data_7CC2 # _entry.id 7CC2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7CC2 pdb_00007cc2 10.2210/pdb7cc2/pdb WWPDB D_1300017313 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7CC2 _pdbx_database_status.recvd_initial_deposition_date 2020-06-16 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Anantharajan, J.' 1 ? 'Baburajendran, N.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country GE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Angew.Chem.Int.Ed.Engl. _citation.journal_id_ASTM ACIEAY _citation.journal_id_CSD 0179 _citation.journal_id_ISSN 1521-3773 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 60 _citation.language ? _citation.page_first 17131 _citation.page_last 17137 _citation.title 'Strategic Design of Catalytic Lysine-Targeting Reversible Covalent BCR-ABL Inhibitors*.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/anie.202105383 _citation.pdbx_database_id_PubMed 34008286 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Quach, D.' 1 ? primary 'Tang, G.' 2 ? primary 'Anantharajan, J.' 3 ? primary 'Baburajendran, N.' 4 ? primary 'Poulsen, A.' 5 ? primary 'Wee, J.L.K.' 6 ? primary 'Retna, P.' 7 ? primary 'Li, R.' 8 ? primary 'Liu, B.' 9 ? primary 'Tee, D.H.Y.' 10 ? primary 'Kwek, P.Z.' 11 ? primary 'Joy, J.K.' 12 ? primary 'Yang, W.Q.' 13 ? primary 'Zhang, C.J.' 14 ? primary 'Foo, K.' 15 ? primary 'Keller, T.H.' 16 ? primary 'Yao, S.Q.' 17 0000-0003-4715-769X # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7CC2 _cell.details ? _cell.formula_units_Z ? _cell.length_a 116.489 _cell.length_a_esd ? _cell.length_b 127.939 _cell.length_b_esd ? _cell.length_c 56.760 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7CC2 _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Tyrosine-protein kinase ABL1' 35894.848 2 2.7.10.2 ? ? ? 2 non-polymer syn '[4-[5-[5-(dimethylcarbamoyl)pyridin-3-yl]-1H-pyrrolo[2,3-b]pyridin-3-yl]-2-methyl-phenyl]boronic acid' 400.238 2 ? ? ? ? 3 water nat water 18.015 45 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Abelson murine leukemia viral oncogene homolog 1,Abelson tyrosine-protein kinase 1,Proto-oncogene c-Abl,p150' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMENLYFQSSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEV EEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFI HRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPY PGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKEL ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMENLYFQSSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEV EEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFI HRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPY PGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKEL ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 GLU n 1 23 ASN n 1 24 LEU n 1 25 TYR n 1 26 PHE n 1 27 GLN n 1 28 SER n 1 29 SER n 1 30 PRO n 1 31 ASN n 1 32 TYR n 1 33 ASP n 1 34 LYS n 1 35 TRP n 1 36 GLU n 1 37 MET n 1 38 GLU n 1 39 ARG n 1 40 THR n 1 41 ASP n 1 42 ILE n 1 43 THR n 1 44 MET n 1 45 LYS n 1 46 HIS n 1 47 LYS n 1 48 LEU n 1 49 GLY n 1 50 GLY n 1 51 GLY n 1 52 GLN n 1 53 TYR n 1 54 GLY n 1 55 GLU n 1 56 VAL n 1 57 TYR n 1 58 GLU n 1 59 GLY n 1 60 VAL n 1 61 TRP n 1 62 LYS n 1 63 LYS n 1 64 TYR n 1 65 SER n 1 66 LEU n 1 67 THR n 1 68 VAL n 1 69 ALA n 1 70 VAL n 1 71 LYS n 1 72 THR n 1 73 LEU n 1 74 LYS n 1 75 GLU n 1 76 ASP n 1 77 THR n 1 78 MET n 1 79 GLU n 1 80 VAL n 1 81 GLU n 1 82 GLU n 1 83 PHE n 1 84 LEU n 1 85 LYS n 1 86 GLU n 1 87 ALA n 1 88 ALA n 1 89 VAL n 1 90 MET n 1 91 LYS n 1 92 GLU n 1 93 ILE n 1 94 LYS n 1 95 HIS n 1 96 PRO n 1 97 ASN n 1 98 LEU n 1 99 VAL n 1 100 GLN n 1 101 LEU n 1 102 LEU n 1 103 GLY n 1 104 VAL n 1 105 CYS n 1 106 THR n 1 107 ARG n 1 108 GLU n 1 109 PRO n 1 110 PRO n 1 111 PHE n 1 112 TYR n 1 113 ILE n 1 114 ILE n 1 115 THR n 1 116 GLU n 1 117 PHE n 1 118 MET n 1 119 THR n 1 120 TYR n 1 121 GLY n 1 122 ASN n 1 123 LEU n 1 124 LEU n 1 125 ASP n 1 126 TYR n 1 127 LEU n 1 128 ARG n 1 129 GLU n 1 130 CYS n 1 131 ASN n 1 132 ARG n 1 133 GLN n 1 134 GLU n 1 135 VAL n 1 136 ASN n 1 137 ALA n 1 138 VAL n 1 139 VAL n 1 140 LEU n 1 141 LEU n 1 142 TYR n 1 143 MET n 1 144 ALA n 1 145 THR n 1 146 GLN n 1 147 ILE n 1 148 SER n 1 149 SER n 1 150 ALA n 1 151 MET n 1 152 GLU n 1 153 TYR n 1 154 LEU n 1 155 GLU n 1 156 LYS n 1 157 LYS n 1 158 ASN n 1 159 PHE n 1 160 ILE n 1 161 HIS n 1 162 ARG n 1 163 ASP n 1 164 LEU n 1 165 ALA n 1 166 ALA n 1 167 ARG n 1 168 ASN n 1 169 CYS n 1 170 LEU n 1 171 VAL n 1 172 GLY n 1 173 GLU n 1 174 ASN n 1 175 HIS n 1 176 LEU n 1 177 VAL n 1 178 LYS n 1 179 VAL n 1 180 ALA n 1 181 ASP n 1 182 PHE n 1 183 GLY n 1 184 LEU n 1 185 SER n 1 186 ARG n 1 187 LEU n 1 188 MET n 1 189 THR n 1 190 GLY n 1 191 ASP n 1 192 THR n 1 193 TYR n 1 194 THR n 1 195 ALA n 1 196 HIS n 1 197 ALA n 1 198 GLY n 1 199 ALA n 1 200 LYS n 1 201 PHE n 1 202 PRO n 1 203 ILE n 1 204 LYS n 1 205 TRP n 1 206 THR n 1 207 ALA n 1 208 PRO n 1 209 GLU n 1 210 SER n 1 211 LEU n 1 212 ALA n 1 213 TYR n 1 214 ASN n 1 215 LYS n 1 216 PHE n 1 217 SER n 1 218 ILE n 1 219 LYS n 1 220 SER n 1 221 ASP n 1 222 VAL n 1 223 TRP n 1 224 ALA n 1 225 PHE n 1 226 GLY n 1 227 VAL n 1 228 LEU n 1 229 LEU n 1 230 TRP n 1 231 GLU n 1 232 ILE n 1 233 ALA n 1 234 THR n 1 235 TYR n 1 236 GLY n 1 237 MET n 1 238 SER n 1 239 PRO n 1 240 TYR n 1 241 PRO n 1 242 GLY n 1 243 ILE n 1 244 ASP n 1 245 LEU n 1 246 SER n 1 247 GLN n 1 248 VAL n 1 249 TYR n 1 250 GLU n 1 251 LEU n 1 252 LEU n 1 253 GLU n 1 254 LYS n 1 255 ASP n 1 256 TYR n 1 257 ARG n 1 258 MET n 1 259 GLU n 1 260 ARG n 1 261 PRO n 1 262 GLU n 1 263 GLY n 1 264 CYS n 1 265 PRO n 1 266 GLU n 1 267 LYS n 1 268 VAL n 1 269 TYR n 1 270 GLU n 1 271 LEU n 1 272 MET n 1 273 ARG n 1 274 ALA n 1 275 CYS n 1 276 TRP n 1 277 GLN n 1 278 TRP n 1 279 ASN n 1 280 PRO n 1 281 SER n 1 282 ASP n 1 283 ARG n 1 284 PRO n 1 285 SER n 1 286 PHE n 1 287 ALA n 1 288 GLU n 1 289 ILE n 1 290 HIS n 1 291 GLN n 1 292 ALA n 1 293 PHE n 1 294 GLU n 1 295 THR n 1 296 MET n 1 297 PHE n 1 298 GLN n 1 299 GLU n 1 300 SER n 1 301 SER n 1 302 ILE n 1 303 SER n 1 304 ASP n 1 305 GLU n 1 306 VAL n 1 307 GLU n 1 308 LYS n 1 309 GLU n 1 310 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 310 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ABL1, ABL, JTK7' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ABL1_HUMAN _struct_ref.pdbx_db_accession P00519 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTRE PPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLM TGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKV YELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKEL ; _struct_ref.pdbx_align_begin 229 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7CC2 A 29 ? 310 ? P00519 229 ? 510 ? 229 510 2 1 7CC2 B 29 ? 310 ? P00519 229 ? 510 ? 229 510 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7CC2 MET A 1 ? UNP P00519 ? ? 'initiating methionine' 201 1 1 7CC2 GLY A 2 ? UNP P00519 ? ? 'expression tag' 202 2 1 7CC2 SER A 3 ? UNP P00519 ? ? 'expression tag' 203 3 1 7CC2 SER A 4 ? UNP P00519 ? ? 'expression tag' 204 4 1 7CC2 HIS A 5 ? UNP P00519 ? ? 'expression tag' 205 5 1 7CC2 HIS A 6 ? UNP P00519 ? ? 'expression tag' 206 6 1 7CC2 HIS A 7 ? UNP P00519 ? ? 'expression tag' 207 7 1 7CC2 HIS A 8 ? UNP P00519 ? ? 'expression tag' 208 8 1 7CC2 HIS A 9 ? UNP P00519 ? ? 'expression tag' 209 9 1 7CC2 HIS A 10 ? UNP P00519 ? ? 'expression tag' 210 10 1 7CC2 SER A 11 ? UNP P00519 ? ? 'expression tag' 211 11 1 7CC2 SER A 12 ? UNP P00519 ? ? 'expression tag' 212 12 1 7CC2 GLY A 13 ? UNP P00519 ? ? 'expression tag' 213 13 1 7CC2 LEU A 14 ? UNP P00519 ? ? 'expression tag' 214 14 1 7CC2 VAL A 15 ? UNP P00519 ? ? 'expression tag' 215 15 1 7CC2 PRO A 16 ? UNP P00519 ? ? 'expression tag' 216 16 1 7CC2 ARG A 17 ? UNP P00519 ? ? 'expression tag' 217 17 1 7CC2 GLY A 18 ? UNP P00519 ? ? 'expression tag' 218 18 1 7CC2 SER A 19 ? UNP P00519 ? ? 'expression tag' 219 19 1 7CC2 HIS A 20 ? UNP P00519 ? ? 'expression tag' 220 20 1 7CC2 MET A 21 ? UNP P00519 ? ? 'expression tag' 221 21 1 7CC2 GLU A 22 ? UNP P00519 ? ? 'expression tag' 222 22 1 7CC2 ASN A 23 ? UNP P00519 ? ? 'expression tag' 223 23 1 7CC2 LEU A 24 ? UNP P00519 ? ? 'expression tag' 224 24 1 7CC2 TYR A 25 ? UNP P00519 ? ? 'expression tag' 225 25 1 7CC2 PHE A 26 ? UNP P00519 ? ? 'expression tag' 226 26 1 7CC2 GLN A 27 ? UNP P00519 ? ? 'expression tag' 227 27 1 7CC2 SER A 28 ? UNP P00519 ? ? 'expression tag' 228 28 2 7CC2 MET B 1 ? UNP P00519 ? ? 'initiating methionine' 201 29 2 7CC2 GLY B 2 ? UNP P00519 ? ? 'expression tag' 202 30 2 7CC2 SER B 3 ? UNP P00519 ? ? 'expression tag' 203 31 2 7CC2 SER B 4 ? UNP P00519 ? ? 'expression tag' 204 32 2 7CC2 HIS B 5 ? UNP P00519 ? ? 'expression tag' 205 33 2 7CC2 HIS B 6 ? UNP P00519 ? ? 'expression tag' 206 34 2 7CC2 HIS B 7 ? UNP P00519 ? ? 'expression tag' 207 35 2 7CC2 HIS B 8 ? UNP P00519 ? ? 'expression tag' 208 36 2 7CC2 HIS B 9 ? UNP P00519 ? ? 'expression tag' 209 37 2 7CC2 HIS B 10 ? UNP P00519 ? ? 'expression tag' 210 38 2 7CC2 SER B 11 ? UNP P00519 ? ? 'expression tag' 211 39 2 7CC2 SER B 12 ? UNP P00519 ? ? 'expression tag' 212 40 2 7CC2 GLY B 13 ? UNP P00519 ? ? 'expression tag' 213 41 2 7CC2 LEU B 14 ? UNP P00519 ? ? 'expression tag' 214 42 2 7CC2 VAL B 15 ? UNP P00519 ? ? 'expression tag' 215 43 2 7CC2 PRO B 16 ? UNP P00519 ? ? 'expression tag' 216 44 2 7CC2 ARG B 17 ? UNP P00519 ? ? 'expression tag' 217 45 2 7CC2 GLY B 18 ? UNP P00519 ? ? 'expression tag' 218 46 2 7CC2 SER B 19 ? UNP P00519 ? ? 'expression tag' 219 47 2 7CC2 HIS B 20 ? UNP P00519 ? ? 'expression tag' 220 48 2 7CC2 MET B 21 ? UNP P00519 ? ? 'expression tag' 221 49 2 7CC2 GLU B 22 ? UNP P00519 ? ? 'expression tag' 222 50 2 7CC2 ASN B 23 ? UNP P00519 ? ? 'expression tag' 223 51 2 7CC2 LEU B 24 ? UNP P00519 ? ? 'expression tag' 224 52 2 7CC2 TYR B 25 ? UNP P00519 ? ? 'expression tag' 225 53 2 7CC2 PHE B 26 ? UNP P00519 ? ? 'expression tag' 226 54 2 7CC2 GLN B 27 ? UNP P00519 ? ? 'expression tag' 227 55 2 7CC2 SER B 28 ? UNP P00519 ? ? 'expression tag' 228 56 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FVC non-polymer . '[4-[5-[5-(dimethylcarbamoyl)pyridin-3-yl]-1H-pyrrolo[2,3-b]pyridin-3-yl]-2-methyl-phenyl]boronic acid' ? 