data_7CAY # _entry.id 7CAY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7CAY pdb_00007cay 10.2210/pdb7cay/pdb WWPDB D_1300017236 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7CAY _pdbx_database_status.recvd_initial_deposition_date 2020-06-10 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Singh, R.' 1 0000-0003-4871-3600 'Sharma, B.' 2 ? 'Deshmukh, S.' 3 ? 'Kumar, A.' 4 0000-0002-7526-1569 'Makde, R.D.' 5 0000-0001-7020-0065 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acta Crystallogr.,Sect.F' _citation.journal_id_ASTM ACSFEN _citation.journal_id_CSD ? _citation.journal_id_ISSN 2053-230X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 76 _citation.language ? _citation.page_first 488 _citation.page_last 494 _citation.title 'Crystal structure of XCC3289 from Xanthomonas campestris: homology with the N-terminal substrate-binding domain of Lon peptidase.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1107/S2053230X20011875 _citation.pdbx_database_id_PubMed 33006577 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Singh, R.' 1 ? primary 'Deshmukh, S.' 2 ? primary 'Kumar, A.' 3 ? primary 'Goyal, V.D.' 4 ? primary 'Makde, R.D.' 5 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7CAY _cell.details ? _cell.formula_units_Z ? _cell.length_a 124.925 _cell.length_a_esd ? _cell.length_b 124.925 _cell.length_b_esd ? _cell.length_c 55.586 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7CAY _symmetry.cell_setting ? _symmetry.Int_Tables_number 97 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 4 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'ATP-dependent protease' _entity.formula_weight 21318.295 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MPAEITSLPLFPLHSVLLPGATIGLRVFERRYLDLVRDCGRTGSSFGVCLILDGSDVGAPAVPAAYGTEVRIEDFDVGND GVLVLRLRGTRRFRVQRSRVRDNGLVVGEVSWCEPDSDDELRPEHGLLATVLERMLEQVGGEFASAGPGLLDQAAWVGWR LAELLPLSEGQRLSLLQEDDPHRRLEQLLAWMP ; _entity_poly.pdbx_seq_one_letter_code_can ;MPAEITSLPLFPLHSVLLPGATIGLRVFERRYLDLVRDCGRTGSSFGVCLILDGSDVGAPAVPAAYGTEVRIEDFDVGND GVLVLRLRGTRRFRVQRSRVRDNGLVVGEVSWCEPDSDDELRPEHGLLATVLERMLEQVGGEFASAGPGLLDQAAWVGWR LAELLPLSEGQRLSLLQEDDPHRRLEQLLAWMP ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 PRO n 1 3 ALA n 1 4 GLU n 1 5 ILE n 1 6 THR n 1 7 SER n 1 8 LEU n 1 9 PRO n 1 10 LEU n 1 11 PHE n 1 12 PRO n 1 13 LEU n 1 14 HIS n 1 15 SER n 1 16 VAL n 1 17 LEU n 1 18 LEU n 1 19 PRO n 1 20 GLY n 1 21 ALA n 1 22 THR n 1 23 ILE n 1 24 GLY n 1 25 LEU n 1 26 ARG n 1 27 VAL n 1 28 PHE n 1 29 GLU n 1 30 ARG n 1 31 ARG n 1 32 TYR n 1 33 LEU n 1 34 ASP n 1 35 LEU n 1 36 VAL n 1 37 ARG n 1 38 ASP n 1 39 CYS n 1 40 GLY n 1 41 ARG n 1 42 THR n 1 43 GLY n 1 44 SER n 1 45 SER n 1 46 PHE n 1 47 GLY n 1 48 VAL n 1 49 CYS n 1 50 LEU n 1 51 ILE n 1 52 LEU n 1 53 ASP n 1 54 GLY n 1 55 SER n 1 56 ASP n 1 57 VAL n 1 58 GLY n 1 59 ALA n 1 60 PRO n 1 61 ALA n 1 62 VAL n 1 63 PRO n 1 64 ALA n 1 65 ALA n 1 66 TYR n 1 67 GLY n 1 68 THR n 1 69 GLU n 1 70 VAL n 1 71 ARG n 1 72 ILE n 1 73 GLU n 1 74 ASP n 1 75 PHE n 1 76 ASP n 1 77 VAL n 1 78 GLY n 1 79 ASN n 1 80 ASP n 1 81 GLY n 1 82 VAL n 1 83 LEU n 1 84 VAL n 1 85 LEU n 1 86 ARG n 1 87 LEU n 1 88 ARG n 1 89 GLY n 1 90 THR n 1 91 ARG n 1 92 ARG n 1 93 PHE n 1 94 ARG n 1 95 VAL n 1 96 GLN n 1 97 ARG n 1 98 SER n 1 99 ARG n 1 100 VAL n 1 101 ARG n 1 102 ASP n 1 103 ASN n 1 104 GLY n 1 105 LEU n 1 106 VAL n 1 107 VAL n 1 108 GLY n 1 109 GLU n 