ? ? 1_555 D SER 66 N ? ? D MSE 167 D SER 168 1_555 ? ? ? ? ? ? ? 1.336 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 MSE A 36 ? . . . . MSE A 138 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 2 MSE A 65 ? . . . . MSE A 167 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 3 MSE B 36 ? . . . . MSE B 138 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 4 MSE B 65 ? . . . . MSE B 167 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 5 MSE C 36 ? . . . . MSE C 138 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 6 MSE C 65 ? . . . . MSE C 167 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 7 MSE D 36 ? . . . . MSE D 138 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 8 MSE D 65 ? . . . . MSE D 167 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' # _pdbx_entry_details.entry_id 7C7Y _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG B 162 ? ? -49.95 -72.21 2 1 GLU C 175 ? ? -64.78 2.56 3 1 THR D 134 ? ? -47.90 -70.34 4 1 THR D 169 ? ? -57.59 -74.53 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 36 A MSE 138 ? MET 'modified residue' 2 A MSE 65 A MSE 167 ? MET 'modified residue' 3 B MSE 36 B MSE 138 ? MET 'modified residue' 4 B MSE 65 B MSE 167 ? MET 'modified residue' 5 C MSE 36 C MSE 138 ? MET 'modified residue' 6 C MSE 65 C MSE 167 ? MET 'modified residue' 7 D MSE 36 D MSE 138 ? MET 'modified residue' 8 D MSE 65 D MSE 167 ? MET 'modified residue' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 103 ? A GLY 1 2 1 Y 1 A SER 104 ? A SER 2 3 1 Y 1 A HIS 105 ? A HIS 3 4 1 Y 1 A MSE 106 ? A MSE 4 5 1 Y 1 A GLN 107 ? A GLN 5 6 1 Y 1 A GLN 108 ? A GLN 6 7 1 Y 1 A VAL 109 ? A VAL 7 8 1 Y 1 A GLN 176 ? A GLN 74 9 1 Y 1 A LYS 177 ? A LYS 75 10 1 Y 1 A SER 178 ? A SER 76 11 1 Y 1 A ALA 179 ? A ALA 77 12 1 Y 1 A ASN 180 ? A ASN 78 13 1 Y 1 A ALA 181 ? A ALA 79 14 1 Y 1 A GLN 182 ? A GLN 80 15 1 Y 1 B GLY 103 ? B GLY 1 16 1 Y 1 B SER 104 ? B SER 2 17 1 Y 1 B HIS 105 ? B HIS 3 18 1 Y 1 B MSE 106 ? B MSE 4 19 1 Y 1 B GLN 107 ? B GLN 5 20 1 Y 1 B GLN 108 ? B GLN 6 21 1 Y 1 B VAL 109 ? B VAL 7 22 1 Y 1 B GLN 176 ? B GLN 74 23 1 Y 1 B LYS 177 ? B LYS 75 24 1 Y 1 B SER 178 ? B SER 76 25 1 Y 1 B ALA 179 ? B ALA 77 26 1 Y 1 B ASN 180 ? B ASN 78 27 1 Y 1 B ALA 181 ? B ALA 79 28 1 Y 1 B GLN 182 ? B GLN 80 29 1 Y 1 C GLY 103 ? C GLY 1 30 1 Y 1 C SER 104 ? C SER 2 31 1 Y 1 C HIS 105 ? C HIS 3 32 1 Y 1 C MSE 106 ? C MSE 4 33 1 Y 1 C GLN 107 ? C GLN 5 34 1 Y 1 C GLN 108 ? C GLN 6 35 1 Y 1 C VAL 109 ? C VAL 7 36 1 Y 1 C LYS 177 ? C LYS 75 37 1 Y 1 C SER 178 ? C SER 76 38 1 Y 1 C ALA 179 ? C ALA 77 39 1 Y 1 C ASN 180 ? C ASN 78 40 1 Y 1 C ALA 181 ? C ALA 79 41 1 Y 1 C GLN 182 ? C GLN 80 42 1 Y 1 D GLY 103 ? D GLY 1 43 1 Y 1 D SER 104 ? D SER 2 44 1 Y 1 D HIS 105 ? D HIS 3 45 1 Y 1 D MSE 106 ? D MSE 4 46 1 Y 1 D GLN 107 ? D GLN 5 47 1 Y 1 D GLN 108 ? D GLN 6 48 1 Y 1 D VAL 109 ? D VAL 7 49 1 Y 1 D ASN 110 ? D ASN 8 50 1 Y 1 D GLU 175 ? D GLU 73 51 1 Y 1 D GLN 176 ? D GLN 74 52 1 Y 1 D LYS 177 ? D LYS 75 53 1 Y 1 D SER 178 ? D SER 76 54 1 Y 1 D ALA 179 ? D ALA 77 55 1 Y 1 D ASN 180 ? D ASN 78 56 1 Y 1 D ALA 181 ? D ALA 79 57 1 Y 1 D GLN 182 ? D GLN 80 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MSE N N N N 216 MSE CA C N S 217 MSE C C N N 218 MSE O O N N 219 MSE OXT O N N 220 MSE CB C N N 221 MSE CG C N N 222 MSE SE SE N N 223 MSE CE C N N 224 MSE H H N N 225 MSE H2 H N N 226 MSE HA H N N 227 MSE HXT H N N 228 MSE HB2 H N N 229 MSE HB3 H N N 230 MSE HG2 H N N 231 MSE HG3 H N N 232 MSE HE1 H N N 233 MSE HE2 H N N 234 