'C22 H21 B N4 O3' 400.238 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7CC2 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.93 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 57.98 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '7 % w/v Polyethylene glycol 8000, 100 mM MES pH 6.5, 20 % v/v Ethylene glycol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-10-28 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.95374 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'AUSTRALIAN SYNCHROTRON BEAMLINE MX2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.95374 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MX2 _diffrn_source.pdbx_synchrotron_site 'Australian Synchrotron' # _reflns.B_iso_Wilson_estimate 43.730 _reflns.entry_id 7CC2 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.720 _reflns.d_resolution_low 47.3950 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 23393 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.500 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.700 _reflns.pdbx_Rmerge_I_obs 0.144 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.700 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.157 _reflns.pdbx_Rpim_I_all 0.060 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.995 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 2.720 2.850 ? ? ? ? ? ? 3000 97.600 ? ? ? ? 0.753 ? ? ? ? ? ? ? ? 6.800 ? ? ? ? 0.815 0.307 ? 1 1 0.785 ? ? 9.020 47.3950 ? ? ? ? ? ? 724 98.500 ? ? ? ? 0.041 ? ? ? ? ? ? ? ? 6.200 ? ? ? ? 0.044 0.017 ? 2 1 0.999 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 129.300 _refine.B_iso_mean 46.1251 _refine.B_iso_min 13.400 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7CC2 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.7230 _refine.ls_d_res_low 47.390 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 23343 _refine.ls_number_reflns_R_free 2000 _refine.ls_number_reflns_R_work 21343 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.6100 _refine.ls_percent_reflns_R_free 8.5700 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1964 _refine.ls_R_factor_R_free 0.2418 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1922 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.360 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2QOH _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 22.5300 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3300 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.7230 _refine_hist.d_res_low 47.390 _refine_hist.number_atoms_solvent 45 _refine_hist.number_atoms_total 4348 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 529 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent 34.99 _refine_hist.pdbx_number_atoms_protein 4303 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.003 ? 4418 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.676 ? 5985 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.045 ? 643 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 746 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 5.494 ? 2596 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.pdbx_weight _refine_ls_restr_ncs.pdbx_ens_id 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 1 TORSIONAL ? A 2398 8.779 ? 1 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 2 TORSIONAL ? B 2398 8.779 ? 1 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.7230 2.7910 . . 138 1473 99.0000 . . . 0.3555 0.0000 0.2615 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7910 2.8664 . . 140 1488 99.0000 . . . 0.3121 0.0000 0.2290 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8664 2.9507 . . 141 1515 100.0000 . . . 0.2986 0.0000 0.2152 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9507 3.0460 . . 140 1493 100.0000 . . . 0.2843 0.0000 0.2211 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0460 3.1548 . . 142 1512 100.0000 . . . 0.2496 0.0000 0.2015 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1548 3.2811 . . 140 1502 100.0000 . . . 0.3152 0.0000 0.2051 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2811 3.4304 . . 142 1507 100.0000 . . . 0.2378 0.0000 0.2006 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.4304 3.6112 . . 142 1517 100.0000 . . . 0.2100 0.0000 0.1817 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.6112 3.8373 . . 142 1514 100.0000 . . . 0.2343 0.0000 0.1860 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.8373 4.1335 . . 143 1532 100.0000 . . . 0.2289 0.0000 0.1744 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.1335 4.5491 . . 144 1528 100.0000 . . . 0.1860 0.0000 0.1670 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.5491 5.2067 . . 145 1563 100.0000 . . . 0.1986 0.0000 0.1684 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.2067 6.5571 . . 147 1558 100.0000 . . . 0.2337 0.0000 0.2047 . . . . . . . . . . . 'X-RAY DIFFRACTION' 6.5571 47.390 . . 154 1641 99.0000 . . . 0.2659 0.0000 0.1943 . . . . . . . . . . . # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 ;(chain A and (resid 233 through 237 or (resid 238 and (name N or name CA or name C or name O or name CB )) or resid 239 through 262 or (resid 263 and (name N or name CA or name C or name O or name CB )) or resid 264 through 285 or (resid 286 through 288 and (name N or name CA or name C or name O or name CB )) or resid 289 through 395 or (resid 396 through 397 and (name N or name CA or name C or name O or name CB )) or (resid 398 through 400 and (name N or name CA or name C or name O or name CB )) or resid 401 through 443 or (resid 444 and (name N or name CA or name C or name O or name CB )) or resid 445 through 461 or (resid 462 and (name N or name CA or name C or name O or name CB )) or resid 463 through 501)) ; 1 2 ;(chain B and (resid 233 through 248 or resid 255 through 277 or (resid 278 through 283 and (name N or name CA or name C or name O or name CB )) or resid 284 through 306 or (resid 307 and (name N or name CA or name C or name O or name CB or name CG )) or resid 308 through 372 or (resid 373 and (name N or name CA or name C or name O or name CB )) or resid 374 through 408 or (resid 409 and (name N or name CA or name C or name O or name CB )) or resid 410 through 414 or (resid 415 and (name N or name CA or name C or name O or name CB or name CG )) or resid 416 through 458 or (resid 459 and (name N or name CA or name C or name O or name CB )) or resid 460 through 500 or (resid 501 and (name N or name CA or name C or name O or name CB )))) ; # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 1 A ASP 33 . A MET 37 . A ASP 233 A MET 237 ? ;(chain A and (resid 233 through 237 or (resid 238 and (name N or name CA or name C or name O or name CB )) or resid 239 through 262 or (resid 263 and (name N or name CA or name C or name O or name CB )) or resid 264 through 285 or (resid 286 through 288 and (name N or name CA or name C or name O or name CB )) or resid 289 through 395 or (resid 396 through 397 and (name N or name CA or name C or name O or name CB )) or (resid 398 through 400 and (name N or name CA or name C or name O or name CB )) or resid 401 through 443 or (resid 444 and (name N or name CA or name C or name O or name CB )) or resid 445 through 461 or (resid 462 and (name N or name CA or name C or name O or name CB )) or resid 463 through 501)) ; 1 1 2 A GLU 38 . A GLU 38 . A GLU 238 A GLU 238 ? ;(chain A and (resid 233 through 237 or (resid 238 and (name N or name CA or name C or name O or name CB )) or resid 239 through 262 or (resid 263 and (name N or name CA or name C or name O or name CB )) or resid 264 through 285 or (resid 286 through 288 and (name N or name CA or name C or name O or name CB )) or resid 289 through 395 or (resid 396 through 397 and (name N or name CA or name C or name O or name CB )) or (resid 398 through 400 and (name N or name CA or name C or name O or name CB )) or resid 401 through 443 or (resid 444 and (name N or name CA or name C or name O or name CB )) or resid 445 through 461 or (resid 462 and (name N or name CA or name C or name O or name CB )) or resid 463 through 501)) ; 1 1 3 A ASP 33 . A SER 301 . A ASP 233 A SER 501 ? ;(chain A and (resid 233 through 237 or (resid 238 and (name N or name CA or name C or name O or name CB )) or resid 239 through 262 or (resid 263 and (name N or name CA or name C or name O or name CB )) or resid 264 through 285 or (resid 286 through 288 and (name N or name CA or name C or name O or name CB )) or resid 289 through 395 or (resid 396 through 397 and (name N or name CA or name C or name O or name CB )) or (resid 398 through 400 and (name N or name CA or name C or name O or name CB )) or resid 401 through 443 or (resid 444 and (name N or name CA or name C or name O or name CB )) or resid 445 through 461 or (resid 462 and (name N or name CA or name C or name O or name CB )) or resid 463 through 501)) ; 1 1 4 A ASP 33 . A SER 301 . A ASP 233 A SER 501 ? ;(chain A and (resid 233 through 237 or (resid 238 and (name N or name CA or name C or name O or name CB )) or resid 239 through 262 or (resid 263 and (name N or name CA or name C or name O or name CB )) or resid 264 through 285 or (resid 286 through 288 and (name N or name CA or name C or name O or name CB )) or resid 289 through 395 or (resid 396 through 397 and (name N or name CA or name C or name O or name CB )) or (resid 398 through 400 and (name N or name CA or name C or name O or name CB )) or resid 401 through 443 or (resid 444 and (name N or name CA or name C or name O or name CB )) or resid 445 through 461 or (resid 462 and (name N or name CA or name C or name O or name CB )) or resid 463 through 501)) ; 1 1 5 A ASP 33 . A SER 301 . A ASP 233 A SER 501 ? ;(chain A and (resid 233 through 237 or (resid 238 and (name N or name CA or name C or name O or name CB )) or resid 239 through 262 or (resid 263 and (name N or name CA or name C or name O or name CB )) or resid 264 through 285 or (resid 286 through 288 and (name N or name CA or name C or name O or name CB )) or resid 289 through 395 or (resid 396 through 397 and (name N or name CA or name C or name O or name CB )) or (resid 398 through 400 and (name N or name CA or name C or name O or name CB )) or resid 401 through 443 or (resid 444 and (name N or name CA or name C or name O or name CB )) or resid 445 through 461 or (resid 462 and (name N or name CA or name C or name O or name CB )) or resid 463 