1 110 VAL n 1 111 SER n 1 112 TRP n 1 113 CYS n 1 114 GLU n 1 115 PRO n 1 116 ASP n 1 117 SER n 1 118 ASP n 1 119 ASP n 1 120 GLU n 1 121 LEU n 1 122 ARG n 1 123 PRO n 1 124 GLU n 1 125 HIS n 1 126 GLY n 1 127 LEU n 1 128 LEU n 1 129 ALA n 1 130 THR n 1 131 VAL n 1 132 LEU n 1 133 GLU n 1 134 ARG n 1 135 MET n 1 136 LEU n 1 137 GLU n 1 138 GLN n 1 139 VAL n 1 140 GLY n 1 141 GLY n 1 142 GLU n 1 143 PHE n 1 144 ALA n 1 145 SER n 1 146 ALA n 1 147 GLY n 1 148 PRO n 1 149 GLY n 1 150 LEU n 1 151 LEU n 1 152 ASP n 1 153 GLN n 1 154 ALA n 1 155 ALA n 1 156 TRP n 1 157 VAL n 1 158 GLY n 1 159 TRP n 1 160 ARG n 1 161 LEU n 1 162 ALA n 1 163 GLU n 1 164 LEU n 1 165 LEU n 1 166 PRO n 1 167 LEU n 1 168 SER n 1 169 GLU n 1 170 GLY n 1 171 GLN n 1 172 ARG n 1 173 LEU n 1 174 SER n 1 175 LEU n 1 176 LEU n 1 177 GLN n 1 178 GLU n 1 179 ASP n 1 180 ASP n 1 181 PRO n 1 182 HIS n 1 183 ARG n 1 184 ARG n 1 185 LEU n 1 186 GLU n 1 187 GLN n 1 188 LEU n 1 189 LEU n 1 190 ALA n 1 191 TRP n 1 192 MET n 1 193 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 193 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene D0A42_17175 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Xanthomonas campestris pv. campestris' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 340 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc 33913 _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant pLysS _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pST50Tr _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A3E1KP83_XANCE _struct_ref.pdbx_db_accession A0A3E1KP83 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MPAEITSLPLFPLHSVLLPGATIGLRVFERRYLDLVRDCGRTGSSFGVCLILDGSDVGAPAVPAAYGTEVRIEDFDVGND GVLVLRLRGTRRFRVQRSRVRDNGLVVGEVSWCEPDSDDELRPEHGLLATVLERMLEQVGGEFASAGPGLLDQAAWVGWR LAELLPLSEGQRLSLLQEDDPHRRLEQLLAWMP ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7CAY _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 193 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A3E1KP83 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 193 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 193 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7CAY _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.54 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 51.64 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method MICROBATCH _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'Isopropanol 35%, 200mM ammonium acetate, 100 mM Tris-Cl, pH 8.5' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details mirror _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RAYONIX MX-225' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-03-07 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator Si111 _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97949 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'RRCAT INDUS-2 BEAMLINE PX-BL21' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97949 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline PX-BL21 _diffrn_source.pdbx_synchrotron_site 'RRCAT INDUS-2' # _reflns.B_iso_Wilson_estimate 74.200 _reflns.entry_id 7CAY _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.800 _reflns.d_resolution_low 44.170 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 5595 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 8.200 _reflns.pdbx_Rmerge_I_obs 0.076 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 19.900 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects 1 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.081 _reflns.pdbx_Rpim_I_all 0.028 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 46030 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 2.800 2.950 ? ? 