MSE HE3 H N N 235 PHE N N N N 236 PHE CA C N S 237 PHE C C N N 238 PHE O O N N 239 PHE CB C N N 240 PHE CG C Y N 241 PHE CD1 C Y N 242 PHE CD2 C Y N 243 PHE CE1 C Y N 244 PHE CE2 C Y N 245 PHE CZ C Y N 246 PHE OXT O N N 247 PHE H H N N 248 PHE H2 H N N 249 PHE HA H N N 250 PHE HB2 H N N 251 PHE HB3 H N N 252 PHE HD1 H N N 253 PHE HD2 H N N 254 PHE HE1 H N N 255 PHE HE2 H N N 256 PHE HZ H N N 257 PHE HXT H N N 258 PRO N N N N 259 PRO CA C N S 260 PRO C C N N 261 PRO O O N N 262 PRO CB C N N 263 PRO CG C N N 264 PRO CD C N N 265 PRO OXT O N N 266 PRO H H N N 267 PRO HA H N N 268 PRO HB2 H N N 269 PRO HB3 H N N 270 PRO HG2 H N N 271 PRO HG3 H N N 272 PRO HD2 H N N 273 PRO HD3 H N N 274 PRO HXT H N N 275 SER N N N N 276 SER CA C N S 277 SER C C N N 278 SER O O N N 279 SER CB C N N 280 SER OG O N N 281 SER OXT O N N 282 SER H H N N 283 SER H2 H N N 284 SER HA H N N 285 SER HB2 H N N 286 SER HB3 H N N 287 SER HG H N N 288 SER HXT H N N 289 THR N N N N 290 THR CA C N S 291 THR C C N N 292 THR O O N N 293 THR CB C N R 294 THR OG1 O N N 295 THR CG2 C N N 296 THR OXT O N N 297 THR H H N N 298 THR H2 H N N 299 THR HA H N N 300 THR HB H N N 301 THR HG1 H N N 302 THR HG21 H N N 303 THR HG22 H N N 304 THR HG23 H N N 305 THR HXT H N N 306 VAL N N N N 307 VAL CA C N S 308 VAL C C N N 309 VAL O O N N 310 VAL CB C N N 311 VAL CG1 C N N 312 VAL CG2 C N N 313 VAL OXT O N N 314 VAL H H N N 315 VAL H2 H N N 316 VAL HA H N N 317 VAL HB H N N 318 VAL HG11 H N N 319 VAL HG12 H N N 320 VAL HG13 H N N 321 VAL HG21 H N N 322 VAL HG22 H N N 323 VAL HG23 H N N 324 VAL HXT H N N 325 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MSE N CA sing N N 205 MSE N H sing N N 206 MSE N H2 sing N N 207 MSE CA C sing N N 208 MSE CA CB sing N N 209 MSE CA HA sing N N 210 MSE C O doub N N 211 MSE C OXT sing N N 212 MSE OXT HXT sing N N 213 MSE CB CG sing N N 214 MSE CB HB2 sing N N 215 MSE CB HB3 sing N N 216 MSE CG SE sing N N 217 MSE CG HG2 sing N N 218 MSE CG HG3 sing N N 219 MSE SE CE sing N N 220 MSE CE HE1 sing N N 221 MSE CE HE2 sing N N 222 MSE CE HE3 sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 THR N CA sing N N 277 THR N H sing N N 278 THR N H2 sing N N 279 THR CA C sing N N 280 THR CA CB sing N N 281 THR CA HA sing N N 282 THR C O doub N N 283 THR C OXT sing N N 284 THR CB OG1 sing N N 285 THR CB CG2 sing N N 286 THR CB HB sing N N 287 THR OG1 HG1 sing N N 288 THR CG2 HG21 sing N N 289 THR CG2 HG22 sing N N 290 THR CG2 HG23 sing N N 291 THR OXT HXT sing N N 292 VAL N CA sing N N 293 VAL N H sing N N 294 VAL N H2 sing N N 295 VAL CA C sing N N 296 VAL CA CB sing N N 297 VAL CA HA sing N N 298 VAL C O doub N N 299 VAL C OXT sing N N 300 VAL CB CG1 sing N N 301 VAL CB CG2 sing N N 302 VAL CB HB sing N N 303 VAL CG1 HG11 sing N N 304 VAL CG1 HG12 sing N N 305 VAL CG1 HG13 sing N N 306 VAL CG2 HG21 sing N N 307 VAL CG2 HG22 sing N N 308 VAL CG2 HG23 sing N N 309 VAL OXT HXT sing N N 310 # _pdbx_audit_support.funding_organization 'Japan Society for the Promotion of Science (JSPS)' _pdbx_audit_support.country Japan _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _atom_sites.entry_id 7C7Y _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.036964 _atom_sites.fract_transf_matrix[1][2] 0.005538 _atom_sites.fract_transf_matrix[1][3] 0.004055 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.025102 _atom_sites.fract_transf_matrix[2][3] 0.005699 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012746 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O SE # loop_ #