through 501)) ; 1 1 6 A ASP 33 . A SER 301 . A ASP 233 A SER 501 ? ;(chain A and (resid 233 through 237 or (resid 238 and (name N or name CA or name C or name O or name CB )) or resid 239 through 262 or (resid 263 and (name N or name CA or name C or name O or name CB )) or resid 264 through 285 or (resid 286 through 288 and (name N or name CA or name C or name O or name CB )) or resid 289 through 395 or (resid 396 through 397 and (name N or name CA or name C or name O or name CB )) or (resid 398 through 400 and (name N or name CA or name C or name O or name CB )) or resid 401 through 443 or (resid 444 and (name N or name CA or name C or name O or name CB )) or resid 445 through 461 or (resid 462 and (name N or name CA or name C or name O or name CB )) or resid 463 through 501)) ; 1 2 1 B ASP 33 . B LEU 48 . B ASP 233 B LEU 248 ? ;(chain B and (resid 233 through 248 or resid 255 through 277 or (resid 278 through 283 and (name N or name CA or name C or name O or name CB )) or resid 284 through 306 or (resid 307 and (name N or name CA or name C or name O or name CB or name CG )) or resid 308 through 372 or (resid 373 and (name N or name CA or name C or name O or name CB )) or resid 374 through 408 or (resid 409 and (name N or name CA or name C or name O or name CB )) or resid 410 through 414 or (resid 415 and (name N or name CA or name C or name O or name CB or name CG )) or resid 416 through 458 or (resid 459 and (name N or name CA or name C or name O or name CB )) or resid 460 through 500 or (resid 501 and (name N or name CA or name C or name O or name CB )))) ; 1 2 2 B GLU 55 . B THR 77 . B GLU 255 B THR 277 ? ;(chain B and (resid 233 through 248 or resid 255 through 277 or (resid 278 through 283 and (name N or name CA or name C or name O or name CB )) or resid 284 through 306 or (resid 307 and (name N or name CA or name C or name O or name CB or name CG )) or resid 308 through 372 or (resid 373 and (name N or name CA or name C or name O or name CB )) or resid 374 through 408 or (resid 409 and (name N or name CA or name C or name O or name CB )) or resid 410 through 414 or (resid 415 and (name N or name CA or name C or name O or name CB or name CG )) or resid 416 through 458 or (resid 459 and (name N or name CA or name C or name O or name CB )) or resid 460 through 500 or (resid 501 and (name N or name CA or name C or name O or name CB )))) ; 1 2 3 B MET 78 . B PHE 83 . B MET 278 B PHE 283 ? ;(chain B and (resid 233 through 248 or resid 255 through 277 or (resid 278 through 283 and (name N or name CA or name C or name O or name CB )) or resid 284 through 306 or (resid 307 and (name N or name CA or name C or name O or name CB or name CG )) or resid 308 through 372 or (resid 373 and (name N or name CA or name C or name O or name CB )) or resid 374 through 408 or (resid 409 and (name N or name CA or name C or name O or name CB )) or resid 410 through 414 or (resid 415 and (name N or name CA or name C or name O or name CB or name CG )) or resid 416 through 458 or (resid 459 and (name N or name CA or name C or name O or name CB )) or resid 460 through 500 or (resid 501 and (name N or name CA or name C or name O or name CB )))) ; 1 2 4 B TYR 32 . B SER 301 . B TYR 232 B SER 501 ? ;(chain B and (resid 233 through 248 or resid 255 through 277 or (resid 278 through 283 and (name N or name CA or name C or name O or name CB )) or resid 284 through 306 or (resid 307 and (name N or name CA or name C or name O or name CB or name CG )) or resid 308 through 372 or (resid 373 and (name N or name CA or name C or name O or name CB )) or resid 374 through 408 or (resid 409 and (name N or name CA or name C or name O or name CB )) or resid 410 through 414 or (resid 415 and (name N or name CA or name C or name O or name CB or name CG )) or resid 416 through 458 or (resid 459 and (name N or name CA or name C or name O or name CB )) or resid 460 through 500 or (resid 501 and (name N or name CA or name C or name O or name CB )))) ; 1 2 5 B TYR 32 . B SER 301 . B TYR 232 B SER 501 ? ;(chain B and (resid 233 through 248 or resid 255 through 277 or (resid 278 through 283 and (name N or name CA or name C or name O or name CB )) or resid 284 through 306 or (resid 307 and (name N or name CA or name C or name O or name CB or name CG )) or resid 308 through 372 or (resid 373 and (name N or name CA or name C or name O or name CB )) or resid 374 through 408 or (resid 409 and (name N or name CA or name C or name O or name CB )) or resid 410 through 414 or (resid 415 and (name N or name CA or name C or name O or name CB or name CG )) or resid 416 through 458 or (resid 459 and (name N or name CA or name C or name O or name CB )) or resid 460 through 500 or (resid 501 and (name N or name CA or name C or name O or name CB )))) ; 1 2 6 B TYR 32 . B SER 301 . B TYR 232 B SER 501 ? ;(chain B and (resid 233 through 248 or resid 255 through 277 or (resid 278 through 283 and (name N or name CA or name C or name O or name CB )) or resid 284 through 306 or (resid 307 and (name N or name CA or name C or name O or name CB or name CG )) or resid 308 through 372 or (resid 373 and (name N or name CA or name C or name O or name CB )) or resid 374 through 408 or (resid 409 and (name N or name CA or name C or name O or name CB )) or resid 410 through 414 or (resid 415 and (name N or name CA or name C or name O or name CB or name CG )) or resid 416 through 458 or (resid 459 and (name N or name CA or name C or name O or name CB )) or resid 460 through 500 or (resid 501 and (name N or name CA or name C or name O or name CB )))) ; 1 2 7 B TYR 32 . B SER 301 . B TYR 232 B SER 501 ? ;(chain B and (resid 233 through 248 or resid 255 through 277 or (resid 278 through 283 and (name N or name CA or name C or name O or name CB )) or resid 284 through 306 or (resid 307 and (name N or name CA or name C or name O or name CB or name CG )) or resid 308 through 372 or (resid 373 and (name N or name CA or name C or name O or name CB )) or resid 374 through 408 or (resid 409 and (name N or name CA or name C or name O or name CB )) or resid 410 through 414 or (resid 415 and (name N or name CA or name C or name O or name CB or name CG )) or resid 416 through 458 or (resid 459 and (name N or name CA or name C or name O or name CB )) or resid 460 through 500 or (resid 501 and (name N or name CA or name C or name O or name CB )))) ; 1 2 8 B TYR 32 . B SER 301 . B TYR 232 B SER 501 ? ;(chain B and (resid 233 through 248 or resid 255 through 277 or (resid 278 through 283 and (name N or name CA or name C or name O or name CB )) or resid 284 through 306 or (resid 307 and (name N or name CA or name C or name O or name CB or name CG )) or resid 308 through 372 or (resid 373 and (name N or name CA or name C or name O or name CB )) or resid 374 through 408 or (resid 409 and (name N or name CA or name C or name O or name CB )) or resid 410 through 414 or (resid 415 and (name N or name CA or name C or name O or name CB or name CG )) or resid 416 through 458 or (resid 459 and (name N or name CA or name C or name O or name CB )) or resid 460 through 500 or (resid 501 and (name N or name CA or name C or name O or name CB )))) ; # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 7CC2 _struct.title 'Strategic design of catalytic lysine-targeting reversible covalent BCR-ABL Inhibitors' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7CC2 _struct_keywords.text 'Tyrosine kinase Covalent inhibitor chronic myelogenous leukemia, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 38 ? THR A 40 ? GLU A 238 THR A 240 5 ? 3 HELX_P HELX_P2 AA2 THR A 77 ? LYS A 91 ? THR A 277 LYS A 291 1 ? 15 HELX_P HELX_P3 AA3 ASN A 122 ? CYS A 130 ? ASN A 322 CYS A 330 1 ? 9 HELX_P HELX_P4 AA4 ASN A 136 ? LYS A 157 ? ASN A 336 LYS A 357 1 ? 22 HELX_P HELX_P5 AA5 ALA A 165 ? ARG A 167 ? ALA A 365 ARG A 367 5 ? 3 HELX_P HELX_P6 AA6 GLU A 173 ? HIS A 175 ? GLU A 373 HIS A 375 5 ? 3 HELX_P HELX_P7 AA7 PRO A 202 ? THR A 206 ? PRO A 402 THR A 406 5 ? 5 HELX_P HELX_P8 AA8 ALA A 207 ? ASN A 214 ? ALA A 407 ASN A 414 1 ? 8 HELX_P HELX_P9 AA9 SER A 217 ? THR A 234 ? SER A 417 THR A 434 1 ? 18 HELX_P HELX_P10 AB1 ASP A 244 ? SER A 246 ? ASP A 444 SER A 446 5 ? 3 HELX_P HELX_P11 AB2 GLN A 247 ? LYS A 254 ? GLN A 447 LYS A 454 1 ? 8 HELX_P HELX_P12 AB3 PRO A 265 ? TRP A 276 ? PRO A 465 TRP A 476 1 ? 12 HELX_P HELX_P13 AB4 ASN A 279 ? ARG A 283 ? ASN A 479 ARG A 483 5 ? 5 HELX_P HELX_P14 AB5 SER A 285 ? GLU A 299 ? SER A 485 GLU A 499 1 ? 15 HELX_P HELX_P15 AB6 GLU B 38 ? THR B 40 ? GLU B 238 THR B 240 5 ? 3 HELX_P HELX_P16 AB7 GLU B 79 ? LYS B 91 ? GLU B 279 LYS B 291 1 ? 13 HELX_P HELX_P17 AB8 ASN B 122 ? CYS B 130 ? ASN B 322 CYS B 330 1 ? 9 HELX_P HELX_P18 AB9 ASN B 136 ? LYS B 157 ? ASN B 336 LYS B 357 1 ? 22 HELX_P HELX_P19 AC1 ALA B 165 ? ARG B 167 ? ALA B 365 ARG B 367 5 ? 3 HELX_P HELX_P20 AC2 GLU B 173 ? HIS B 175 ? GLU B 373 HIS B 375 5 ? 3 HELX_P HELX_P21 AC3 PRO B 202 ? THR B 206 ? PRO B 402 THR B 406 5 ? 5 HELX_P HELX_P22 AC4 ALA B 207 ? ASN B 214 ? ALA B 407 ASN B 414 1 ? 8 HELX_P HELX_P23 AC5 SER B 217 ? THR B 234 ? SER B 417 THR B 434 1 ? 18 HELX_P HELX_P24 AC6 ASP B 244 ? SER B 246 ? ASP B 444 SER B 446 5 ? 3 HELX_P HELX_P25 AC7 GLN B 247 ? LYS B 254 ? GLN B 447 LYS B 454 1 ? 8 HELX_P HELX_P26 AC8 PRO B 265 ? TRP B 276 ? PRO B 465 TRP B 476 1 ? 12 HELX_P HELX_P27 AC9 ASN B 279 ? ARG B 283 ? ASN B 479 ARG B 483 5 ? 5 HELX_P HELX_P28 AD1 SER B 285 ? GLU B 299 ? SER B 485 GLU B 499 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale none ? A LYS 71 NZ ? ? ? 1_555 C FVC . C21 ? ? A LYS 271 A FVC 601 1_555 ? ? ? ? ? ? ? 1.261 ? ? covale2 covale none ? B LYS 71 NZ ? ? ? 1_555 D FVC . C21 ? ? B LYS 271 B FVC 601 1_555 ? ? ? ? ? ? ? 1.259 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 PRO 109 A . ? PRO 309 A PRO 110 A ? PRO 310 A 1 -3.48 2 PRO 109 B . ? PRO 309 B PRO 110 B ? PRO 310 B 1 -6.00 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 2 ? AA4 ? 2 ? AA5 ? 5 ? AA6 ? 2 ? AA7 ? 