6711 ? ? ? 795 99.600 ? ? ? ? 0.905 ? ? ? ? ? ? ? ? 8.400 ? ? ? 2.300 0.963 0.325 ? 1 1 0.859 ? ? 8.850 44.170 ? ? 1426 ? ? ? 201 95.600 ? ? ? ? 0.026 ? ? ? ? ? ? ? ? 7.100 ? ? ? 57.100 0.028 0.010 ? 2 1 0.999 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 104.630 _refine.B_iso_mean 71.1476 _refine.B_iso_min 48.990 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7CAY _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.8000 _refine.ls_d_res_low 33.3270 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 5588 _refine.ls_number_reflns_R_free 320 _refine.ls_number_reflns_R_work 5268 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.4800 _refine.ls_percent_reflns_R_free 5.7300 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2634 _refine.ls_R_factor_R_free 0.2876 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2618 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1zbo _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 33.0800 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2600 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.8000 _refine_hist.d_res_low 33.3270 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1262 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 169 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1262 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.002 ? 1285 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.569 ? 1751 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.038 ? 207 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 226 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 16.076 ? 759 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.8001 3.5272 . . 160 2576 99.0000 . . . 0.3495 0.0000 0.3270 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.5272 33.3 . . 160 2692 98.0000 . . . 0.2709 0.0000 0.2417 . . . . . . . . . . . # _struct.entry_id 7CAY _struct.title 'Crystal Structure of Lon N-terminal domain protein from Xanthomonas campestris' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7CAY _struct_keywords.text 'N-terminal domain, Lon protease, PROTEIN BINDING' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 29 ? GLY A 43 ? GLU A 29 GLY A 43 1 ? 15 HELX_P HELX_P2 AA2 ARG A 122 ? GLU A 124 ? ARG A 122 GLU A 124 5 ? 3 HELX_P HELX_P3 AA3 HIS A 125 ? MET A 135 ? HIS A 125 MET A 135 1 ? 11 HELX_P HELX_P4 AA4 GLN A 153 ? LEU A 165 ? GLN A 153 LEU A 165 1 ? 13 HELX_P HELX_P5 AA5 SER A 168 ? GLU A 178 ? SER A 168 GLU A 178 1 ? 11 HELX_P HELX_P6 AA6 ASP A 180 ? TRP A 191 ? ASP A 180 TRP A 191 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 22 ? VAL A 27 ? THR A 22 VAL A 27 AA1 2 LEU A 83 ? VAL A 100 ? LEU A 83 VAL A 100 AA1 3 VAL A 106 ? TRP A 112 ? VAL A 106 TRP A 112 AA1 4 THR A 6 ? LEU A 13 ? THR A 6 LEU A 13 AA1 5 GLY A 47 ? LEU A 50 ? GLY A 47 LEU A 50 AA1 6 TYR A 66 ? ASP A 74 ? TYR A 66 ASP A 74 AA1 7 LEU A 83 ? VAL A 100 ? LEU A 83 VAL A 100 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 23 ? N ILE A 23 O LEU A 87 ? O LEU A 87 AA1 2 3 N ARG A 99 ? N ARG A 99 O VAL A 107 ? O VAL A 107 AA1 3 4 O VAL A 110 ? O