2 ? AA8 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA4 1 2 ? anti-parallel AA5 1 2 ? anti-parallel AA5 2 3 ? anti-parallel AA5 3 4 ? anti-parallel AA5 4 5 ? anti-parallel AA6 1 2 ? anti-parallel AA7 1 2 ? anti-parallel AA8 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 42 ? LYS A 47 ? ILE A 242 LYS A 247 AA1 2 VAL A 56 ? TRP A 61 ? VAL A 256 TRP A 261 AA1 3 LEU A 66 ? LEU A 73 ? LEU A 266 LEU A 273 AA1 4 PHE A 111 ? GLU A 116 ? PHE A 311 GLU A 316 AA1 5 LEU A 101 ? CYS A 105 ? LEU A 301 CYS A 305 AA2 1 PHE A 159 ? ILE A 160 ? PHE A 359 ILE A 360 AA2 2 SER A 185 ? ARG A 186 ? SER A 385 ARG A 386 AA3 1 CYS A 169 ? VAL A 171 ? CYS A 369 VAL A 371 AA3 2 VAL A 177 ? VAL A 179 ? VAL A 377 VAL A 379 AA4 1 TYR A 193 ? THR A 194 ? TYR A 393 THR A 394 AA4 2 LYS A 215 ? PHE A 216 ? LYS A 415 PHE A 416 AA5 1 ILE B 42 ? LEU B 48 ? ILE B 242 LEU B 248 AA5 2 VAL B 56 ? TRP B 61 ? VAL B 256 TRP B 261 AA5 3 LEU B 66 ? LEU B 73 ? LEU B 266 LEU B 273 AA5 4 PHE B 111 ? GLU B 116 ? PHE B 311 GLU B 316 AA5 5 LEU B 101 ? CYS B 105 ? LEU B 301 CYS B 305 AA6 1 PHE B 159 ? ILE B 160 ? PHE B 359 ILE B 360 AA6 2 SER B 185 ? ARG B 186 ? SER B 385 ARG B 386 AA7 1 CYS B 169 ? VAL B 171 ? CYS B 369 VAL B 371 AA7 2 VAL B 177 ? VAL B 179 ? VAL B 377 VAL B 379 AA8 1 TYR B 193 ? THR B 194 ? TYR B 393 THR B 394 AA8 2 LYS B 215 ? PHE B 216 ? LYS B 415 PHE B 416 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N HIS A 46 ? N HIS A 246 O GLU A 58 ? O GLU A 258 AA1 2 3 N GLY A 59 ? N GLY A 259 O VAL A 68 ? O VAL A 268 AA1 3 4 N LYS A 71 ? N LYS A 271 O ILE A 113 ? O ILE A 313 AA1 4 5 O ILE A 114 ? O ILE A 314 N LEU A 102 ? N LEU A 302 AA2 1 2 N ILE A 160 ? N ILE A 360 O SER A 185 ? O SER A 385 AA3 1 2 N LEU A 170 ? N LEU A 370 O LYS A 178 ? O LYS A 378 AA4 1 2 N TYR A 193 ? N TYR A 393 O PHE A 216 ? O PHE A 416 AA5 1 2 N LEU B 48 ? N LEU B 248 O VAL B 56 ? O VAL B 256 AA5 2 3 N TYR B 57 ? N TYR B 257 O VAL B 70 ? O VAL B 270 AA5 3 4 N LYS B 71 ? N LYS B 271 O ILE B 113 ? O ILE B 313 AA5 4 5 O ILE B 114 ? O ILE B 314 N LEU B 102 ? N LEU B 302 AA6 1 2 N ILE B 160 ? N ILE B 360 O SER B 185 ? O SER B 385 AA7 1 2 N LEU B 170 ? N LEU B 370 O LYS B 178 ? O LYS B 378 AA8 1 2 N TYR B 193 ? N TYR B 393 O PHE B 216 ? O PHE B 416 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A FVC 601 ? 9 'binding site for residue FVC A 601' AC2 Software B FVC 601 ? 15 'binding site for Di-peptide FVC B 601 and LYS B 271' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 9 ALA A 69 ? ALA A 269 . ? 1_555 ? 2 AC1 9 LYS A 71 ? LYS A 271 . ? 1_555 ? 3 AC1 9 THR A 115 ? THR A 315 . ? 1_555 ? 4 AC1 9 GLU A 116 ? GLU A 316 . ? 1_555 ? 5 AC1 9 MET A 118 ? MET A 318 . ? 1_555 ? 6 AC1 9 GLY A 121 ? GLY A 321 . ? 1_555 ? 7 AC1 9 ASN A 122 ? ASN A 322 . ? 1_555 ? 8 AC1 9 LEU A 170 ? LEU A 370 . ? 1_555 ? 9 AC1 9 PHE A 182 ? PHE A 382 . ? 1_555 ? 10 AC2 15 LEU B 48 ? LEU B 248 . ? 1_555 ? 11 AC2 15 TYR B 53 ? TYR B 253 . ? 1_555 ? 12 AC2 15 VAL B 56 ? VAL B 256 . ? 1_555 ? 13 AC2 15 ALA B 69 ? ALA B 269 . ? 1_555 ? 14 AC2 15 VAL B 70 ? VAL B 270 . ? 1_555 ? 15 AC2 15 THR B 72 ? THR B 272 . ? 1_555 ? 16 AC2 15 PHE B 111 ? PHE B 311 . ? 1_555 ? 17 AC2 15 TYR B 112 ? TYR B 312 . ? 1_555 ? 18 AC2 15 ILE B 113 ? ILE B 313 . ? 1_555 ? 19 AC2 15 THR B 115 ? THR B 315 . ? 1_555 ? 20 AC2 15 GLU B 116 ? GLU B 316 . ? 1_555 ? 21 AC2 15 MET B 118 ? MET B 318 . ? 1_555 ? 22 AC2 15 ASN B 122 ? ASN B 322 . ? 1_555 ? 23 AC2 15 LEU B 170 ? LEU B 370 . ? 1_555 ? 24 AC2 15 PHE B 182 ? PHE B 382 . ? 1_555 ? # _atom_sites.entry_id 7CC2 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.008585 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.007816 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017618 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol B C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 201 ? ? ? A . n A 1 2 GLY 2 202 ? ? ? A . n A 1 3 SER 3 203 ? ? ? A . n A 1 4 SER 4 204 ? ? ? A . n A 1 5 HIS 5 205 ? ? ? A . n A 1 6 HIS 6 206 ? ? ? A . n A 1 7 HIS 7 207 ? ? ? A . n A 1 8 HIS 8 208 ? ? ? A . n A 1 9 HIS 9 209 ? ? ? A . n A 1 10 HIS 10 210 ? ? ? A . n A 1 11 SER 11 211 ? ? ? A . n A 1 12 SER 12 212 ? ? ? A . n A 1 13 GLY 13 213 ? ? ? A . n A 1 14 LEU 14 214 ? ? ? A . n A 1 15 VAL 15 215 ? ? ? A . n A 1 16 PRO 16 216 ? ? ? A . n A 1 17 ARG 17 217 ? ? ? A . n A 1 18 GLY 18 218 ? ? ? A . n A 1 19 SER 19 219 ? ? ? A . n A 1 20 HIS 20 220 ? ? ? A . n A 1 21 MET 21 221 ? ? ? A . n A 1 22 GLU 22 222 ? ? ? A . n A 1 23 ASN 23 223 ? ? ? A . n A 1 24 LEU 24 224 ? ? ? A . n A 1 25 TYR 25 225 ? ? ? A . n A 1 26 PHE 26 226 ? ? ? A . n A 1 27 GLN 27 227 ? ? ? A . n A 1 28 SER 28 228 ? ? ? A . n A 1 29 SER 29 229 ? ? ? A . n A 1 30 PRO 30 230 ? ? ? A . n A 1 31 ASN 31 231 ? ? ? A . n A 1 32 TYR 32 232 ? ? ? A . n A 1 33 ASP 33 233 233 ASP ASP A . n A 1 34 LYS 34 234 234 LYS LYS A . n A 1 35 TRP 35 235 235 TRP TRP A . n A 1 36 GLU 36 236 236 GLU GLU A . n A 1 37 MET 37 237 237 MET MET A . n A 1 38 GLU 38 238 238 GLU GLU A . n A 1 39 ARG 39 239 239 ARG ARG A . n A 1 40 THR 40 240 240 THR THR A . n A 1 41 ASP 41 241 241 ASP ASP A . n A 1 42 ILE 42 242 242 ILE ILE A . n A 1 43 THR 43 243 243 THR THR A . n A 1 44 MET 44 244 244 MET MET A . n A 1 45 LYS 45 245 245 LYS LYS A . n A 1 46 HIS 46 246 246 HIS HIS A . n A 1 47 LYS 47 247 247 LYS LYS A . n A 1 48 LEU 48 248 248 LEU LEU A . n A 1 49 GLY 49 249 ? ? ? A . n A 1 50 GLY 50 250 ? ? ? A . n A 1 51 GLY 51 251 ? ? ? A . n A 1 52 GLN 52 252 ? ? ? A . n A 1 53 TYR 53 253 ? ? ? A . n A 1 54 GLY 54 254 ? ? ? A . n A 1 55 GLU 55 255 255 GLU GLU A . n A 1 56 VAL 56 256 256 VAL VAL A . n A 1 57 TYR 57 257 257 TYR TYR A . n A 1 58 GLU 58 258 258 GLU GLU A . n A 1 59 GLY 59 259 259 GLY GLY A . n A 1 60 VAL 60 260 260 VAL VAL A . n A 1 61 TRP 61 261 261 TRP TRP A . n A 1 62 LYS 62 262 262 LYS LYS A . n A 1 63 LYS 63 263 263 LYS LYS A . n A 1 64 TYR 64 264 264 TYR TYR A . n A 1 65 SER 65 265 265 SER SER A . n A 1 66 LEU 66 266 266 LEU LEU A . n A 1 67 THR 67 267 267 THR THR A . n A 1 68 VAL 68 268 268 VAL VAL A . n A 1 69 ALA 69 269 269 ALA ALA A . n A 1 70 VAL 70 270 270 VAL VAL A . n A 1 71 LYS 71 271 271 LYS LLP A . n A 1 72 THR 72 272 272 THR THR A . n A 1 73 LEU 73 273 273 LEU LEU A . n A 1 74 LYS 74 274 274 LYS LYS A . n A 1 75 GLU 75 275 275 GLU GLU A . n A 1 76 ASP 76 276 276 ASP ASP A . n A 1 77 THR 77 277 277 THR THR A . n A 1 78 MET 78 278 278 MET MET A . n A 1 79 GLU 79 279 279 GLU GLU A . n A 1 80 VAL 80 280 280 VAL VAL A . n A 1 81 GLU 81 281 281 GLU GLU A . n A 1 82 GLU 82 282 282 GLU GLU A . n A 1 83 PHE 83 283 283 PHE PHE A . n A 1 84 LEU 84 284 284 LEU LEU A . n A 1 85 LYS 85 285 285 LYS LYS A . n A 1 86 GLU 86 286 286 GLU GLU A . n A 1 87 ALA 87 287 287 ALA ALA A . n A 1 88 ALA 88 288 288 ALA ALA A . n A 1 89 VAL 89 289 289 VAL VAL A . n A 1 90 MET 90 290 290 MET MET A . n A 1 91 LYS 91 291 291 LYS LYS A . n A 1 92 GLU 92 292 292 GLU GLU A . n A 1 93 ILE 93 293 293 ILE ILE A . n A 1 94 LYS 94 294 294 LYS LYS A . n A 1 95 HIS 95 295 295 HIS HIS A . n A 1 96 PRO 96 296 296 PRO PRO A . n A 1 97 ASN 97 297 297 ASN ASN A . n A 1 98 LEU 98 298 298 LEU LEU A . n A 1 99 VAL 99 299 299 VAL VAL A . n A 1 100 GLN 100 300 300 GLN GLN A . n A 1 101 LEU 101 301 301 LEU LEU A . n A 1 102 LEU 102 302 302 LEU LEU A . n A 1 103 GLY 103 303 303 GLY GLY A . n A 1 104 VAL 104 304 304 VAL VAL A . n A 1 105 CYS 105 305 305 CYS CYS A . n A 1 106 THR 106 306 306 THR THR A . n A 1 107 ARG 107 307 307 ARG ARG A . n A 1 108 GLU 108 308 308 GLU GLU A . n A 1 109 PRO 109 309 309 PRO PRO A . n A 1 110 PRO 110 310 310 PRO PRO A . n A 1 111 PHE 111 311 311 PHE PHE A . n A 1 112 TYR 112 312 312 TYR TYR A . n A 1 113 ILE 113 313 313 ILE ILE A . n A 1 114 ILE 114 314 314 ILE ILE A . n A 1 115 THR 115 315 315 THR THR A . n A 1 116 GLU 116 316 316 GLU GLU A . n A 1 117 PHE 117 317 317 PHE PHE A . n A 1 118 MET 118 318 318 MET MET A . n A 1 119 THR 119 319 319 THR THR A . n A 1 120 TYR 120 320 320 TYR TYR A . n A 1 121 GLY 121 321 321 GLY GLY A . n A 1 122 ASN 122 322 322 ASN ASN A . n A 1 123 LEU 123 323 323 LEU LEU A . n A 1 124 LEU 124 324 324 LEU LEU A . n A 1 125 ASP 125 325 325 ASP ASP A . n A 1 126 TYR 126 326 326 TYR TYR A . n A 1 127 LEU 127 327 327 LEU LEU A . n A 1 128 ARG 128 328 328 ARG ARG A . n A 1 129 GLU 129 329 329 GLU GLU A . n A 1 130 CYS 130 330 330 CYS CYS A . n A 1 131 ASN 131 331 331 ASN ASN A . n A 1 132 ARG 132 332 332 ARG ARG A . n A 1 133 GLN 133 333 333 GLN GLN A . n A 1 134 GLU 134 334 334 GLU GLU A . n A 1 135 VAL 135 335 335 VAL VAL A . n A 1 136 ASN 136 336 336 ASN ASN A . n A 1 137 ALA 137 337 337 ALA ALA A . n A 1 138 VAL 138 338 338 VAL VAL A . n A 1 139 VAL 139 339 339 VAL VAL A . n A 1 140 LEU 140 340 340 LEU LEU A . n A 1 141 LEU 141 341 341 LEU LEU A . n A 1 142 TYR 142 342 342 TYR TYR A . n A 1 143 MET 143 343 343 MET MET A . n A 1 144 ALA 144 344 344 ALA ALA A . n A 1 145 THR 145 345 345 THR THR A . n A 1 146 GLN 146 346 346 GLN GLN A . n A 1 147 ILE 147 347 347 ILE ILE A . n A 1 148 SER 148 348 348 SER SER A . n A 1 149 SER 149 349 349 SER SER A . n A 1 150 ALA 150 350 350 ALA ALA A . n A 1 151 MET 151 351 351 MET MET A . n A 1 152 GLU 152 352 352 GLU GLU A . n A 1 153 TYR 153 353 353 TYR TYR A . n A 1 154 LEU 154 354 354 LEU LEU A . n A 1 155 GLU 155 355 355 GLU GLU A . n A 1 156 LYS 156 356 356 LYS LYS A . n A 1 157 LYS 157 357 357 LYS LYS A . n A 1 158 ASN 158 358 358 ASN ASN A . n A 1 159 PHE 159 359 359 PHE PHE A . n A 1 160 ILE 160 360 360 ILE ILE A . n A 1 161 HIS 161 361 361 HIS HIS A . n A 1 162 ARG 162 362 362 ARG ARG A . n A 1 163 ASP 163 363 363 ASP ASP A . n A 1 164 LEU 164 364 364 LEU LEU A . n A 1 165 ALA 165 365 365 ALA ALA A . n A 1 166 ALA 166 366 366 ALA ALA A . n A 1 167 ARG 167 367 367 ARG ARG A . n A 1 168 ASN 168 368 368 ASN ASN A . n A 1 169 CYS 169 369 369 CYS CYS A . n A 1 170 LEU 170 370 370 LEU LEU A . n A 1 171 VAL 171 371 371 VAL VAL A . n A 1 172 GLY 172 372 372 GLY GLY A . n A 1 173 GLU 173 373 373 GLU GLU A . n A 1 174 ASN 174 374 374 ASN ASN A . n A 1 175 HIS 175 375 375 HIS HIS A . n A 1 176 LEU 176 376 376 LEU LEU A . n A 1 177 VAL 177 377 377 VAL VAL A . n A 1 178 LYS 178 378 378 LYS LYS A . n A 1 179 VAL 179 379 379 VAL VAL A . n A 1 180 ALA 180 380 380 ALA ALA A . n A 1 181 ASP 181 381 381 ASP ASP A . n A 1 182 PHE 182 382 382 PHE PHE A . n A 1 183 GLY 183 383 383 GLY GLY A . n A 1 184 LEU 184 384 384 LEU LEU A . n A 1 185 SER 185 385 385 SER SER A . n A 1 186 ARG 186 386 386 ARG ARG A . n A 1 187 LEU 187 387 387 LEU LEU A . n A 1 188 MET 188 388 388 MET MET A . n A 1 189 THR 189 389 389 THR THR A . n A 1 190 GLY 190 390 390 GLY GLY A . n A 1 191 ASP 191 391 391 ASP ASP A . n A 1 192 THR 192 392 392 THR THR A . n A 1 193 TYR 193 393 393 TYR TYR A . n A 1 194 THR 194 394 394 THR THR A . n A 1 195 ALA 195 395 395 ALA ALA A . n A 1 196 HIS 196 396 396 HIS HIS A . n A 1 197 ALA 197 397 397 ALA ALA A . n A 1 198 GLY 198 398 398 GLY GLY A . n A 1 199 ALA 199 399 399 ALA ALA A . n A 1 200 LYS 200 400 400 LYS LYS A . n A 1 201 PHE 201 401 401 PHE PHE A . n A 1 202 PRO 202 402 402 PRO PRO A . n A 1 203 ILE 203 403 403 ILE ILE A . n A 1 204 LYS 204 404 404 LYS LYS A . n A 1 205 TRP 205 405 405 TRP TRP A . n A 1 206 THR 206 406 406 THR THR A . n A 1 207 ALA 207 407 407 ALA ALA A . n A 1 208 PRO 208 408 408 PRO PRO A . n A 1 209 GLU 209 409 409 GLU GLU A . n A 1 210 SER 210 410 410 SER SER A . n A 1 211 LEU 211 411 411 LEU LEU A . n A 1 212 ALA 212 412 412 ALA ALA A . n A 1 213 TYR 213 413 413 TYR TYR A . n A 1 214 ASN 214 414 414 ASN ASN A . n A 1 215 LYS 215 415 415 LYS LYS A . n A 1 216 PHE 216 416 416 PHE PHE A . n A 1 217 SER 217 417 417 SER SER A . n A 1 218 ILE 218 418 418 ILE ILE A . n A 1 219 LYS 219 419 419 LYS LYS A . n A 1 220 SER 220 420 420 SER SER A . n A 1 221 ASP 221 421 421 ASP ASP A . n A 1 222 VAL 222 422 422 VAL VAL A . n A 1 223 TRP 223 423 423 TRP TRP A . n A 1 224 ALA 224 424 424 ALA ALA A . n A 1 225 PHE 225 425 425 PHE PHE A . n A 1 226 GLY 226 426 426 GLY GLY A . n A 1 227 VAL 227 427 427 VAL VAL A . n A 1 228 LEU 228 428 428 LEU LEU A . n A 1 229 LEU 229 429 429 LEU LEU A . n A 1 230 TRP 230 430 430 TRP TRP A . n A 1 231 GLU 231 431 431 GLU GLU A . n A 1 232 ILE 232 432 432 ILE ILE A . n A 1 233 ALA 233 433 433 ALA ALA A . n A 1 234 THR 234 434 434 THR THR A . n A 1 235 TYR 235 435 435 TYR TYR A . n A 1 236 GLY 236 436 436 GLY GLY A . n A 1 237 MET 237 437 437 MET MET A . n A 1 238 SER 238 438 438 SER SER A . n A 1 239 PRO 239 439 439 PRO PRO A . n A 1 240 TYR 240 440 440 TYR TYR A . n A 1 241 PRO 241 441 441 PRO PRO A . n A 1 242 GLY 242 442 442 GLY GLY A . n A 1 243 ILE 243 443 443 ILE ILE A . n A 1 244 ASP 244 444 444 ASP ASP A . n A 1 245 LEU 245 445 445 LEU LEU A . n A 1 246 SER 246 446 446 SER SER A . n A 1 247 GLN 247 447 447 GLN GLN A . n A 1 248 VAL 248 448 448 VAL VAL A . n A 1 249 TYR 249 449 449 TYR TYR A . n A 1 250 GLU 250 450 450 GLU GLU A . n A 1 251 LEU 251 451 451 LEU LEU A . n A 1 252 LEU 252 452 452 LEU LEU A . n A 1 253 GLU 253 453 453 GLU GLU A . n A 1 254 LYS 254 454 454 LYS LYS A . n A 1 255 ASP 255 455 455 ASP ASP A . n A 1 256 TYR 256 456 456 TYR TYR A . n A 1 257 ARG 257 457 457 ARG ARG A . n A 1 258 MET 258 458 458 MET MET A . n A 1 259 GLU 259 459 459 GLU GLU A . n A 1 260 ARG 260 460 460 ARG ARG A . n A 1 261 PRO 261 461 461 PRO PRO A . n A 1 262 GLU 262 462 462 GLU GLU A . n A 1 263 GLY 263 463 463 GLY GLY A . n A 1 264 CYS 264 464 464 CYS CYS A . n A 1 265 PRO 265 465 465 PRO PRO A . n A 1 266 GLU 266 466 466 GLU GLU A . n A 1 267 LYS 267 467 467 LYS LYS A . n A 1 268 VAL 268 468 468 VAL VAL A . n A 1 269 TYR 269 469 469 TYR TYR A . n A 1 270 GLU 270 470 470 GLU GLU A . n A 1 271 LEU 271 471 471 LEU LEU A . n A 1 272 MET 272 472 472 MET MET A . n A 1 273 ARG 273 473 473 ARG ARG A . n A 1 274 ALA 274 474 474 ALA ALA A . n A 1 275 CYS 275 475 475 CYS CYS A . n A 1 276 TRP 276 476 476 TRP TRP A . n A 1 277 GLN 277 477 477 GLN GLN A . n A 1 278 TRP 278 478 478 TRP TRP A . n A 1 279 ASN 279 479 479 ASN ASN A . n A 1 280 PRO 280 480 480 PRO PRO A . n A 1 281 SER 281 481 481 SER SER A . n A 1 282 ASP 282 482 482 ASP ASP A . n A 1 283 ARG 283 483 483 ARG ARG A . n A 1 284 PRO 284 484 484 PRO PRO A . n A 1 285 SER 285 485 485 SER SER A . n A 1 286 PHE 286 486 486 PHE PHE A . n A 1 287 ALA 287 487 487 ALA ALA A . n A 1 288 GLU 288 488 488 GLU GLU A . n A 1 289 ILE 289 489 489 ILE ILE A . n A 1 290 HIS 290 490 490 HIS HIS A . n A 1 291 GLN 291 491 491 GLN GLN A . n A 1 292 ALA 292 492 492 ALA ALA A . n A 1 293 PHE 293 493 493 PHE PHE A . n A 1 294 GLU 294 494 494 GLU GLU A . n A 1 295 THR 295 495 495 THR THR A . n A 1 296 MET 296 496 496 MET MET A . n A 1 297 PHE 297 497 497 PHE PHE A . n A 1 298 GLN 298 498 498 GLN GLN A . n A 1 299 GLU 299 499 499 GLU GLU A . n A 1 300 SER 300 500 500 SER SER A . n A 1 301 SER 301 501 501 SER SER A . n A 1 302 ILE 302 502 ? ? ? A . n A 1 303 SER 303 503 ? ? ? A . n A 1 304 ASP 304 504 ? ? ? A . n A 1 305 GLU 305 505 ? ? ? A . n A 1 306 VAL 306 506 ? ? ? A . n A 1 307 GLU 307 507 ? ? ? A . n A 1 308 LYS 308 508 ? ? ? A . n A 1 309 GLU 309 509 ? ? ? A . n A 1 310 LEU 310 510 ? ? ? A . n B 1 1 MET 1 201 ? ? ? B . n B 1 2 GLY 2 202 ? ? ? B . n B 1 3 SER 3 203 ? ? ? B . n B 1 4 SER 4 204 ? ? ? B . n B 1 5 HIS 5 205 ? ? ? B . n B 1 6 HIS 6 206 ? ? ? B . n B 1 7 HIS 7 207 ? ? ? B . n B 1 8 HIS 8 208 ? ? ? B . n B 1 9 HIS 9 209 ? ? ? B . n B 1 10 HIS 10 210 ? ? ? B . n B 1 11 SER 11 211 ? ? ? B . n B 1 12 SER 12 212 ? ? ? B . n B 1 13 GLY 13 213 ? ? ? B . n B 1 14 LEU 14 214 ? ? ? B . n B 1 15 VAL 15 215 ? ? ? B . n B 1 16 PRO 16 216 ? ? ? B . n B 1 17 ARG 17 217 ? ? ? B . n B 1 18 GLY 18 218 ? ? ? B . n B 1 19 SER 19 219 ? ? ? B . n B 1 20 HIS 20 220 ? ? ? B . n B 1 21 MET 21 221 ? ? ? B . n B 1 22 GLU 22 222 ? ? ? B . n B 1 23 ASN 23 223 ? ? ? B . n B 1 24 LEU 24 224 ? ? ? B . n B 1 25 TYR 25 225 ? ? ? B . n B 1 26 PHE 26 226 ? ? ? B . n B 1 27 GLN 27 227 ? ? ? B . n B 1 28 SER 28 228 ? ? ? B . n B 1 29 SER 29 229 ? ? ? B . n B 1 30 PRO 30 230 ? ? ? B . n B 1 31 ASN 31 231 ? ? ? B . n B 1 32 TYR 32 232 232 TYR TYR B . n B 1 33 ASP 33 233 233 ASP ASP B . n B 1 34 LYS 34 234 234 LYS LYS B . n B 1 35 TRP 35 235 235 TRP TRP B . n B 1 36 GLU 36 236 236 GLU GLU B . n B 1 37 MET 37 237 237 MET MET B . n B 1 38 GLU 38 238 238 GLU GLU B . n B 1 39 ARG 39 239 239 ARG ARG B . n B 1 40 THR 40 240 240 THR THR B . n B 1 41 ASP 41 241 241 ASP ASP B . n B 1 42 ILE 42 242 242 ILE ILE B . n B 1 43 THR 43 243 243 THR THR B . n B 1 44 MET 44 244 244 MET MET B . n B 1 45 LYS 45 245 245 LYS LYS B . n B 1 46 HIS 46 246 246 HIS HIS B . n B 1 47 LYS 47 247 247 LYS LYS B . n B 1 48 LEU 48 248 248 LEU LEU B . n B 1 49 GLY 49 249 ? ? ? B . n B 1 50 GLY 50 250 ? ? ? B . n B 1 51 GLY 51 251 ? ? ? B . n B 1 52 GLN 52 252 ? ? ? B . n B 1 53 TYR 53 253 253 TYR TYR B . n B 1 54 GLY 54 254 254 GLY GLY B . n B 1 55 GLU 55 255 255 GLU GLU B . n B 1 56 VAL 56 256 256 VAL VAL B . n B 1 57 TYR 57 257 257 TYR TYR B . n B 1 58 GLU 58 258 258 GLU GLU B . n B 1 59 GLY 59 259 259 GLY GLY B . n B 1 60 VAL 60 260 260 VAL VAL B . n B 1 61 TRP 61 261 261 TRP TRP B . n B 1 62 LYS 62 262 262 LYS LYS B . n B 1 63 LYS 63 263 263 LYS LYS B . n B 1 64 TYR 64 264 264 TYR TYR B . n B 1 65 SER 65 265 265 SER SER B . n B 1 66 LEU 66 266 266 LEU LEU B . n B 1 67 THR 67 267 267 THR THR B . n B 1 68 VAL 68 268 268 VAL VAL B . n B 1 69 ALA 69 269 269 ALA ALA B . n B 1 70 VAL 70 270 270 VAL VAL B . n B 1 71 LYS 71 271 271 LYS LLP B . n B 1 72 THR 72 272 272 THR THR B . n B 1 73 LEU 73 273 273 LEU LEU B . n B 1 74 LYS 74 274 274 LYS LYS B . n B 1 75 GLU 75 275 275 GLU GLU B . n B 1 76 ASP 76 276 276 ASP ASP B . n B 1 77 THR 77 277 277 THR THR B . n B 1 78 MET 78 278 278 MET MET B . n B 1 79 GLU 79 279 279 GLU GLU B . n B 1 80 VAL 80 280 280 VAL VAL B . n B 1 81 GLU 81 281 281 GLU GLU B . n B 1 82 GLU 82 282 282 GLU GLU B . n B 1 83 PHE 83 283 283 PHE PHE B . n B 1 84 LEU 84 284 284 LEU LEU B . n B 1 85 LYS 85 285 285 LYS LYS B . n B 1 86 GLU 86 286 286 GLU GLU B . n B 1 87 ALA 87 287 287 ALA ALA B . n B 1 88 ALA 88 288 288 ALA ALA B . n B 1 89 VAL 89 289 289 VAL VAL B . n B 1 90 MET 90 290 290 MET MET B . n B 1 91 LYS 91 291 291 LYS LYS B . n B 1 92 GLU 92 292 292 GLU GLU B . n B 1 93 ILE 93 293 293 ILE ILE B . n B 1 94 LYS 94 294 294 LYS LYS B . n B 1 95 HIS 95 295 295 HIS HIS B . n B 1 96 PRO 96 296 296 PRO PRO B . n B 1 97 ASN 97 297 297 ASN ASN B . n B 1 98 LEU 98 298 298 LEU LEU B . n B 1 99 VAL 99 299 299 VAL VAL B . n B 1 100 GLN 100 300 300 GLN GLN B . n B 1 101 LEU 101 301 301 LEU LEU B . n B 1 102 LEU 102 302 302 LEU LEU B . n B 1 103 GLY 103 303 303 GLY GLY B . n B 1 104 VAL 104 304 304 VAL VAL B . n B 1 105 CYS 105 305 305 CYS CYS B . n B 1 106 THR 106 306 306 THR THR B . n B 1 107 ARG 107 307 307 ARG ARG B . n B 1 108 GLU 108 308 308 GLU GLU B . n B 1 109 PRO 109 309 309 PRO PRO B . n B 1 110 PRO 110 310 310 PRO PRO B . n B 1 111 PHE 111 311 311 PHE PHE B . n B 1 112 TYR 112 312 312 TYR TYR B . n B 1 113 ILE 113 313 313 ILE ILE B . n B 1 114 ILE 114 314 314 ILE ILE B . n B 1 115 THR 115 315 315 THR THR B . n B 1 116 GLU 116 316 316 GLU GLU B . n B 1 117 PHE 117 317 317 PHE PHE B . n B 1 118 MET 118 318 318 MET MET B . n B 1 119 THR 119 319 319 THR THR B . n B 1 120 TYR 120 320 320 TYR TYR B . n B 1 121 GLY 121 321 321 GLY GLY B . n B 1 122 ASN 122 322 322 ASN ASN B . n B 1 123 LEU 123 323 323 LEU LEU B . n B 1 124 LEU 124 324 324 LEU LEU B . n B 1 125 ASP 125 325 325 ASP ASP B . n B 1 126 TYR 126 326 326 TYR TYR B . n B 1 127 LEU 127 327 327 LEU LEU B . n B 1 128 ARG 128 328 328 ARG ARG B . n B 1 129 GLU 129 329 329 GLU GLU B . n B 1 130 CYS 130 330 330 CYS CYS B . n B 1 131 ASN 131 331 331 ASN ASN B . n B 1 132 ARG 132 332 332 ARG ARG B . n B 1 133 GLN 133 333 333 GLN GLN B . n B 1 134 GLU 134 334 334 GLU GLU B . n B 1 135 VAL 135 335 335 VAL VAL B . n B 1 136 ASN 136 336 336 ASN ASN B . n B 1 137 ALA 137 337 337 ALA ALA B . n B 1 138 VAL 138 338 338 VAL VAL B . n B 1 139 VAL 139 339 339 VAL VAL B . n B 1 140 LEU 140 340 340 LEU LEU B . n B 1 141 LEU 141 341 341 LEU LEU B . n B 1 142 TYR 142 342 342 TYR TYR B . n B 1 143 MET 143 343 343 MET MET B . n B 1 144 ALA 144 344 344 ALA ALA B . n B 1 145 THR 145 345 345 THR THR B . n B 1 146 GLN 146 346 346 GLN GLN B . n B 1 147 ILE 147 347 347 ILE ILE B . n B 1 148 SER 148 348 348 SER SER B . n B 1 149 SER 149 349 349 SER SER B . n B 1 150 ALA 150 350 350 ALA ALA B . n B 1 151 MET 151 351 351 MET MET B . n B 1 152 GLU 152 352 352 GLU GLU B . n B 1 153 TYR 153 353 353 TYR TYR B . n B 1 154 LEU 154 354 354 LEU LEU B . n B 1 155 GLU 155 355 355 GLU GLU B . n B 1 156 LYS 156 356 356 LYS LYS B . n B 1 157 LYS 157 357 357 LYS LYS B . n B 1 158 ASN 158 358 358 ASN ASN B . n B 1 159 PHE 159 359 359 PHE PHE B . n B 1 160 ILE 160 360 360 ILE ILE B . n B 1 161 HIS 161 361 361 HIS HIS B . n B 1 162 ARG 162 362 362 ARG ARG B . n B 1 163 ASP 163 363 363 ASP ASP B . n B 1 164 LEU 164 364 364 LEU LEU B . n B 1 165 ALA 165 365 365 ALA ALA B . n