VAL A 110 N THR A 6 ? N THR A 6 AA1 4 5 N PHE A 11 ? N PHE A 11 O GLY A 47 ? O GLY A 47 AA1 5 6 N VAL A 48 ? N VAL A 48 O THR A 68 ? O THR A 68 AA1 6 7 N GLU A 69 ? N GLU A 69 O ARG A 91 ? O ARG A 91 # _atom_sites.entry_id 7CAY _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.008005 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008005 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017990 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 PRO 2 2 ? ? ? A . n A 1 3 ALA 3 3 ? ? ? A . n A 1 4 GLU 4 4 ? ? ? A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 HIS 14 14 14 HIS HIS A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 SER 55 55 ? ? ? A . n A 1 56 ASP 56 56 ? ? ? A . n A 1 57 VAL 57 57 ? ? ? A . n A 1 58 GLY 58 58 ? ? ? A . n A 1 59 ALA 59 59 ? ? ? A . n A 1 60 PRO 60 60 ? ? ? A . n A 1 61 ALA 61 61 ? ? ? A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 TYR 66 66 66 TYR TYR A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 ARG 88 88 88 ARG ARG A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 ARG 92 92 92 ARG ARG A . n A 1 93 PHE 93 93 93 PHE PHE A . n A 1 94 ARG 94 94 94 ARG ARG A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 GLN 96 96 96 GLN GLN A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 SER 98 98 98 SER SER A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 ARG 101 101 101 ARG ARG A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 ASN 103 103 103 ASN ASN A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 SER 111 111 111 SER SER A . n A 1 112 TRP 112 112 112 TRP TRP A . n A 1 113 CYS 113 113 113 CYS CYS A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 PRO 115 115 115 PRO PRO A . n A 1 116 ASP 116 116 116 ASP ASP A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 ASP 118 118 118 ASP ASP A . n A 1 119 ASP 119 119 119 ASP ASP A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 ARG 122 122 122 ARG ARG A . n A 1 123 PRO 123 123 123 PRO PRO A . n A 1 124 GLU 124 124 124 GLU GLU A . n A 1 125 HIS 125 125 125 HIS HIS A . n A 1 126 GLY 126 126 126 GLY GLY A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 THR 130 130 130 THR THR A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 GLU 133 133 133 GLU GLU A . n A 1 134 ARG 134 134 134 ARG ARG A . n A 1 135 MET 135 135 135 MET MET A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 GLU 137 137 ? ? ? A . n A 1 138 GLN 138 138 ? ? ? A . n A 1 139 VAL 139 139 ? ? ? A . n A 1 140 GLY 140 140 ? ? ? A . n A 1 141 GLY 141 141 ? ? ? A . n A 1 142 GLU 142 142 ? ? ? A . n A 1 143 PHE 143 143 ? ? ? A . n A 1 144 ALA 144 144 ? ? ? A . n A 1 145 SER 145 145 ? ? ? A . n A 1 146 ALA 146 146 ? ? ? A . n A 1 147 GLY 147 147 ? ? ? A . n A 1 148 PRO 148 148 ? ? ? A . n A 1 149 GLY 149 149 ? ? ? A . n A 1 150 LEU 150 150 150 LEU LEU A . n A 1 151 LEU 151 151 151 LEU LEU A . n A 1 152 ASP 152 152 152 ASP ASP A . n A 1 153 GLN 153 153 153 GLN GLN A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 ALA 155 155 155 ALA ALA A . n A 1 156 TRP 156 156 156 TRP TRP A . n A 1 157 VAL 157 157 157 VAL VAL A . n A 1 158 GLY 158 158 158 GLY GLY A . n A 1 159 TRP 159 159 159 TRP TRP A . n A 1 160 ARG 160 160 160 ARG ARG A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 ALA 162 162 162 ALA ALA A . n A 1 163 GLU 163 163 163 GLU GLU A . n A 1 164 LEU 164 164 164 LEU LEU A . n A 1 165 LEU 165 165 165 LEU LEU A . n A 1 166 PRO 166 166 166 PRO PRO A . n A 1 167 LEU 167 167 167 LEU LEU A . n A 1 168 SER 168 168 168 SER SER A . n A 1 169 GLU 169 169 169 GLU GLU A . n A 1 170 GLY 170 170 170 GLY GLY A . n A 1 171 GLN 171 171 171 GLN GLN A . n A 1 172 ARG 172 172 172 ARG ARG A . n A 1 173 LEU 173 173 173 LEU LEU A . n A 1 174 SER 174 174 174 SER SER A . n A 1 175 LEU 175 175 175 LEU LEU A . n A 1 176 LEU 176 176 176 LEU LEU A . n A 1 177 GLN 177 177 177 GLN GLN A . n A 1 178 GLU 178 178 178 GLU GLU A . n A 1 179 ASP 179 179 179 ASP ASP A . n A 1 180 ASP 180 180 180 ASP ASP A . n A 1 181 PRO 181 181 181 PRO PRO A . n A 1 182 HIS 182 182 182 HIS HIS A . n A 1 183 ARG 183 183 183 ARG ARG A . n A 1 184 ARG 184 184 184 ARG ARG A . n A 1 185 LEU 185 185 185 LEU LEU A . n A 1 186 GLU 186 186 186 GLU GLU A . n A 1 187 GLN 187 187 187 GLN GLN A . n A 1 188 LEU 188 188 188 LEU LEU A . n A 1 189 LEU 189 189 189 LEU LEU A . n A 1 190 ALA 190 190 190 ALA ALA A . n A 1 191 TRP 191 191 191 TRP TRP A . n A 1 192 MET 192 192 192 MET MET A . n A 1 193 PRO 193 193 193 PRO PRO A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-10-14 2 'Structure model' 1 1 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -30.9683 _pdbx_refine_tls.origin_y 11.2254 _pdbx_refine_tls.origin_z -6.3041 _pdbx_refine_tls.T[1][1] 0.3464 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] 0.1149 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.0860 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.4730 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] -0.0766 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.4200 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 2.6554 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -0.1753 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] -1.4969 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 2.1053 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] -0.5906 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 3.8025 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.0347 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] 0.0080 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] 0.1722 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] 0.0207 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.0103 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.3566 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.3183 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.6616 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] -0.0157 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 5 _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 193 _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.7.4 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.12_2829 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 52 ? ? -151.26 45.92 2 1 ASP A 53 ? ? -94.26 42.12 3 1 ASP A 76 ? ? -167.35 118.59 4 1 THR A 90 ? ? -109.10 -105.99 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ILE 5 ? CG1 ? A ILE 5 CG1 2 1 Y 1 A ILE 5 ? CG2 ? A ILE 5 CG2 3 1 Y 1 A ILE 5 ? CD1 ? A ILE 5 CD1 4 1 Y 1 A SER 7 ? OG ? A SER 7 OG 5 1 Y 1 A ARG 30 ? CG ? A ARG 30 CG 6 1 Y 1 A ARG 30 ? CD ? A ARG 30 CD 7 1 Y 1 A ARG 30 ? NE ? A ARG 30 NE 8 1 Y 1 A ARG 30 ? CZ ? A ARG 30 CZ 9 1 Y 1 A ARG 30 ? NH1 ? A ARG 30 NH1 10 1 Y 1 A ARG 30 ? NH2 ? A ARG 30 NH2 11 1 Y 1 A ASP 34 ? CG ? A ASP 34 CG 12 1 Y 1 A ASP 34 ? OD1 ? A ASP 34 OD1 13 1 Y 1 A