B 1 166 ALA 166 366 366 ALA ALA B . n B 1 167 ARG 167 367 367 ARG ARG B . n B 1 168 ASN 168 368 368 ASN ASN B . n B 1 169 CYS 169 369 369 CYS CYS B . n B 1 170 LEU 170 370 370 LEU LEU B . n B 1 171 VAL 171 371 371 VAL VAL B . n B 1 172 GLY 172 372 372 GLY GLY B . n B 1 173 GLU 173 373 373 GLU GLU B . n B 1 174 ASN 174 374 374 ASN ASN B . n B 1 175 HIS 175 375 375 HIS HIS B . n B 1 176 LEU 176 376 376 LEU LEU B . n B 1 177 VAL 177 377 377 VAL VAL B . n B 1 178 LYS 178 378 378 LYS LYS B . n B 1 179 VAL 179 379 379 VAL VAL B . n B 1 180 ALA 180 380 380 ALA ALA B . n B 1 181 ASP 181 381 381 ASP ASP B . n B 1 182 PHE 182 382 382 PHE PHE B . n B 1 183 GLY 183 383 383 GLY GLY B . n B 1 184 LEU 184 384 384 LEU LEU B . n B 1 185 SER 185 385 385 SER SER B . n B 1 186 ARG 186 386 386 ARG ARG B . n B 1 187 LEU 187 387 387 LEU LEU B . n B 1 188 MET 188 388 388 MET MET B . n B 1 189 THR 189 389 389 THR THR B . n B 1 190 GLY 190 390 390 GLY GLY B . n B 1 191 ASP 191 391 391 ASP ASP B . n B 1 192 THR 192 392 392 THR THR B . n B 1 193 TYR 193 393 393 TYR TYR B . n B 1 194 THR 194 394 394 THR THR B . n B 1 195 ALA 195 395 395 ALA ALA B . n B 1 196 HIS 196 396 396 HIS HIS B . n B 1 197 ALA 197 397 397 ALA ALA B . n B 1 198 GLY 198 398 398 GLY GLY B . n B 1 199 ALA 199 399 399 ALA ALA B . n B 1 200 LYS 200 400 400 LYS LYS B . n B 1 201 PHE 201 401 401 PHE PHE B . n B 1 202 PRO 202 402 402 PRO PRO B . n B 1 203 ILE 203 403 403 ILE ILE B . n B 1 204 LYS 204 404 404 LYS LYS B . n B 1 205 TRP 205 405 405 TRP TRP B . n B 1 206 THR 206 406 406 THR THR B . n B 1 207 ALA 207 407 407 ALA ALA B . n B 1 208 PRO 208 408 408 PRO PRO B . n B 1 209 GLU 209 409 409 GLU GLU B . n B 1 210 SER 210 410 410 SER SER B . n B 1 211 LEU 211 411 411 LEU LEU B . n B 1 212 ALA 212 412 412 ALA ALA B . n B 1 213 TYR 213 413 413 TYR TYR B . n B 1 214 ASN 214 414 414 ASN ASN B . n B 1 215 LYS 215 415 415 LYS LYS B . n B 1 216 PHE 216 416 416 PHE PHE B . n B 1 217 SER 217 417 417 SER SER B . n B 1 218 ILE 218 418 418 ILE ILE B . n B 1 219 LYS 219 419 419 LYS LYS B . n B 1 220 SER 220 420 420 SER SER B . n B 1 221 ASP 221 421 421 ASP ASP B . n B 1 222 VAL 222 422 422 VAL VAL B . n B 1 223 TRP 223 423 423 TRP TRP B . n B 1 224 ALA 224 424 424 ALA ALA B . n B 1 225 PHE 225 425 425 PHE PHE B . n B 1 226 GLY 226 426 426 GLY GLY B . n B 1 227 VAL 227 427 427 VAL VAL B . n B 1 228 LEU 228 428 428 LEU LEU B . n B 1 229 LEU 229 429 429 LEU LEU B . n B 1 230 TRP 230 430 430 TRP TRP B . n B 1 231 GLU 231 431 431 GLU GLU B . n B 1 232 ILE 232 432 432 ILE ILE B . n B 1 233 ALA 233 433 433 ALA ALA B . n B 1 234 THR 234 434 434 THR THR B . n B 1 235 TYR 235 435 435 TYR TYR B . n B 1 236 GLY 236 436 436 GLY GLY B . n B 1 237 MET 237 437 437 MET MET B . n B 1 238 SER 238 438 438 SER SER B . n B 1 239 PRO 239 439 439 PRO PRO B . n B 1 240 TYR 240 440 440 TYR TYR B . n B 1 241 PRO 241 441 441 PRO PRO B . n B 1 242 GLY 242 442 442 GLY GLY B . n B 1 243 ILE 243 443 443 ILE ILE B . n B 1 244 ASP 244 444 444 ASP ASP B . n B 1 245 LEU 245 445 445 LEU LEU B . n B 1 246 SER 246 446 446 SER SER B . n B 1 247 GLN 247 447 447 GLN GLN B . n B 1 248 VAL 248 448 448 VAL VAL B . n B 1 249 TYR 249 449 449 TYR TYR B . n B 1 250 GLU 250 450 450 GLU GLU B . n B 1 251 LEU 251 451 451 LEU LEU B . n B 1 252 LEU 252 452 452 LEU LEU B . n B 1 253 GLU 253 453 453 GLU GLU B . n B 1 254 LYS 254 454 454 LYS LYS B . n B 1 255 ASP 255 455 455 ASP ASP B . n B 1 256 TYR 256 456 456 TYR TYR B . n B 1 257 ARG 257 457 457 ARG ARG B . n B 1 258 MET 258 458 458 MET MET B . n B 1 259 GLU 259 459 459 GLU GLU B . n B 1 260 ARG 260 460 460 ARG ARG B . n B 1 261 PRO 261 461 461 PRO PRO B . n B 1 262 GLU 262 462 462 GLU GLU B . n B 1 263 GLY 263 463 463 GLY GLY B . n B 1 264 CYS 264 464 464 CYS CYS B . n B 1 265 PRO 265 465 465 PRO PRO B . n B 1 266 GLU 266 466 466 GLU GLU B . n B 1 267 LYS 267 467 467 LYS LYS B . n B 1 268 VAL 268 468 468 VAL VAL B . n B 1 269 TYR 269 469 469 TYR TYR B . n B 1 270 GLU 270 470 470 GLU GLU B . n B 1 271 LEU 271 471 471 LEU LEU B . n B 1 272 MET 272 472 472 MET MET B . n B 1 273 ARG 273 473 473 ARG ARG B . n B 1 274 ALA 274 474 474 ALA ALA B . n B 1 275 CYS 275 475 475 CYS CYS B . n B 1 276 TRP 276 476 476 TRP TRP B . n B 1 277 GLN 277 477 477 GLN GLN B . n B 1 278 TRP 278 478 478 TRP TRP B . n B 1 279 ASN 279 479 479 ASN ASN B . n B 1 280 PRO 280 480 480 PRO PRO B . n B 1 281 SER 281 481 481 SER SER B . n B 1 282 ASP 282 482 482 ASP ASP B . n B 1 283 ARG 283 483 483 ARG ARG B . n B 1 284 PRO 284 484 484 PRO PRO B . n B 1 285 SER 285 485 485 SER SER B . n B 1 286 PHE 286 486 486 PHE PHE B . n B 1 287 ALA 287 487 487 ALA ALA B . n B 1 288 GLU 288 488 488 GLU GLU B . n B 1 289 ILE 289 489 489 ILE ILE B . n B 1 290 HIS 290 490 490 HIS HIS B . n B 1 291 GLN 291 491 491 GLN GLN B . n B 1 292 ALA 292 492 492 ALA ALA B . n B 1 293 PHE 293 493 493 PHE PHE B . n B 1 294 GLU 294 494 494 GLU GLU B . n B 1 295 THR 295 495 495 THR THR B . n B 1 296 MET 296 496 496 MET MET B . n B 1 297 PHE 297 497 497 PHE PHE B . n B 1 298 GLN 298 498 498 GLN GLN B . n B 1 299 GLU 299 499 499 GLU GLU B . n B 1 300 SER 300 500 500 SER SER B . n B 1 301 SER 301 501 501 SER SER B . n B 1 302 ILE 302 502 ? ? ? B . n B 1 303 SER 303 503 ? ? ? B . n B 1 304 ASP 304 504 ? ? ? B . n B 1 305 GLU 305 505 ? ? ? B . n B 1 306 VAL 306 506 ? ? ? B . n B 1 307 GLU 307 507 ? ? ? B . n B 1 308 LYS 308 508 ? ? ? B . n B 1 309 GLU 309 509 ? ? ? B . n B 1 310 LEU 310 510 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 FVC 1 601 271 FVC LLP A . D 2 FVC 1 601 271 FVC LLP B . E 3 HOH 1 701 33 HOH HOH A . E 3 HOH 2 702 41 HOH HOH A . E 3 HOH 3 703 4 HOH HOH A . E 3 HOH 4 704 12 HOH HOH A . E 3 HOH 5 705 13 HOH HOH A . E 3 HOH 6 706 42 HOH HOH A . E 3 HOH 7 707 8 HOH HOH A . E 3 HOH 8 708 11 HOH HOH A . E 3 HOH 9 709 3 HOH HOH A . E 3 HOH 10 710 9 HOH HOH A . E 3 HOH 11 711 2 HOH HOH A . E 3 HOH 12 712 19 HOH HOH A . E 3 HOH 13 713 17 HOH HOH A . E 3 HOH 14 714 18 HOH HOH A . E 3 HOH 15 715 34 HOH HOH A . E 3 HOH 16 716 26 HOH HOH A . E 3 HOH 17 717 23 HOH HOH A . E 3 HOH 18 718 44 HOH HOH A . E 3 HOH 19 719 43 HOH HOH A . E 3 HOH 20 720 20 HOH HOH A . E 3 HOH 21 721 39 HOH HOH A . E 3 HOH 22 722 36 HOH HOH A . E 3 HOH 23 723 31 HOH HOH A . E 3 HOH 24 724 40 HOH HOH A . E 3 HOH 25 725 38 HOH HOH A . E 3 HOH 26 726 37 HOH HOH A . E 3 HOH 27 727 15 HOH HOH A . E 3 HOH 28 728 21 HOH HOH A . E 3 HOH 29 729 30 HOH HOH A . E 3 HOH 30 730 35 HOH HOH A . E 3 HOH 31 731 24 HOH HOH A . F 3 HOH 1 701 32 HOH HOH B . F 3 HOH 2 702 10 HOH HOH B . F 3 HOH 3 703 29 HOH HOH B . F 3 HOH 4 704 1 HOH HOH B . F 3 HOH 5 705 6 HOH HOH B . F 3 HOH 6 706 22 HOH HOH B . F 3 HOH 7 707 25 HOH HOH B . F 3 HOH 8 708 28 HOH HOH B . F 3 HOH 9 709 5 HOH HOH B . F 3 HOH 10 710 7 HOH HOH B . F 3 HOH 11 711 27 HOH HOH B . F 3 HOH 12 712 16 HOH HOH B . F 3 HOH 13 713 14 HOH HOH B . F 3 HOH 14 714 45 HOH HOH B . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 author_defined_assembly ? monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,C,E 2 1 B,D,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-06-09 2 'Structure model' 1 1 2021-07-28 3 'Structure model' 1 2 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model 7 3 'Structure model' struct_ncs_dom_lim # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.title' 5 2 'Structure model' '_citation_author.identifier_ORCID' 6 2 'Structure model' '_citation_author.name' 7 3 'Structure model' '_database_2.pdbx_DOI' 8 3 'Structure model' '_database_2.pdbx_database_accession' 9 3 'Structure model' '_struct_ncs_dom_lim.beg_auth_comp_id' 10 3 'Structure model' '_struct_ncs_dom_lim.beg_label_asym_id' 11 3 'Structure model' '_struct_ncs_dom_lim.beg_label_comp_id' 12 3 'Structure model' '_struct_ncs_dom_lim.beg_label_seq_id' 13 3 'Structure model' '_struct_ncs_dom_lim.end_auth_comp_id' 14 3 'Structure model' '_struct_ncs_dom_lim.end_label_asym_id' 15 3 'Structure model' '_struct_ncs_dom_lim.end_label_comp_id' 16 3 'Structure model' '_struct_ncs_dom_lim.end_label_seq_id' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.11.1_2575 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.7.2 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_entry_details.entry_id 7CC2 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 C A VAL 270 ? ? N A LYS 271 ? ? CA A LYS 271 ? ? 104.62 121.70 -17.08 2.50 Y 2 1 CA B VAL 270 ? ? C B VAL 270 ? ? N B LYS 271 ? ? 101.10 117.20 -16.10 2.20 Y 3 1 O B VAL 270 ? ? C B VAL 270 ? ? N B LYS 271 ? ? 138.00 122.70 15.30 1.60 Y 4 1 C B VAL 270 ? ? N B LYS 271 ? ? CA B LYS 271 ? ? 102.76 121.70 -18.94 2.50 Y 5 1 CA B LYS 271 ? ? C B LYS 271 ? ? N B THR 272 ? ? 98.88 117.20 -18.32 2.20 Y 6 1 O B LYS 271 ? ? C B LYS 271 ? ? N B THR 272 ? ? 134.29 122.70 11.59 1.60 Y 7 1 C B LYS 271 ? ? N B THR 272 ? ? CA B THR 272 ? ? 101.08 121.70 -20.62 2.50 Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 245 ? ? -112.17 -74.40 2 1 LYS A 274 ? ? -63.67 -74.26 3 1 ASP A 276 ? ? -108.97 78.12 4 1 ASP A 363 ? ? -155.74 56.48 5 1 ASP A 381 ? ? -109.30 64.01 6 1 ASP B 233 ? ? -149.18 -158.42 7 1 LYS B 245 ? ? -111.30 -88.12 8 1 GLU B 255 ? ? -107.03 66.62 9 1 ASP B 276 ? ? -109.28 65.00 10 1 GLU B 279 ? ? -75.18 42.42 11 1 ASP B 363 ? ? -154.42 55.13 12 1 ASP B 381 ? ? -110.49 61.26 # loop_ _pdbx_validate_main_chain_plane.id _pdbx_validate_main_chain_plane.PDB_model_num _pdbx_validate_main_chain_plane.auth_comp_id _pdbx_validate_main_chain_plane.auth_asym_id _pdbx_validate_main_chain_plane.auth_seq_id _pdbx_validate_main_chain_plane.PDB_ins_code _pdbx_validate_main_chain_plane.label_alt_id _pdbx_validate_main_chain_plane.improper_torsion_angle 1 1 LYS A 271 ? ? 13.22 2 1 LYS B 271 ? ? 