ASP 34 ? OD2 ? A ASP 34 OD2 14 1 Y 1 A ARG 37 ? CG ? A ARG 37 CG 15 1 Y 1 A ARG 37 ? CD ? A ARG 37 CD 16 1 Y 1 A ARG 37 ? NE ? A ARG 37 NE 17 1 Y 1 A ARG 37 ? CZ ? A ARG 37 CZ 18 1 Y 1 A ARG 37 ? NH1 ? A ARG 37 NH1 19 1 Y 1 A ARG 37 ? NH2 ? A ARG 37 NH2 20 1 Y 1 A ASP 38 ? CG ? A ASP 38 CG 21 1 Y 1 A ASP 38 ? OD1 ? A ASP 38 OD1 22 1 Y 1 A ASP 38 ? OD2 ? A ASP 38 OD2 23 1 Y 1 A ARG 41 ? CG ? A ARG 41 CG 24 1 Y 1 A ARG 41 ? CD ? A ARG 41 CD 25 1 Y 1 A ARG 41 ? NE ? A ARG 41 NE 26 1 Y 1 A ARG 41 ? CZ ? A ARG 41 CZ 27 1 Y 1 A ARG 41 ? NH1 ? A ARG 41 NH1 28 1 Y 1 A ARG 41 ? NH2 ? A ARG 41 NH2 29 1 Y 1 A ASP 53 ? CG ? A ASP 53 CG 30 1 Y 1 A ASP 53 ? OD1 ? A ASP 53 OD1 31 1 Y 1 A ASP 53 ? OD2 ? A ASP 53 OD2 32 1 Y 1 A LEU 83 ? CG ? A LEU 83 CG 33 1 Y 1 A LEU 83 ? CD1 ? A LEU 83 CD1 34 1 Y 1 A LEU 83 ? CD2 ? A LEU 83 CD2 35 1 Y 1 A ARG 86 ? CG ? A ARG 86 CG 36 1 Y 1 A ARG 86 ? CD ? A ARG 86 CD 37 1 Y 1 A ARG 86 ? NE ? A ARG 86 NE 38 1 Y 1 A ARG 86 ? CZ ? A ARG 86 CZ 39 1 Y 1 A ARG 86 ? NH1 ? A ARG 86 NH1 40 1 Y 1 A ARG 86 ? NH2 ? A ARG 86 NH2 41 1 Y 1 A ARG 99 ? CG ? A ARG 99 CG 42 1 Y 1 A ARG 99 ? CD ? A ARG 99 CD 43 1 Y 1 A ARG 99 ? NE ? A ARG 99 NE 44 1 Y 1 A ARG 99 ? CZ ? A ARG 99 CZ 45 1 Y 1 A ARG 99 ? NH1 ? A ARG 99 NH1 46 1 Y 1 A ARG 99 ? NH2 ? A ARG 99 NH2 47 1 Y 1 A ASP 102 ? CG ? A ASP 102 CG 48 1 Y 1 A ASP 102 ? OD1 ? A ASP 102 OD1 49 1 Y 1 A ASP 102 ? OD2 ? A ASP 102 OD2 50 1 Y 1 A LEU 105 ? CG ? A LEU 105 CG 51 1 Y 1 A LEU 105 ? CD1 ? A LEU 105 CD1 52 1 Y 1 A LEU 105 ? CD2 ? A LEU 105 CD2 53 1 Y 1 A GLU 114 ? CG ? A GLU 114 CG 54 1 Y 1 A GLU 114 ? CD ? A GLU 114 CD 55 1 Y 1 A GLU 114 ? OE1 ? A GLU 114 OE1 56 1 Y 1 A GLU 114 ? OE2 ? A GLU 114 OE2 57 1 Y 1 A GLU 120 ? CG ? A GLU 120 CG 58 1 Y 1 A GLU 120 ? CD ? A GLU 120 CD 59 1 Y 1 A GLU 120 ? OE1 ? A GLU 120 OE1 60 1 Y 1 A GLU 120 ? OE2 ? A GLU 120 OE2 61 1 Y 1 A PRO 123 ? CG ? A PRO 123 CG 62 1 Y 1 A PRO 123 ? CD ? A PRO 123 CD 63 1 Y 1 A LEU 128 ? CG ? A LEU 128 CG 64 1 Y 1 A LEU 128 ? CD1 ? A LEU 128 CD1 65 1 Y 1 A LEU 128 ? CD2 ? A LEU 128 CD2 66 1 Y 1 A ARG 134 ? CG ? A ARG 134 CG 67 1 Y 1 A ARG 134 ? CD ? A ARG 134 CD 68 1 Y 1 A ARG 134 ? NE ? A ARG 134 NE 69 1 Y 1 A ARG 134 ? CZ ? A ARG 134 CZ 70 1 Y 1 A ARG 134 ? NH1 ? A ARG 134 NH1 71 1 Y 1 A ARG 134 ? NH2 ? A ARG 134 NH2 72 1 Y 1 A ASP 152 ? CG ? A ASP 152 CG 73 1 Y 1 A ASP 152 ? OD1 ? A ASP 152 OD1 74 1 Y 1 A ASP 152 ? OD2 ? A ASP 152 OD2 75 1 Y 1 A GLN 153 ? CG ? A GLN 153 CG 76 1 Y 1 A GLN 153 ? CD ? A GLN 153 CD 77 1 Y 1 A GLN 153 ? OE1 ? A GLN 153 OE1 78 1 Y 1 A GLN 153 ? NE2 ? A GLN 153 NE2 79 1 Y 1 A GLN 177 ? CG ? A GLN 177 CG 80 1 Y 1 A GLN 177 ? CD ? A GLN 177 CD 81 1 Y 1 A GLN 177 ? OE1 ? A GLN 177 OE1 82 1 Y 1 A GLN 177 ? NE2 ? A GLN 177 NE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A PRO 2 ? A PRO 2 3 1 Y 1 A ALA 3 ? A ALA 3 4 1 Y 1 A GLU 4 ? A GLU 4 5 1 Y 1 A SER 55 ? A SER 55 6 1 Y 1 A ASP 56 ? A ASP 56 7 1 Y 1 A VAL 57 ? A VAL 57 8 1 Y 1 A GLY 58 ? A GLY 58 9 1 Y 1 A ALA 59 ? A ALA 59 10 1 Y 1 A PRO 60 ? A PRO 60 11 1 Y 1 A ALA 61 ? A ALA 61 12 1 Y 1 A GLU 137 ? A GLU 137 13 1 Y 1 A GLN 138 ? A GLN 138 14 1 Y 1 A VAL 139 ? A VAL 139 15 1 Y 1 A GLY 140 ? A GLY 140 16 1 Y 1 A GLY 141 ? A GLY 141 17 1 Y 1 A GLU 142 ? A GLU 142 18 1 Y 1 A PHE 143 ? A PHE 143 19 1 Y 1 A ALA 144 ? A ALA 144 20 1 Y 1 A SER 145 ? A SER 145 21 1 Y 1 A ALA 146 ? A ALA 146 22 1 Y 1 A GLY 147 ? A GLY 147 23 1 Y 1 A PRO 148 ? A PRO 148 24 1 Y 1 A GLY 149 ? A GLY 149 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 MET N N N N 202 MET CA C N S 203 MET C C N N 204 MET O O N N 205 MET CB C N N 206 MET CG C N N 207 MET SD S N N 208 MET CE C N N 209 MET OXT O N N 210 MET H H N N 211 MET H2 H N N 212 MET HA H N N 213 MET HB2 H N N 214 MET HB3 H N N 215 MET HG2 H N N 216 MET HG3 H N N 217 MET HE1 H N N 218 MET HE2 H N N 219 MET HE3 H N N 220 MET HXT H N N 221 PHE N N N N 222 PHE CA C N S 223 PHE C C N N 224 PHE O O N N 225 PHE CB C N N 226 PHE CG C Y N 227 PHE CD1 C Y N 228 PHE CD2 C Y N 229 PHE CE1 C Y N 230 PHE CE2 C Y N 231 PHE CZ C Y N 232 PHE OXT O N N 233 PHE H H N N 234 PHE H2 H N N 235 PHE HA H N N 236 PHE HB2 H N N 237 PHE HB3 H N N 238 PHE HD1 H N N 239 PHE HD2 H N N 240 PHE HE1 H N N 241 PHE HE2 H N N 242 PHE HZ H N N 243 PHE HXT H N N 244 PRO N N N N 245 PRO CA C N S 246 PRO C C N N 247 PRO O O N N 248 PRO CB C N N 249 PRO CG C N N 250 PRO CD C N N 251 PRO OXT O N N 252 PRO H H N N 253 PRO HA H N N 254 PRO HB2 H N N 255 PRO HB3 H N N 256 PRO HG2 H N N 257 PRO HG3 H N N 258 PRO HD2 H N N 259 PRO HD3 H N N 260 PRO HXT H N N 261 SER N N N N 262 SER CA C N S 263 SER C C N N 264 SER O O N N 265 SER CB C N N 266 SER OG O N N 267 SER OXT O N N 268 SER H H N N 269 SER H2 H N N 270 SER HA H N N 271 SER HB2 H N N 272 SER HB3 H N N 273 SER HG H N N 274 SER HXT H N N 275 THR N N N N 276 THR CA C N S 277 THR C C N N 278 THR O O N N 279 THR CB C N R 280 THR OG1 O N N 281 THR CG2 C N N 282 THR OXT O N N 283 THR H H N N 284 THR H2 H N N 285 THR HA H N N 286 THR HB H N N 287 THR HG1 H N N 288 THR HG21 H N N 289 THR HG22 H N N 290 THR HG23 H N N 291 THR HXT H N N 292 TRP N N N N 293 TRP CA C N S 294 TRP C C N N 295 TRP O O N N 296 TRP CB C N N 297 TRP CG C Y N 298 TRP CD1 C Y N 299 TRP CD2 C Y N 300 TRP NE1 N Y N 301 TRP CE2 C Y N 302 TRP CE3 C Y N 303 TRP CZ2 C Y N 304 TRP CZ3 C Y N 305 TRP CH2 C Y N 306 TRP OXT O N N 307 TRP H H N N 308 TRP H2 H N N 309 TRP HA H N N 310 TRP HB2 H N N 311 TRP HB3 H N N 312 TRP HD1 H N N 313 TRP HE1 H N N 314 TRP HE3 H N N 315 TRP HZ2 H N N 316 TRP HZ3 H N N 317 TRP HH2 H N N 318 TRP HXT H N N 319 TYR N N N N 320 TYR CA C N S 321 TYR C C N N 322 TYR O O N N 323 TYR CB C N N 324 TYR CG C Y N 325 TYR CD1 C Y N 326 TYR CD2 C Y N 327 TYR CE1 C Y N 328 TYR CE2 C Y N 329 TYR CZ C Y N 330 TYR OH O N N 331 TYR OXT O N N 332 TYR H H N N 333 TYR H2 H N N 334 TYR HA H N N 335 TYR HB2 H N N 336 TYR HB3 H N N 337 TYR HD1 H N N 338 TYR HD2 H N N 339 TYR HE1 H N N 340 TYR HE2 H N N 341 TYR HH H N N 342 TYR HXT H N N 343 VAL N N N N 344 VAL CA C N S 345 VAL C C N N 346 VAL O O N N 347 VAL CB C N N 348 VAL CG1 C N N 349 VAL CG2 C N N 350 VAL OXT O N N 351 VAL H H N N 352 VAL H2 H N N 353 VAL HA H N N 354 VAL HB H N N 355 VAL HG11 H N N 356 VAL HG12 H N N 357 VAL HG13 H N N 358 VAL HG21 H N N 359 VAL HG22 H N N 360 VAL HG23 H N N 361 VAL HXT H N N 362 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 MET N CA sing N N 192 MET N H sing N N 193 MET N H2 sing N N 194 MET CA C sing N N 195 MET CA CB sing N N 196 MET CA HA sing N N 197 MET C O doub N N 198 MET C OXT sing N N 199 MET CB CG sing N N 200 MET CB HB2 sing N N 201 MET CB HB3 sing N N 202 MET CG SD sing N N 203 MET CG HG2 sing N N 204 MET CG HG3 sing N N 205 MET SD CE sing N N 206 MET CE HE1 sing N N 207 MET CE HE2 sing N N 208 MET CE HE3 sing N N 209 MET OXT HXT sing N N 210 PHE N CA sing N N 211 PHE