12.39 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 275 ? CG ? A GLU 75 CG 2 1 Y 1 A GLU 275 ? CD ? A GLU 75 CD 3 1 Y 1 A GLU 275 ? OE1 ? A GLU 75 OE1 4 1 Y 1 A GLU 275 ? OE2 ? A GLU 75 OE2 5 1 Y 1 A MET 278 ? CG ? A MET 78 CG 6 1 Y 1 A MET 278 ? SD ? A MET 78 SD 7 1 Y 1 A MET 278 ? CE ? A MET 78 CE 8 1 Y 1 A GLU 279 ? CG ? A GLU 79 CG 9 1 Y 1 A GLU 279 ? CD ? A GLU 79 CD 10 1 Y 1 A GLU 279 ? OE1 ? A GLU 79 OE1 11 1 Y 1 A GLU 279 ? OE2 ? A GLU 79 OE2 12 1 Y 1 A VAL 280 ? CG1 ? A VAL 80 CG1 13 1 Y 1 A VAL 280 ? CG2 ? A VAL 80 CG2 14 1 Y 1 A GLU 281 ? CG ? A GLU 81 CG 15 1 Y 1 A GLU 281 ? CD ? A GLU 81 CD 16 1 Y 1 A GLU 281 ? OE1 ? A GLU 81 OE1 17 1 Y 1 A GLU 281 ? OE2 ? A GLU 81 OE2 18 1 Y 1 A GLU 282 ? CG ? A GLU 82 CG 19 1 Y 1 A GLU 282 ? CD ? A GLU 82 CD 20 1 Y 1 A GLU 282 ? OE1 ? A GLU 82 OE1 21 1 Y 1 A GLU 282 ? OE2 ? A GLU 82 OE2 22 1 Y 1 A PHE 283 ? CG ? A PHE 83 CG 23 1 Y 1 A PHE 283 ? CD1 ? A PHE 83 CD1 24 1 Y 1 A PHE 283 ? CD2 ? A PHE 83 CD2 25 1 Y 1 A PHE 283 ? CE1 ? A PHE 83 CE1 26 1 Y 1 A PHE 283 ? CE2 ? A PHE 83 CE2 27 1 Y 1 A PHE 283 ? CZ ? A PHE 83 CZ 28 1 Y 1 A ARG 307 ? CD ? A ARG 107 CD 29 1 Y 1 A ARG 307 ? NE ? A ARG 107 NE 30 1 Y 1 A ARG 307 ? CZ ? A ARG 107 CZ 31 1 Y 1 A ARG 307 ? NH1 ? A ARG 107 NH1 32 1 Y 1 A ARG 307 ? NH2 ? A ARG 107 NH2 33 1 Y 1 A GLU 373 ? CG ? A GLU 173 CG 34 1 Y 1 A GLU 373 ? CD ? A GLU 173 CD 35 1 Y 1 A GLU 373 ? OE1 ? A GLU 173 OE1 36 1 Y 1 A GLU 373 ? OE2 ? A GLU 173 OE2 37 1 Y 1 A GLU 409 ? CG ? A GLU 209 CG 38 1 Y 1 A GLU 409 ? CD ? A GLU 209 CD 39 1 Y 1 A GLU 409 ? OE1 ? A GLU 209 OE1 40 1 Y 1 A GLU 409 ? OE2 ? A GLU 209 OE2 41 1 Y 1 A LYS 415 ? CD ? A LYS 215 CD 42 1 Y 1 A LYS 415 ? CE ? A LYS 215 CE 43 1 Y 1 A LYS 415 ? NZ ? A LYS 215 NZ 44 1 Y 1 A GLU 459 ? CG ? A GLU 259 CG 45 1 Y 1 A GLU 459 ? CD ? A GLU 259 CD 46 1 Y 1 A GLU 459 ? OE1 ? A GLU 259 OE1 47 1 Y 1 A GLU 459 ? OE2 ? A GLU 259 OE2 48 1 Y 1 A SER 501 ? OG ? A SER 301 OG 49 1 Y 1 B TYR 232 ? CG ? B TYR 32 CG 50 1 Y 1 B TYR 232 ? CD1 ? B TYR 32 CD1 51 1 Y 1 B TYR 232 ? CD2 ? B TYR 32 CD2 52 1 Y 1 B TYR 232 ? CE1 ? B TYR 32 CE1 53 1 Y 1 B TYR 232 ? CE2 ? B TYR 32 CE2 54 1 Y 1 B TYR 232 ? CZ ? B TYR 32 CZ 55 1 Y 1 B TYR 232 ? OH ? B TYR 32 OH 56 1 Y 1 B GLU 238 ? CG ? B GLU 38 CG 57 1 Y 1 B GLU 238 ? CD ? B GLU 38 CD 58 1 Y 1 B GLU 238 ? OE1 ? B GLU 38 OE1 59 1 Y 1 B GLU 238 ? OE2 ? B GLU 38 OE2 60 1 Y 1 B LYS 263 ? CG ? B LYS 63 CG 61 1 Y 1 B LYS 263 ? CD ? B LYS 63 CD 62 1 Y 1 B LYS 263 ? CE ? B LYS 63 CE 63 1 Y 1 B LYS 263 ? NZ ? B LYS 63 NZ 64 1 Y 1 B GLU 275 ? CG ? B GLU 75 CG 65 1 Y 1 B GLU 275 ? CD ? B GLU 75 CD 66 1 Y 1 B GLU 275 ? OE1 ? B GLU 75 OE1 67 1 Y 1 B GLU 275 ? OE2 ? B GLU 75 OE2 68 1 Y 1 B GLU 279 ? CG ? B GLU 79 CG 69 1 Y 1 B GLU 279 ? CD ? B GLU 79 CD 70 1 Y 1 B GLU 279 ? OE1 ? B GLU 79 OE1 71 1 Y 1 B GLU 279 ? OE2 ? B GLU 79 OE2 72 1 Y 1 B GLU 286 ? CG ? B GLU 86 CG 73 1 Y 1 B GLU 286 ? CD ? B GLU 86 CD 74 1 Y 1 B GLU 286 ? OE1 ? B GLU 86 OE1 75 1 Y 1 B GLU 286 ? OE2 ? B GLU 86 OE2 76 1 Y 1 B HIS 396 ? CG ? B HIS 196 CG 77 1 Y 1 B HIS 396 ? ND1 ? B HIS 196 ND1 78 1 Y 1 B HIS 396 ? CD2 ? B HIS 196 CD2 79 1 Y 1 B HIS 396 ? CE1 ? B HIS 196 CE1 80 1 Y 1 B HIS 396 ? NE2 ? B HIS 196 NE2 81 1 Y 1 B LYS 400 ? CG ? B LYS 200 CG 82 1 Y 1 B LYS 400 ? CD ? B LYS 200 CD 83 1 Y 1 B LYS 400 ? CE ? B LYS 200 CE 84 1 Y 1 B LYS 400 ? NZ ? B LYS 200 NZ 85 1 Y 1 B ASP 444 ? CG ? B ASP 244 CG 86 1 Y 1 B ASP 444 ? OD1 ? B ASP 244 OD1 87 1 Y 1 B ASP 444 ? OD2 ? B ASP 244 OD2 88 1 Y 1 B GLU 462 ? CG ? B GLU 262 CG 89 1 Y 1 B GLU 462 ? CD ? B GLU 262 CD 90 1 Y 1 B GLU 462 ? OE1 ? B GLU 262 OE1 91 1 Y 1 B GLU 462 ? OE2 ? B GLU 262 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 201 ? A MET 1 2 1 Y 1 A GLY 202 ? A GLY 2 3 1 Y 1 A SER 203 ? A SER 3 4 1 Y 1 A SER 204 ? A SER 4 5 1 Y 1 A HIS 205 ? A HIS 5 6 1 Y 1 A HIS 206 ? A HIS 6 7 1 Y 1 A HIS 207 ? A HIS 7 8 1 Y 1 A HIS 208 ? A HIS 8 9 1 Y 1 A HIS 209 ? A HIS 9 10 1 Y 1 A HIS 210 ? A HIS 10 11 1 Y 1 A SER 211 ? A SER 11 12 1 Y 1 A SER 212 ? A SER 12 13 1 Y 1 A GLY 213 ? A GLY 13 14 1 Y 1 A LEU 214 ? A LEU 14 15 1 Y 1 A VAL 215 ? A VAL 15 16 1 Y 1 A PRO 216 ? A PRO 16 17 1 Y 1 A ARG 217 ? A ARG 17 18 1 Y 1 A GLY 218 ? A GLY 18 19 1 Y 1 A SER 219 ? A SER 19 20 1 Y 1 A HIS 220 ? A HIS 20 21 1 Y 1 A MET 221 ? A MET 21 22 1 Y 1 A GLU 222 ? A GLU 22 23 1 Y 1 A ASN 223 ? A ASN 23 24 1 Y 1 A LEU 224 ? A LEU 24 25 1 Y 1 A TYR 225 ? A TYR 25 26 1 Y 1 A PHE 226 ? A PHE 26 27 1 Y 1 A GLN 227 ? A GLN 27 28 1 Y 1 A SER 228 ? A SER 28 29 1 Y 1 A SER 229 ? A SER 29 30 1 Y 1 A PRO 230 ? A PRO 30 31 1 Y 1 A ASN 231 ? A ASN 31 32 1 Y 1 A TYR 232 ? A TYR 32 33 1 Y 1 A GLY 249 ? A GLY 49 34 1 Y 1 A GLY 250 ? A GLY 50 35 1 Y 1 A GLY 251 ? A GLY 51 36 1 Y 1 A GLN 252 ? A GLN 52 37 1 Y 1 A TYR 253 ? A TYR 53 38 1 Y 1 A GLY 254 ? A GLY 54 39 1 Y 1 A ILE 502 ? A ILE 302 40 1 Y 1 A SER 503 ? A SER 303 41 1 Y 1 A ASP 504 ? A ASP 304 42 1 Y 1 A GLU 505 ? A GLU 305 43 1 Y 1 A VAL 506 ? A VAL 306 44 1 Y 1 A GLU 507 ? A GLU 307 45 1 Y 1 A LYS 508 ? A LYS 308 46 1 Y 1 A GLU 509 ? A GLU 309 47 1 Y 1 A LEU 510 ? A LEU 310 48 1 Y 1 B MET 201 ? B MET 1 49 1 Y 1 B GLY 202 ? B GLY 2 50 1 Y 1 B SER 203 ? B SER 3 51 1 Y 1 B SER 204 ? B SER 4 52 1 Y 1 B HIS 205 ? B HIS 5 53 1 Y 1 B HIS 206 ? B HIS 6 54 1 Y 1 B HIS 207 ? B HIS 7 55 1 Y 1 B HIS 208 ? B HIS 8 56 1 Y 1 B HIS 209 ? B HIS 9 57 1 Y 1 B HIS 210 ? B HIS 10 58 1 Y 1 B SER 211 ? B SER 11 59 1 Y 1 B SER 212 ? B SER 12 60 1 Y 1 B GLY 213 ? B GLY 13 61 1 Y 1 B LEU 214 ? B LEU 14 62 1 Y 1 B VAL 215 ? B VAL 15 63 1 Y 1 B PRO 216 ? B PRO 16 64 1 Y 1 B ARG 217 ? B ARG 17 65 1 Y 1 B GLY 218 ? B GLY 18 66 1 Y 1 B SER 219 ? B SER 19 67 1 Y 1 B HIS 220 ? B HIS 20 68 1 Y 1 B MET 221 ? B MET 21 69 1 Y 1 B GLU 222 ? B GLU 22 70 1 Y 1 B ASN 223 ? B ASN 23 71 1 Y 1 B LEU 224 ? B LEU 24 72 1 Y 1 B TYR 225 ? B TYR 25 73 1 Y 1 B PHE 226 ? B PHE 26 74 1 Y 1 B GLN 227 ? B GLN 27 75 1 Y 1 B SER 228 ? B SER 28 76 1 Y 1 B SER 229 ? B SER 29 77 1 Y 1 B PRO 230 ? B PRO 30 78 1 Y 1 B ASN 231 ? B ASN 31 79 1 Y 1 B GLY 249 ? B GLY 49 80 1 Y 1 B GLY 250 ? B GLY 50 81 1 Y 1 B GLY 251 ? B GLY 51 82 1 Y 1 B GLN 252 ? B GLN 52 83 1 Y 1 B ILE 502 ? B ILE 302 84 1 Y 1 B SER 503 ? B SER 303 85 1 Y 1 B ASP 504 ? B ASP 304 86 1 Y 1 B GLU 505 ? B GLU 305 87 1 Y 1 B VAL 506 ? B VAL 306 88 1 Y 1 B GLU 507 ? B GLU 307 89 1 Y 1 B LYS 508 ? B LYS 308 90 1 Y 1 B GLU 509 ? B GLU 309 91 1 Y 1 B LEU 510 ? B LEU 310 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 FVC B33 B N N 88 FVC C02 C N N 89 FVC C04 C N N 90 FVC C05 C N N 91 FVC C06 C Y N 92 FVC C07 C Y N 93 FVC C09 C Y N 94 FVC C10 C Y N 95 FVC C11 C Y N 96 FVC C12 C Y N 97 FVC C14 C Y N 98 FVC C16 C Y N 99 FVC C17 C Y N 100 FVC C18 C Y N 101 FVC C19 C Y N 102 FVC C20 C Y N 103 FVC C21 C N N 104 FVC C32 C Y N 105 FVC C36 C Y N 106 FVC C37 C Y N 107 FVC C38 C Y N 108 FVC C39 C Y N 109 FVC C40 C Y N 110 FVC N03 N N N 111 FVC N08 N Y N 112 FVC N13 N Y N 113 FVC N15 N Y N 114 FVC O01 O N N 115 FVC O34 O N N 116 FVC O35 O N N 117 FVC H1 H N N 118 FVC H2 H N N 119 FVC H3 H N N 120 FVC H4 H N N 121 FVC H5 H N N 122 FVC H6 H N N 123 FVC H7 H N N 124 FVC H8 H N N 125 FVC H9 H N N 126 FVC H10 H N N 127 FVC H11 H N N 128 FVC H12 H N N 129 FVC H13 H N N 130 FVC H14 H N N 131 FVC H15 H N N 132 FVC H16 H N N 133 FVC H17 H N N 134 FVC H18 H N N 135 FVC H19 H N N 136 FVC H20 H N N 137 FVC H21 H N N 138 GLN N N N N 139 GLN CA C N S 140 GLN C C N N 141 GLN O O N N 142 GLN CB C N N 143 GLN CG C N N 144 GLN CD C N N 145 GLN OE1 O N N 146 GLN NE2 N N N 147 GLN OXT O N N 148 GLN H H N N 149 GLN H2 H N N 150 GLN HA H N N 151 GLN HB2 H N N 152 GLN HB3 H N N 153 GLN HG2 H N N 154 GLN HG3 H N N 155 GLN HE21 H N N 156 GLN HE22 H N N 157 GLN HXT H N N 158 GLU N N N N 159 GLU CA C N S 160 GLU C C N N 161 GLU O O N N 162 GLU CB C N N 163 GLU CG C N N 164 GLU CD C N N 165 GLU OE1 O N N 166 GLU OE2 O N N 167 GLU OXT O N N 168 GLU H H N N 169 GLU H2 H N N 170 GLU HA H N N 171 GLU HB2 H N N 172 GLU HB3 H N N 173 GLU HG2 H N N 174 GLU HG3 H N N 175 GLU HE2 H N N 176 GLU HXT H N N 177 GLY N N N N 178 GLY CA C N N 179 GLY C C N N 180 GLY O O N N 181 GLY OXT O N N 182 GLY H H N N 183 GLY H2 H N N 184 GLY HA2 H N N 185 GLY HA3 H N N 186 GLY HXT H N N 187 HIS N N N N 188 HIS CA C N S 189 HIS C C N N 190 HIS O O N N 191 HIS CB C N N 192 HIS CG C Y N 193 HIS ND1 N Y N 194 HIS CD2 C Y N 195 HIS CE1 C Y N 196 HIS NE2 N Y N 197 HIS OXT O N N 198 HIS H H N N 199 HIS H2 H N N 200 HIS HA H N N 201 HIS HB2 H N N 202 HIS HB3 H N N 203 HIS HD1 H N N 204 HIS HD2 H N N 205 HIS HE1 H N N 206 HIS HE2 H N N 207 HIS HXT H N N 208 HOH O O N N 209 HOH H1 H N N 210 HOH H2 H N N 211 ILE N N N N 212 ILE CA C N S 213 ILE C C N N 214 ILE O O N N 215 ILE CB C N S 216 ILE CG1 C N N 217 ILE CG2 C N N 218 ILE CD1 C N N 219 ILE OXT O N N 220 ILE H H N N 221 ILE H2 H N N 222 ILE HA H N N 223 ILE HB H N N 224 ILE HG12 H N N 225 ILE HG13 H N N 226 ILE HG21 H N N 227 ILE HG22 H N N 228 ILE HG23 H N N 229 ILE HD11 H N N 230 ILE HD12 H N N 231 ILE HD13 H N N 232 ILE HXT H N N 233 LEU N N N N 234 LEU CA C N S 235 LEU C C N N 236 LEU O O N N 237 LEU CB C N N 238 LEU CG C N N 239 LEU CD1 C N N 240 LEU CD2 C N N 241 LEU OXT O N N 242 LEU H H N N 243 LEU H2 H N N 244 LEU HA H N N 245 LEU HB2 H N N 246 LEU HB3 H N N 247 LEU HG H N N 248 LEU HD11 H N N 249 LEU HD12 H N N 250 LEU HD13 H N N 251 LEU HD21 H N N 252 LEU HD22 H N N 253 LEU HD23 H N N 254 LEU HXT H N N 255 LYS N N N N 256 LYS CA C N S 257 LYS C C N N 258 LYS O O N N 259 LYS CB C N N 260 LYS CG C N N 261 LYS CD C N N 262 LYS CE C N N 263 LYS NZ N N N 264 LYS OXT O N N 265 LYS H H N N 266 LYS H2 H N N 267 LYS HA H N N 268 LYS HB2 H N N 269 LYS HB3 H N N 270 LYS HG2 H N N 271 LYS HG3 H N N 272 LYS HD2 H N N 273 LYS HD3 H N N 274 LYS HE2 H N N 275 LYS HE3 H N N 276 LYS HZ1 H N N 277 LYS HZ2 H N N 278 LYS HZ3 H N N 279 LYS HXT H N N 280 MET N N N N 281 MET CA C N S 282 MET C C N N 283 MET O O N N 284 MET CB C N N 285 MET CG C N N 286 MET SD S N N 287 MET CE C N N 288 MET OXT O N N 289 MET H H N N 290 MET H2 H N N 291 MET HA H N N 292 MET HB2 H N N 293 MET HB3 H N N 294 MET HG2 H N N 295 MET HG3 H N N 296 MET HE1 H N N 297 MET HE2 H N N 298 MET HE3 H N N 299 MET HXT H N N 300 PHE N N N N 301 PHE CA C N S 302 PHE C C N N 303 PHE O O N N 304 PHE CB C N N 305 PHE CG C Y N 306 PHE CD1 C Y N 307 PHE CD2 C Y N 308 PHE CE1 C Y N 309 PHE CE2 C Y N 310 PHE CZ C Y N 311 PHE OXT O N N 312 PHE H H N N 313 PHE H2 H N N 314 PHE HA H N N 315 PHE HB2 H N N 316 PHE HB3 H N N 317 PHE HD1 H N N 318 PHE HD2 H N N 319 PHE HE1 H N N 320 PHE HE2 H N N 321 PHE HZ H N N 322 PHE HXT H N N 323 PRO N N N N 324 PRO CA C N S 325 PRO C C N N 326 PRO O O N N 327 PRO CB C N N 328 PRO CG C N N 329 PRO CD C N N 330 PRO OXT O N N 331 PRO H H N N 332 PRO HA H N N 333 PRO HB2 H N N 334 PRO HB3 H N N 335 PRO HG2 H N N 336 PRO HG3 H N N 337 PRO HD2 H N N 338 PRO HD3 H N N 339 PRO HXT H N N 340 SER N N N N 341 SER CA C N S 342 SER C C N N 343 SER O O N N 344 SER CB C N N 345 SER OG O N N 346 SER