N H sing N N 212 PHE N H2 sing N N 213 PHE CA C sing N N 214 PHE CA CB sing N N 215 PHE CA HA sing N N 216 PHE C O doub N N 217 PHE C OXT sing N N 218 PHE CB CG sing N N 219 PHE CB HB2 sing N N 220 PHE CB HB3 sing N N 221 PHE CG CD1 doub Y N 222 PHE CG CD2 sing Y N 223 PHE CD1 CE1 sing Y N 224 PHE CD1 HD1 sing N N 225 PHE CD2 CE2 doub Y N 226 PHE CD2 HD2 sing N N 227 PHE CE1 CZ doub Y N 228 PHE CE1 HE1 sing N N 229 PHE CE2 CZ sing Y N 230 PHE CE2 HE2 sing N N 231 PHE CZ HZ sing N N 232 PHE OXT HXT sing N N 233 PRO N CA sing N N 234 PRO N CD sing N N 235 PRO N H sing N N 236 PRO CA C sing N N 237 PRO CA CB sing N N 238 PRO CA HA sing N N 239 PRO C O doub N N 240 PRO C OXT sing N N 241 PRO CB CG sing N N 242 PRO CB HB2 sing N N 243 PRO CB HB3 sing N N 244 PRO CG CD sing N N 245 PRO CG HG2 sing N N 246 PRO CG HG3 sing N N 247 PRO CD HD2 sing N N 248 PRO CD HD3 sing N N 249 PRO OXT HXT sing N N 250 SER N CA sing N N 251 SER N H sing N N 252 SER N H2 sing N N 253 SER CA C sing N N 254 SER CA CB sing N N 255 SER CA HA sing N N 256 SER C O doub N N 257 SER C OXT sing N N 258 SER CB OG sing N N 259 SER CB HB2 sing N N 260 SER CB HB3 sing N N 261 SER OG HG sing N N 262 SER OXT HXT sing N N 263 THR N CA sing N N 264 THR N H sing N N 265 THR N H2 sing N N 266 THR CA C sing N N 267 THR CA CB sing N N 268 THR CA HA sing N N 269 THR C O doub N N 270 THR C OXT sing N N 271 THR CB OG1 sing N N 272 THR CB CG2 sing N N 273 THR CB HB sing N N 274 THR OG1 HG1 sing N N 275 THR CG2 HG21 sing N N 276 THR CG2 HG22 sing N N 277 THR CG2 HG23 sing N N 278 THR OXT HXT sing N N 279 TRP N CA sing N N 280 TRP N H sing N N 281 TRP N H2 sing N N 282 TRP CA C sing N N 283 TRP CA CB sing N N 284 TRP CA HA sing N N 285 TRP C O doub N N 286 TRP C OXT sing N N 287 TRP CB CG sing N N 288 TRP CB HB2 sing N N 289 TRP CB HB3 sing N N 290 TRP CG CD1 doub Y N 291 TRP CG CD2 sing Y N 292 TRP CD1 NE1 sing Y N 293 TRP CD1 HD1 sing N N 294 TRP CD2 CE2 doub Y N 295 TRP CD2 CE3 sing Y N 296 TRP NE1 CE2 sing Y N 297 TRP NE1 HE1 sing N N 298 TRP CE2 CZ2 sing Y N 299 TRP CE3 CZ3 doub Y N 300 TRP CE3 HE3 sing N N 301 TRP CZ2 CH2 doub Y N 302 TRP CZ2 HZ2 sing N N 303 TRP CZ3 CH2 sing Y N 304 TRP CZ3 HZ3 sing N N 305 TRP CH2 HH2 sing N N 306 TRP OXT HXT sing N N 307 TYR N CA sing N N 308 TYR N H sing N N 309 TYR N H2 sing N N 310 TYR CA C sing N N 311 TYR CA CB sing N N 312 TYR CA HA sing N N 313 TYR C O doub N N 314 TYR C OXT sing N N 315 TYR CB CG sing N N 316 TYR CB HB2 sing N N 317 TYR CB HB3 sing N N 318 TYR CG CD1 doub Y N 319 TYR CG CD2 sing Y N 320 TYR CD1 CE1 sing Y N 321 TYR CD1 HD1 sing N N 322 TYR CD2 CE2 doub Y N 323 TYR CD2 HD2 sing N N 324 TYR CE1 CZ doub Y N 325 TYR CE1 HE1 sing N N 326 TYR CE2 CZ sing Y N 327 TYR CE2 HE2 sing N N 328 TYR CZ OH sing N N 329 TYR OH HH sing N N 330 TYR OXT HXT sing N N 331 VAL N CA sing N N 332 VAL N H sing N N 333 VAL N H2 sing N N 334 VAL CA C sing N N 335 VAL CA CB sing N N 336 VAL CA HA sing N N 337 VAL C O doub N N 338 VAL C OXT sing N N 339 VAL CB CG1 sing N N 340 VAL CB CG2 sing N N 341 VAL CB HB sing N N 342 VAL CG1 HG11 sing N N 343 VAL CG1 HG12 sing N N 344 VAL CG1 HG13 sing N N 345 VAL CG2 HG21 sing N N 346 VAL CG2 HG22 sing N N 347 VAL CG2 HG23 sing N N 348 VAL OXT HXT sing N N 349 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1ZBO _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details 'gel filtration and PISA analysis' #