OXT O N N 347 SER H H N N 348 SER H2 H N N 349 SER HA H N N 350 SER HB2 H N N 351 SER HB3 H N N 352 SER HG H N N 353 SER HXT H N N 354 THR N N N N 355 THR CA C N S 356 THR C C N N 357 THR O O N N 358 THR CB C N R 359 THR OG1 O N N 360 THR CG2 C N N 361 THR OXT O N N 362 THR H H N N 363 THR H2 H N N 364 THR HA H N N 365 THR HB H N N 366 THR HG1 H N N 367 THR HG21 H N N 368 THR HG22 H N N 369 THR HG23 H N N 370 THR HXT H N N 371 TRP N N N N 372 TRP CA C N S 373 TRP C C N N 374 TRP O O N N 375 TRP CB C N N 376 TRP CG C Y N 377 TRP CD1 C Y N 378 TRP CD2 C Y N 379 TRP NE1 N Y N 380 TRP CE2 C Y N 381 TRP CE3 C Y N 382 TRP CZ2 C Y N 383 TRP CZ3 C Y N 384 TRP CH2 C Y N 385 TRP OXT O N N 386 TRP H H N N 387 TRP H2 H N N 388 TRP HA H N N 389 TRP HB2 H N N 390 TRP HB3 H N N 391 TRP HD1 H N N 392 TRP HE1 H N N 393 TRP HE3 H N N 394 TRP HZ2 H N N 395 TRP HZ3 H N N 396 TRP HH2 H N N 397 TRP HXT H N N 398 TYR N N N N 399 TYR CA C N S 400 TYR C C N N 401 TYR O O N N 402 TYR CB C N N 403 TYR CG C Y N 404 TYR CD1 C Y N 405 TYR CD2 C Y N 406 TYR CE1 C Y N 407 TYR CE2 C Y N 408 TYR CZ C Y N 409 TYR OH O N N 410 TYR OXT O N N 411 TYR H H N N 412 TYR H2 H N N 413 TYR HA H N N 414 TYR HB2 H N N 415 TYR HB3 H N N 416 TYR HD1 H N N 417 TYR HD2 H N N 418 TYR HE1 H N N 419 TYR HE2 H N N 420 TYR HH H N N 421 TYR HXT H N N 422 VAL N N N N 423 VAL CA C N S 424 VAL C C N N 425 VAL O O N N 426 VAL CB C N N 427 VAL CG1 C N N 428 VAL CG2 C N N 429 VAL OXT O N N 430 VAL H H N N 431 VAL H2 H N N 432 VAL HA H N N 433 VAL HB H N N 434 VAL HG11 H N N 435 VAL HG12 H N N 436 VAL HG13 H N N 437 VAL HG21 H N N 438 VAL HG22 H N N 439 VAL HG23 H N N 440 VAL HXT H N N 441 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 FVC C09 N08 doub Y N 83 FVC C09 C10 sing Y N 84 FVC N08 C07 sing Y N 85 FVC N13 C12 doub Y N 86 FVC N13 C14 sing Y N 87 FVC C12 C11 sing Y N 88 FVC C14 N15 sing Y N 89 FVC C14 C38 doub Y N 90 FVC N15 C16 sing Y N 91 FVC C11 C10 sing N N 92 FVC C11 C39 doub Y N 93 FVC C10 C40 doub Y N 94 FVC C07 C06 doub Y N 95 FVC C38 C39 sing Y N 96 FVC C38 C17 sing Y N 97 FVC C16 C17 doub Y N 98 FVC C17 C18 sing N N 99 FVC C04 N03 sing N N 100 FVC C06 C40 sing Y N 101 FVC C06 C02 sing N N 102 FVC C18 C19 doub Y N 103 FVC C18 C37 sing Y N 104 FVC C19 C20 sing Y N 105 FVC N03 C02 sing N N 106 FVC N03 C05 sing N N 107 FVC C02 O01 doub N N 108 FVC C37 C36 doub Y N 109 FVC C20 C21 sing N N 110 FVC C20 C32 doub Y N 111 FVC C36 C32 sing Y N 112 FVC C32 B33 sing N N 113 FVC O35 B33 sing N N 114 FVC B33 O34 sing N N 115 FVC C04 H1 sing N N 116 FVC C04 H2 sing N N 117 FVC C04 H3 sing N N 118 FVC C05 H4 sing N N 119 FVC C05 H5 sing N N 120 FVC C05 H6 sing N N 121 FVC C07 H7 sing N N 122 FVC C09 H8 sing N N 123 FVC C12 H9 sing N N 124 FVC C16 H10 sing N N 125 FVC C19 H11 sing N N 126 FVC C21 H12 sing N N 127 FVC C21 H13 sing N N 128 FVC C21 H14 sing N N 129 FVC C36 H15 sing N N 130 FVC C37 H16 sing N N 131 FVC C39 H17 sing N N 132 FVC C40 H18 sing N N 133 FVC N15 H19 sing N N 134 FVC O35 H20 sing N N 135 FVC O34 H21 sing N N 136 GLN N CA sing N N 137 GLN N H sing N N 138 GLN N H2 sing N N 139 GLN CA C sing N N 140 GLN CA CB sing N N 141 GLN CA HA sing N N 142 GLN C O doub N N 143 GLN C OXT sing N N 144 GLN CB CG sing N N 145 GLN CB HB2 sing N N 146 GLN CB HB3 sing N N 147 GLN CG CD sing N N 148 GLN CG HG2 sing N N 149 GLN CG HG3 sing N N 150 GLN CD OE1 doub N N 151 GLN CD NE2 sing N N 152 GLN NE2 HE21 sing N N 153 GLN NE2 HE22 sing N N 154 GLN OXT HXT sing N N 155 GLU N CA sing N N 156 GLU N H sing N N 157 GLU N H2 sing N N 158 GLU CA C sing N N 159 GLU CA CB sing N N 160 GLU CA HA sing N N 161 GLU C O doub N N 162 GLU C OXT sing N N 163 GLU CB CG sing N N 164 GLU CB HB2 sing N N 165 GLU CB HB3 sing N N 166 GLU CG CD sing N N 167 GLU CG HG2 sing N N 168 GLU CG HG3 sing N N 169 GLU CD OE1 doub N N 170 GLU CD OE2 sing N N 171 GLU OE2 HE2 sing N N 172 GLU OXT HXT sing N N 173 GLY N CA sing N N 174 GLY N H sing N N 175 GLY N H2 sing N N 176 GLY CA C sing N N 177 GLY CA HA2 sing N N 178 GLY CA HA3 sing N N 179 GLY C O doub N N 180 GLY C OXT sing N N 181 GLY OXT HXT sing N N 182 HIS N CA sing N N 183 HIS N H sing N N 184 HIS N H2 sing N N 185 HIS CA C sing N N 186 HIS CA CB sing N N 187 HIS CA HA sing N N 188 HIS C O doub N N 189 HIS C OXT sing N N 190 HIS CB CG sing N N 191 HIS CB HB2 sing N N 192 HIS CB HB3 sing N N 193 HIS CG ND1 sing Y N 194 HIS CG CD2 doub Y N 195 HIS ND1 CE1 doub Y N 196 HIS ND1 HD1 sing N N 197 HIS CD2 NE2 sing Y N 198 HIS CD2 HD2 sing N N 199 HIS CE1 NE2 sing Y N 200 HIS CE1 HE1 sing N N 201 HIS NE2 HE2 sing N N 202 HIS OXT HXT sing N N 203 HOH O H1 sing N N 204 HOH O H2 sing N N 205 ILE N CA sing N N 206 ILE N H sing N N 207 ILE N H2 sing N N 208 ILE CA C sing N N 209 ILE CA CB sing N N 210 ILE CA HA sing N N 211 ILE C O doub N N 212 ILE C OXT sing N N 213 ILE CB CG1 sing N N 214 ILE CB CG2 sing N N 215 ILE CB HB sing N N 216 ILE CG1 CD1 sing N N 217 ILE CG1 HG12 sing N N 218 ILE CG1 HG13 sing N N 219 ILE CG2 HG21 sing N N 220 ILE CG2 HG22 sing N N 221 ILE CG2 HG23 sing N N 222 ILE CD1 HD11 sing N N 223 ILE CD1 HD12 sing N N 224 ILE CD1 HD13 sing N N 225 ILE OXT HXT sing N N 226 LEU N CA sing N N 227 LEU N H sing N N 228 LEU N H2 sing N N 229 LEU CA C sing N N 230 LEU CA CB sing N N 231 LEU CA HA sing N N 232 LEU C O doub N N 233 LEU C OXT sing N N 234 LEU CB CG sing N N 235 LEU CB HB2 sing N N 236 LEU CB HB3 sing N N 237 LEU CG CD1 sing N N 238 LEU CG CD2 sing N N 239 LEU CG HG sing N N 240 LEU CD1 HD11 sing N N 241 LEU CD1 HD12 sing N N 242 LEU CD1 HD13 sing N N 243 LEU CD2 HD21 sing N N 244 LEU CD2 HD22 sing N N 245 LEU CD2 HD23 sing N N 246 LEU OXT HXT sing N N 247 LYS N CA sing N N 248 LYS N H sing N N 249 LYS N H2 sing N N 250 LYS CA C sing N N 251 LYS CA CB sing N N 252 LYS CA HA sing N N 253 LYS C O doub N N 254 LYS C OXT sing N N 255 LYS CB CG sing N N 256 LYS CB HB2 sing N N 257 LYS CB HB3 sing N N 258 LYS CG CD sing N N 259 LYS CG HG2 sing N N 260 LYS CG HG3 sing N N 261 LYS CD CE sing N N 262 LYS CD HD2 sing N N 263 LYS CD HD3 sing N N 264 LYS CE NZ sing N N 265 LYS CE HE2 sing N N 266 LYS CE HE3 sing N N 267 LYS NZ HZ1 sing N N 268 LYS NZ HZ2 sing N N 269 LYS NZ HZ3 sing N N 270 LYS OXT HXT sing N N 271 MET N CA sing N N 272 MET N H sing N N 273 MET N H2 sing N N 274 MET CA C sing N N 275 MET CA CB sing N N 276 MET CA HA sing N N 277 MET C O doub N N 278 MET C OXT sing N N 279 MET CB CG sing N N 280 MET CB HB2 sing N N 281 MET CB HB3 sing N N 282 MET CG SD sing N N 283 MET CG HG2 sing N N 284 MET CG HG3 sing N N 285 MET SD CE sing N N 286 MET CE HE1 sing N N 287 MET CE HE2 sing N N 288 MET CE HE3 sing N N 289 MET OXT HXT sing N N 290 PHE N CA sing N N 291 PHE N H sing N N 292 PHE N H2 sing N N 293 PHE CA C sing N N 294 PHE CA CB sing N N 295 PHE CA HA sing N N 296 PHE C O doub N N 297 PHE C OXT sing N N 298 PHE CB CG sing N N 299 PHE CB HB2 sing N N 300 PHE CB HB3 sing N N 301 PHE CG CD1 doub Y N 302 PHE CG CD2 sing Y N 303 PHE CD1 CE1 sing Y N 304 PHE CD1 HD1 sing N N 305 PHE CD2 CE2 doub Y N 306 PHE CD2 HD2 sing N N 307 PHE CE1 CZ doub Y N 308 PHE CE1 HE1 sing N N 309 PHE CE2 CZ sing Y N 310 PHE CE2 HE2 sing N N 311 PHE CZ HZ sing N N 312 PHE OXT HXT sing N N 313 PRO N CA sing N N 314 PRO N CD sing N N 315 PRO N H sing N N 316 PRO CA C sing N N 317 PRO CA CB sing N N 318 PRO CA HA sing N N 319 PRO C O doub N N 320 PRO C OXT sing N N 321 PRO CB CG sing N N 322 PRO CB HB2 sing N N 323 PRO CB HB3 sing N N 324 PRO CG CD sing N N 325 PRO CG HG2 sing N N 326 PRO CG HG3 sing N N 327 PRO CD HD2 sing N N 328 PRO CD HD3 sing N N 329 PRO OXT HXT sing N N 330 SER N CA sing N N 331 SER N H sing N N 332 SER N H2 sing N N 333 SER CA C sing N N 334 SER CA CB sing N N 335 SER CA HA sing N N 336 SER C O doub N N 337 SER C OXT sing N N 338 SER CB OG sing N N 339 SER CB HB2 sing N N 340 SER CB HB3 sing N N 341 SER OG HG sing N N 342 SER OXT HXT sing N N 343 THR N CA sing N N 344 THR N H sing N N 345 THR N H2 sing N N 346 THR CA C sing N N 347 THR CA CB sing N N 348 THR CA HA sing N N 349 THR C O doub N N 350 THR C OXT sing N N 351 THR CB OG1 sing N N 352 THR CB CG2 sing N N 353 THR CB HB sing N N 354 THR OG1 HG1 sing N N 355 THR CG2 HG21 sing N N 356 THR CG2 HG22 sing N N 357 THR CG2 HG23 sing N N 358 THR OXT HXT sing N N 359 TRP N CA sing N N 360 TRP N H sing N N 361 TRP N H2 sing N N 362 TRP CA C sing N N 363 TRP CA CB sing N N 364 TRP CA HA sing N N 365 TRP C O doub N N 366 TRP C OXT sing N N 367 TRP CB CG sing N N 368 TRP CB HB2 sing N N 369 TRP CB HB3 sing N N 370 TRP CG CD1 doub Y N 371 TRP CG CD2 sing Y N 372 TRP CD1 NE1 sing Y N 373 TRP CD1 HD1 sing N N 374 TRP CD2 CE2 doub Y N 375 TRP CD2 CE3 sing Y N 376 TRP NE1 CE2 sing Y N 377 TRP NE1 HE1 sing N N 378 TRP CE2 CZ2 sing Y N 379 TRP CE3 CZ3 doub Y N 380 TRP CE3 HE3 sing N N 381 TRP CZ2 CH2 doub Y N 382 TRP CZ2 HZ2 sing N N 383 TRP CZ3 CH2 sing Y N 384 TRP CZ3 HZ3 sing N N 385 TRP CH2 HH2 sing N N 386 TRP OXT HXT sing N N 387 TYR N CA sing N N 388 TYR N H sing N N 389 TYR N H2 sing N N 390 TYR CA C sing N N 391 TYR CA CB sing N N 392 TYR CA HA sing N N 393 TYR C O doub N N 394 TYR C OXT sing N N 395 TYR CB CG sing N N 396 TYR CB HB2 sing N N 397 TYR CB HB3 sing N N 398 TYR CG CD1 doub Y N 399 TYR CG CD2 sing Y N 400 TYR CD1 CE1 sing Y N 401 TYR CD1 HD1 sing N N 402 TYR CD2 CE2 doub Y N 403 TYR CD2 HD2 sing N N 404 TYR CE1 CZ doub Y N 405 TYR CE1 HE1 sing N N 406 TYR CE2 CZ sing Y N 407 TYR CE2 HE2 sing N N 408 TYR CZ OH sing N N 409 TYR OH HH sing N N 410 TYR OXT HXT sing N N 411 VAL N CA sing N N 412 VAL N H sing N N 413 VAL N H2 sing N N 414 VAL CA C sing N N 415 VAL CA CB sing N N 416 VAL CA HA sing N N 417 VAL C O doub N N 418 VAL C OXT sing N N 419 VAL CB CG1 sing N N 420 VAL CB CG2 sing N N 421 VAL CB HB sing N N 422 VAL CG1 HG11 sing N N 423 VAL CG1 HG12 sing N N 424 VAL CG1 HG13 sing N N 425 VAL CG2 HG21 sing N N 426 VAL CG2 HG22 sing N N 427 VAL CG2 HG23 sing N N 428 VAL OXT HXT sing N N 429 # _pdbx_audit_support.funding_organization 'National Medical Research Council' _pdbx_audit_support.country Singapore _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '[4-[5-[5-(dimethylcarbamoyl)pyridin-3-yl]-1H-pyrrolo[2,3-b]pyridin-3-yl]-2-methyl-phenyl]boronic acid' FVC 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2QOH _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #