data_7CHM # _entry.id 7CHM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7CHM pdb_00007chm 10.2210/pdb7chm/pdb WWPDB D_1300017555 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-05-12 2 'Structure model' 1 1 2021-06-09 3 'Structure model' 1 2 2023-11-29 4 'Structure model' 1 3 2024-10-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' 5 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model 7 4 'Structure model' pdbx_entry_details 8 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation_author.identifier_ORCID' 5 3 'Structure model' '_database_2.pdbx_DOI' 6 3 'Structure model' '_database_2.pdbx_database_accession' 7 4 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7CHM _pdbx_database_status.recvd_initial_deposition_date 2020-07-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kim, H.L.' 1 0000-0003-0569-7129 'Cho, H.Y.' 2 0000-0002-9465-8633 'Park, Y.W.' 3 0000-0003-2396-9140 'Lee, Y.H.' 4 ? 'Son, J.B.' 5 ? 'Ko, E.H.' 6 ? 'Choi, H.G.' 7 ? 'Kim, N.D.' 8 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 64 _citation.language ? _citation.page_first 6985 _citation.page_last 6995 _citation.title ;X-ray Crystal Structure-Guided Design and Optimization of 7 H -Pyrrolo[2,3- d ]pyrimidine-5-carbonitrile Scaffold as a Potent and Orally Active Monopolar Spindle 1 Inhibitor. ; _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.1c00542 _citation.pdbx_database_id_PubMed 33942608 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lee, Y.' 1 ? primary 'Kim, H.' 2 ? primary 'Kim, H.' 3 ? primary 'Cho, H.Y.' 4 ? primary 'Jee, J.G.' 5 ? primary 'Seo, K.A.' 6 ? primary 'Son, J.B.' 7 ? primary 'Ko, E.' 8 ? primary 'Choi, H.G.' 9 ? primary 'Kim, N.D.' 10 ? primary 'Kim, I.' 11 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Dual specificity protein kinase TTK' 32619.260 1 2.7.12.1 ? ? ? 2 non-polymer syn '4-(cyclohexylamino)-2-[(2-methoxy-4-morpholin-4-ylcarbonyl-phenyl)amino]-7H-pyrrolo[2,3-d]pyrimidine-5-carbonitrile' 475.543 1 ? ? ? ? 3 water nat water 18.015 6 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Phosphotyrosine picked threonine-protein kinase,PYT' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;NECISVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEIT DQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPD (TPO)TSVVKDSQVG(TPO)VNYMPPEAIKDMSSSRENGKSKSKISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHA IIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQT ; _entity_poly.pdbx_seq_one_letter_code_can ;NECISVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEIT DQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPD TTSVVKDSQVGTVNYMPPEAIKDMSSSRENGKSKSKISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEI EFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQT ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '4-(cyclohexylamino)-2-[(2-methoxy-4-morpholin-4-ylcarbonyl-phenyl)amino]-7H-pyrrolo[2,3-d]pyrimidine-5-carbonitrile' FZF 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASN n 1 2 GLU n 1 3 CYS n 1 4 ILE n 1 5 SER n 1 6 VAL n 1 7 LYS n 1 8 GLY n 1 9 ARG n 1 10 ILE n 1 11 TYR n 1 12 SER n 1 13 ILE n 1 14 LEU n 1 15 LYS n 1 16 GLN n 1 17 ILE n 1 18 GLY n 1 19 SER n 1 20 GLY n 1 21 GLY n 1 22 SER n 1 23 SER n 1 24 LYS n 1 25 VAL n 1 26 PHE n 1 27 GLN n 1 28 VAL n 1 29 LEU n 1 30 ASN n 1 31 GLU n 1 32 LYS n 1 33 LYS n 1 34 GLN n 1 35 ILE n 1 36 TYR n 1 37 ALA n 1 38 ILE n 1 39 LYS n 1 40 TYR n 1 41 VAL n 1 42 ASN n 1 43 LEU n 1 44 GLU n 1 45 GLU n 1 46 ALA n 1 47 ASP n 1 48 ASN n 1 49 GLN n 1 50 THR n 1 51 LEU n 1 52 ASP n 1 53 SER n 1 54 TYR n 1 55 ARG n 1 56 ASN n 1 57 GLU n 1 58 ILE n 1 59 ALA n 1 60 TYR n 1 61 LEU n 1 62 ASN n 1 63 LYS n 1 64 LEU n 1 65 GLN n 1 66 GLN n 1 67 HIS n 1 68 SER n 1 69 ASP n 1 70 LYS n 1 71 ILE n 1 72 ILE n 1 73 ARG n 1 74 LEU n 1 75 TYR n 1 76 ASP n 1 77 TYR n 1 78 GLU n 1 79 ILE n 1 80 THR n 1 81 ASP n 1 82 GLN n 1 83 TYR n 1 84 ILE n 1 85 TYR n 1 86 MET n 1 87 VAL n 1 88 MET n 1 89 GLU n 1 90 CYS n 1 91 GLY n 1 92 ASN n 1 93 ILE n 1 94 ASP n 1 95 LEU n 1 96 ASN n 1 97 SER n 1 98 TRP n 1 99 LEU n 1 100 LYS n 1 101 LYS n 1 102 LYS n 1 103 LYS n 1 104 SER n 1 105 ILE n 1 106 ASP n 1 107 PRO n 1 108 TRP n 1 109 GLU n 1 110 ARG n 1 111 LYS n 1 112 SER n 1 113 TYR n 1 114 TRP n 1 115 LYS n 1 116 ASN n 1 117 MET n 1 118 LEU n 1 119 GLU n 1 120 ALA n 1 121 VAL n 1 122 HIS n 1 123 THR n 1 124 ILE n 1 125 HIS n 1 126 GLN n 1 127 HIS n 1 128 GLY n 1 129 ILE n 1 130 VAL n 1 131 HIS n 1 132 SER n 1 133 ASP n 1 134 LEU n 1 135 LYS n 1 136 PRO n 1 137 ALA n 1 138 ASN n 1 139 PHE n 1 140 LEU n 1 141 ILE n 1 142 VAL n 1 143 ASP n 1 144 GLY n 1 145 MET n 1 146 LEU n 1 147 LYS n 1 148 LEU n 1 149 ILE n 1 150 ASP n 1 151 PHE n 1 152 GLY n 1 153 ILE n 1 154 ALA n 1 155 ASN n 1 156 GLN n 1 157 MET n 1 158 GLN n 1 159 PRO n 1 160 ASP n 1 161 TPO n 1 162 THR n 1 163 SER n 1 164 VAL n 1 165 VAL n 1 166 LYS n 1 167 ASP n 1 168 SER n 1 169 GLN n 1 170 VAL n 1 171 GLY n 1 172 TPO n 1 173 VAL n 1 174 ASN n 1 175 TYR n 1 176 MET n 1 177 PRO n 1 178 PRO n 1 179 GLU n 1 180 ALA n 1 181 ILE n 1 182 LYS n 1 183 ASP n 1 184 MET n 1 185 SER n 1 186 SER n 1 187 SER n 1 188 ARG n 1 189 GLU n 1 190 ASN n 1 191 GLY n 1 192 LYS n 1 193 SER n 1 194 LYS n 1 195 SER n 1 196 LYS n 1 197 ILE n 1 198 SER n 1 199 PRO n 1 200 LYS n 1 201 SER n 1 202 ASP n 1 203 VAL n 1 204 TRP n 1 205 SER n 1 206 LEU n 1 207 GLY n 1 208 CYS n 1 209 ILE n 1 210 LEU n 1 211 TYR n 1 212 TYR n 1 213 MET n 1 214 THR n 1 215 TYR n 1 216 GLY n 1 217 LYS n 1 218 THR n 1 219 PRO n 1 220 PHE n 1 221 GLN n 1 222 GLN n 1 223 ILE n 1 224 ILE n 1 225 ASN n 1 226 GLN n 1 227 ILE n 1 228 SER n 1 229 LYS n 1 230 LEU n 1 231 HIS n 1 232 ALA n 1 233 ILE n 1 234 ILE n 1 235 ASP n 1 236 PRO n 1 237 ASN n 1 238 HIS n 1 239 GLU n 1 240 ILE n 1 241 GLU n 1 242 PHE n 1 243 PRO n 1 244 ASP n 1 245 ILE n 1 246 PRO n 1 247 GLU n 1 248 LYS n 1 249 ASP n 1 250 LEU n 1 251 GLN n 1 252 ASP n 1 253 VAL n 1 254 LEU n 1 255 LYS n 1 256 CYS n 1 257 CYS n 1 258 LEU n 1 259 LYS n 1 260 ARG n 1 261 ASP n 1 262 PRO n 1 263 LYS n 1 264 GLN n 1 265 ARG n 1 266 ILE n 1 267 SER n 1 268 ILE n 1 269 PRO n 1 270 GLU n 1 271 LEU n 1 272 LEU n 1 273 ALA n 1 274 HIS n 1 275 PRO n 1 276 TYR n 1 277 VAL n 1 278 GLN n 1 279 ILE n 1 280 GLN n 1 281 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 281 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'TTK, MPS1, MPS1L1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli K-12' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 83333 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FZF non-polymer . '4-(cyclohexylamino)-2-[(2-methoxy-4-morpholin-4-ylcarbonyl-phenyl)amino]-7H-pyrrolo[2,3-d]pyrimidine-5-carbonitrile' ? 'C25 H29 N7 O3' 475.543 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TPO 'L-peptide linking' n PHOSPHOTHREONINE PHOSPHONOTHREONINE 'C4 H10 N O6 P' 199.099 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASN 1 515 ? ? ? A . n A 1 2 GLU 2 516 516 GLU GLU A . n A 1 3 CYS 3 517 517 CYS CYS A . n A 1 4 ILE 4 518 518 ILE ILE A . n A 1 5 SER 5 519 519 SER SER A . n A 1 6 VAL 6 520 520 VAL VAL A . n A 1 7 LYS 7 521 521 LYS LYS A . n A 1 8 GLY 8 522 522 GLY GLY A . n A 1 9 ARG 9 523 523 ARG ARG A . n A 1 10 ILE 10 524 524 ILE ILE A . n A 1 11 TYR 11 525 525 TYR TYR A . n A 1 12 SER 12 526 526 SER SER A . n A 1 13 ILE 13 527 527 ILE ILE A . n A 1 14 LEU 14 528 528 LEU LEU A . n A 1 15 LYS 15 529 529 LYS LYS A . n A 1 16 GLN 16 530 530 GLN GLN A . n A 1 17 ILE 17 531 531 ILE ILE A . n A 1 18 GLY 18 532 532 GLY GLY A . n A 1 19 SER 19 533 533 SER SER A . n A 1 20 GLY 20 534 534 GLY GLY A . n A 1 21 GLY 21 535 535 GLY GLY A . n A 1 22 SER 22 536 536 SER SER A . n A 1 23 SER 23 537 537 SER SER A . n A 1 24 LYS 24 538 538 LYS LYS A . n A 1 25 VAL 25 539 539 VAL VAL A . n A 1 26 PHE 26 540 540 PHE PHE A . n A 1 27 GLN 27 541 541 GLN GLN A . n A 1 28 VAL 28 542 542 VAL VAL A . n A 1 29 LEU 29 543 543 LEU LEU A . n A 1 30 ASN 30 544 544 ASN ASN A . n A 1 31 GLU 31 545 545 GLU GLU A . n A 1 32 LYS 32 546 546 LYS LYS A . n A 1 33 LYS 33 547 547 LYS LYS A . n A 1 34 GLN 34 548 548 GLN GLN A . n A 1 35 ILE 35 549 549 ILE ILE A . n A 1 36 TYR 36 550 550 TYR TYR A . n A 1 37 ALA 37 551 551 ALA ALA A . n A 1 38 ILE 38 552 552 ILE ILE A . n A 1 39 LYS 39 553 553 LYS LYS A . n A 1 40 TYR 40 554 554 TYR TYR A . n A 1 41 VAL 41 555 555 VAL VAL A . n A 1 42 ASN 42 556 556 ASN ASN A . n A 1 43 LEU 43 557 557 LEU LEU A . n A 1 44 GLU 44 558 558 GLU GLU A . n A 1 45 GLU 45 559 559 GLU GLU A . n A 1 46 ALA 46 560 560 ALA ALA A . n A 1 47 ASP 47 561 561 ASP ASP A . n A 1 48 ASN 48 562 562 ASN ASN A . n A 1 49 GLN 49 563 563 GLN GLN A . n A 1 50 THR 50 564 564 THR THR A . n A 1 51 LEU 51 565 565 LEU LEU A . n A 1 52 ASP 52 566 566 ASP ASP A . n A 1 53 SER 53 567 567 SER SER A . n A 1 54 TYR 54 568 568 TYR TYR A . n A 1 55 ARG 55 569 569 ARG ARG A . n A 1 56 ASN 56 570 570 ASN ASN A . n A 1 57 GLU 57 571 571 GLU GLU A . n A 1 58 ILE 58 572 572 ILE ILE A . n A 1 59 ALA 59 573 573 ALA ALA A . n A 1 60 TYR 60 574 574 TYR TYR A . n A 1 61 LEU 61 575 575 LEU LEU A . n A 1 62 ASN 62 576 576 ASN ASN A . n A 1 63 LYS 63 577 577 LYS LYS A . n A 1 64 LEU 64 578 578 LEU LEU A . n A 1 65 GLN 65 579 579 GLN GLN A . n A 1 66 GLN 66 580 580 GLN GLN A . n A 1 67 HIS 67 581 581 HIS HIS A . n A 1 68 SER 68 582 582 SER SER A . n A 1 69 ASP 69 583 583 ASP ASP A . n A 1 70 LYS 70 584 584 LYS LYS A . n A 1 71 ILE 71 585 585 ILE ILE A . n A 1 72 ILE 72 586 586 ILE ILE A . n A 1 73 ARG 73 587 587 ARG ARG A . n A 1 74 LEU 74 588 588 LEU LEU A . n A 1 75 TYR 75 589 589 TYR TYR A . n A 1 76 ASP 76 590 590 ASP ASP A . n A 1 77 TYR 77 591 591 TYR TYR A . n A 1 78 GLU 78 592 592 GLU GLU A . n A 1 79 ILE 79 593 593 ILE ILE A . n A 1 80 THR 80 594 594 THR THR A . n A 1 81 ASP 81 595 595 ASP ASP A . n A 1 82 GLN 82 596 596 GLN GLN A . n A 1 83 TYR 83 597 597 TYR TYR A . n A 1 84 ILE 84 598 598 ILE ILE A . n A 1 85 TYR 85 599 599 TYR TYR A . n A 1 86 MET 86 600 600 MET MET A . n A 1 87 VAL 87 601 601 VAL VAL A . n A 1 88 MET 88 602 602 MET MET A . n A 1 89 GLU 89 603 603 GLU GLU A . n A 1 90 CYS 90 604 604 CYS CYS A . n A 1 91 GLY 91 605 605 GLY GLY A . n A 1 92 ASN 92 606 606 ASN ASN A . n A 1 93 ILE 93 607 607 ILE ILE A . n A 1 94 ASP 94 608 608 ASP ASP A . n A 1 95 LEU 95 609 609 LEU LEU A . n A 1 96 ASN 96 610 610 ASN ASN A . n A 1 97 SER 97 611 611 SER SER A . n A 1 98 TRP 98 612 612 TRP TRP A . n A 1 99 LEU 99 613 613 LEU LEU A . n A 1 100 LYS 100 614 614 LYS LYS A . n A 1 101 LYS 101 615 615 LYS LYS A . n A 1 102 LYS 102 616 616 LYS LYS A . n A 1 103 LYS 103 617 617 LYS LYS A . n A 1 104 SER 104 618 618 SER SER A . n A 1 105 ILE 105 619 619 ILE ILE A . n A 1 106 ASP 106 620 620 ASP ASP A . n A 1 107 PRO 107 621 621 PRO PRO A . n A 1 108 TRP 108 622 622 TRP TRP A . n A 1 109 GLU 109 623 623 GLU GLU A . n A 1 110 ARG 110 624 624 ARG ARG A . n A 1 111 LYS 111 625 625 LYS LYS A . n A 1 112 SER 112 626 626 SER SER A . n A 1 113 TYR 113 627 627 TYR TYR A . n A 1 114 TRP 114 628 628 TRP TRP A . n A 1 115 LYS 115 629 629 LYS LYS A . n A 1 116 ASN 116 630 630 ASN ASN A . n A 1 117 MET 117 631 631 MET MET A . n A 1 118 LEU 118 632 632 LEU LEU A . n A 1 119 GLU 119 633 633 GLU GLU A . n A 1 120 ALA 120 634 634 ALA ALA A . n A 1 121 VAL 121 635 635 VAL VAL A . n A 1 122 HIS 122 636 636 HIS HIS A . n A 1 123 THR 123 637 637 THR THR A . n A 1 124 ILE 124 638 638 ILE ILE A . n A 1 125 HIS 125 639 639 HIS HIS A . n A 1 126 GLN 126 640 640 GLN GLN A . n A 1 127 HIS 127 641 641 HIS HIS A . n A 1 128 GLY 128 642 642 GLY GLY A . n A 1 129 ILE 129 643 643 ILE ILE A . n A 1 130 VAL 130 644 644 VAL VAL A . n A 1 131 HIS 131 645 645 HIS HIS A . n A 1 132 SER 132 646 646 SER SER A . n A 1 133 ASP 133 647 647 ASP ASP A . n A 1 134 LEU 134 648 648 LEU LEU A . n A 1 135 LYS 135 649 649 LYS LYS A . n A 1 136 PRO 136 650 650 PRO PRO A . n A 1 137 ALA 137 651 651 ALA ALA A . n A 1 138 ASN 138 652 652 ASN ASN A . n A 1 139 PHE 139 653 653 PHE PHE A . n A 1 140 LEU 140 654 654 LEU LEU A . n A 1 141 ILE 141 655 655 ILE ILE A . n A 1 142 VAL 142 656 656 VAL VAL A . n A 1 143 ASP 143 657 657 ASP ASP A . n A 1 144 GLY 144 658 658 GLY GLY A . n A 1 145 MET 145 659 659 MET MET A . n A 1 146 LEU 146 660 660 LEU LEU A . n A 1 147 LYS 147 661 661 LYS LYS A . n A 1 148 LEU 148 662 662 LEU LEU A . n A 1 149 ILE 149 663 663 ILE ILE A . n A 1 150 ASP 150 664 664 ASP ASP A . n A 1 151 PHE 151 665 665 PHE PHE A . n A 1 152 GLY 152 666 666 GLY GLY A . n A 1 153 ILE 153 667 667 ILE ILE A . n A 1 154 ALA 154 668 668 ALA ALA A . n A 1 155 ASN 155 669 669 ASN ASN A . n A 1 156 GLN 156 670 670 GLN GLN A . n A 1 157 MET 157 671 671 MET MET A . n A 1 158 GLN 158 672 672 GLN GLN A . n A 1 159 PRO 159 673 673 PRO PRO A . n A 1 160 ASP 160 674 674 ASP ASP A . n A 1 161 TPO 161 675 675 TPO TPO A . n A 1 162 THR 162 676 ? ? ? A . n A 1 163 SER 163 677 ? ? ? A . n A 1 164 VAL 164 678 ? ? ? A . n A 1 165 VAL 165 679 ? ? ? A . n A 1 166 LYS 166 680 ? ? ? A . n A 1 167 ASP 167 681 ? ? ? A . n A 1 168 SER 168 682 ? ? ? A . n A 1 169 GLN 169 683 ? ? ? A . n A 1 170 VAL 170 684 684 VAL VAL A . n A 1 171 GLY 171 685 685 GLY GLY A . n A 1 172 TPO 172 686 686 TPO TPO A . n A 1 173 VAL 173 687 687 VAL VAL A . n A 1 174 ASN 174 688 688 ASN ASN A . n A 1 175 TYR 175 689 689 TYR TYR A . n A 1 176 MET 176 690 690 MET MET A . n A 1 177 PRO 177 691 691 PRO PRO A . n A 1 178 PRO 178 692 692 PRO PRO A . n A 1 179 GLU 179 693 693 GLU GLU A . n A 1 180 ALA 180 694 694 ALA ALA A . n A 1 181 ILE 181 695 695 ILE ILE A . n A 1 182 LYS 182 696 696 LYS LYS A . n A 1 183 ASP 183 697 697 ASP ASP A . n A 1 184 MET 184 698 698 MET MET A . n A 1 185 SER 185 699 699 SER SER A . n A 1 186 SER 186 700 ? ? ? A . n A 1 187 SER 187 701 ? ? ? A . n A 1 188 ARG 188 702 ? ? ? A . n A 1 189 GLU 189 703 ? ? ? A . n A 1 190 ASN 190 704 ? ? ? A . n A 1 191 GLY 191 705 ? ? ? A . n A 1 192 LYS 192 706 ? ? ? A . n A 1 193 SER 193 707 ? ? ? A . n A 1 194 LYS 194 708 ? ? ? A . n A 1 195 SER 195 709 ? ? ? A . n A 1 196 LYS 196 710 ? ? ? A . n A 1 197 ILE 197 711 711 ILE ILE A . n A 1 198 SER 198 712 712 SER SER A . n A 1 199 PRO 199 713 713 PRO PRO A . n A 1 200 LYS 200 714 714 LYS LYS A . n A 1 201 SER 201 715 715 SER SER A . n A 1 202 ASP 202 716 716 ASP ASP A . n A 1 203 VAL 203 717 717 VAL VAL A . n A 1 204 TRP 204 718 718 TRP TRP A . n A 1 205 SER 205 719 719 SER SER A . n A 1 206 LEU 206 720 720 LEU LEU A . n A 1 207 GLY 207 721 721 GLY GLY A . n A 1 208 CYS 208 722 722 CYS CYS A . n A 1 209 ILE 209 723 723 ILE ILE A . n A 1 210 LEU 210 724 724 LEU LEU A . n A 1 211 TYR 211 725 725 TYR TYR A . n A 1 212 TYR 212 726 726 TYR TYR A . n A 1 213 MET 213 727 727 MET MET A . n A 1 214 THR 214 728 728 THR THR A . n A 1 215 TYR 215 729 729 TYR TYR A . n A 1 216 GLY 216 730 730 GLY GLY A . n A 1 217 LYS 217 731 731 LYS LYS A . n A 1 218 THR 218 732 732 THR THR A . n A 1 219 PRO 219 733 733 PRO PRO A . n A 1 220 PHE 220 734 734 PHE PHE A . n A 1 221 GLN 221 735 735 GLN GLN A . n A 1 222 GLN 222 736 736 GLN GLN A . n A 1 223 ILE 223 737 737 ILE ILE A . n A 1 224 ILE 224 738 738 ILE ILE A . n A 1 225 ASN 225 739 739 ASN ASN A . n A 1 226 GLN 226 740 740 GLN GLN A . n A 1 227 ILE 227 741 741 ILE ILE A . n A 1 228 SER 228 742 742 SER SER A . n A 1 229 LYS 229 743 743 LYS LYS A . n A 1 230 LEU 230 744 744 LEU LEU A . n A 1 231 HIS 231 745 745 HIS HIS A . n A 1 232 ALA 232 746 746 ALA ALA A . n A 1 233 ILE 233 747 747 ILE ILE A . n A 1 234 ILE 234 748 748 ILE ILE A . n A 1 235 ASP 235 749 749 ASP ASP A . n A 1 236 PRO 236 750 750 PRO PRO A . n A 1 237 ASN 237 751 751 ASN ASN A . n A 1 238 HIS 238 752 752 HIS HIS A . n A 1 239 GLU 239 753 753 GLU GLU A . n A 1 240 ILE 240 754 754 ILE ILE A . n A 1 241 GLU 241 755 755 GLU GLU A . n A 1 242 PHE 242 756 756 PHE PHE A . n A 1 243 PRO 243 757 757 PRO PRO A . n A 1 244 ASP 244 758 758 ASP ASP A . n A 1 245 ILE 245 759 759 ILE ILE A . n A 1 246 PRO 246 760 760 PRO PRO A . n A 1 247 GLU 247 761 761 GLU GLU A . n A 1 248 LYS 248 762 762 LYS LYS A . n A 1 249 ASP 249 763 763 ASP ASP A . n A 1 250 LEU 250 764 764 LEU LEU A . n A 1 251 GLN 251 765 765 GLN GLN A . n A 1 252 ASP 252 766 766 ASP ASP A . n A 1 253 VAL 253 767 767 VAL VAL A . n A 1 254 LEU 254 768 768 LEU LEU A . n A 1 255 LYS 255 769 769 LYS LYS A . n A 1 256 CYS 256 770 770 CYS CYS A . n A 1 257 CYS 257 771 771 CYS CYS A . n A 1 258 LEU 258 772 772 LEU LEU A . n A 1 259 LYS 259 773 773 LYS LYS A . n A 1 260 ARG 260 774 774 ARG ARG A . n A 1 261 ASP 261 775 775 ASP ASP A . n A 1 262 PRO 262 776 776 PRO PRO A . n A 1 263 LYS 263 777 777 LYS LYS A . n A 1 264 GLN 264 778 778 GLN GLN A . n A 1 265 ARG 265 779 779 ARG ARG A . n A 1 266 ILE 266 780 780 ILE ILE A . n A 1 267 SER 267 781 781 SER SER A . n A 1 268 ILE 268 782 782 ILE ILE A . n A 1 269 PRO 269 783 783 PRO PRO A . n A 1 270 GLU 270 784 784 GLU GLU A . n A 1 271 LEU 271 785 785 LEU LEU A . n A 1 272 LEU 272 786 786 LEU LEU A . n A 1 273 ALA 273 787 787 ALA ALA A . n A 1 274 HIS 274 788 788 HIS HIS A . n A 1 275 PRO 275 789 789 PRO PRO A . n A 1 276 TYR 276 790 790 TYR TYR A . n A 1 277 VAL 277 791 791 VAL VAL A . n A 1 278 GLN 278 792 792 GLN GLN A . n A 1 279 ILE 279 793 793 ILE ILE A . n A 1 280 GLN 280 794 794 GLN GLN A . n A 1 281 THR 281 795 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id FZF _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id FZF _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 FZF 1 801 801 FZF LIG A . C 3 HOH 1 901 2 HOH HOH A . C 3 HOH 2 902 6 HOH HOH A . C 3 HOH 3 903 3 HOH HOH A . C 3 HOH 4 904 4 HOH HOH A . C 3 HOH 5 905 5 HOH HOH A . C 3 HOH 6 906 1 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 563 ? CG ? A GLN 49 CG 2 1 Y 1 A GLN 563 ? CD ? A GLN 49 CD 3 1 Y 1 A GLN 563 ? OE1 ? A GLN 49 OE1 4 1 Y 1 A GLN 563 ? NE2 ? A GLN 49 NE2 5 1 Y 1 A LYS 615 ? CG ? A LYS 101 CG 6 1 Y 1 A LYS 615 ? CD ? A LYS 101 CD 7 1 Y 1 A LYS 615 ? CE ? A LYS 101 CE 8 1 Y 1 A LYS 615 ? NZ ? A LYS 101 NZ 9 1 Y 1 A LYS 616 ? CG ? A LYS 102 CG 10 1 Y 1 A LYS 616 ? CD ? A LYS 102 CD 11 1 Y 1 A LYS 616 ? CE ? A LYS 102 CE 12 1 Y 1 A LYS 616 ? NZ ? A LYS 102 NZ 13 1 Y 1 A LYS 617 ? CG ? A LYS 103 CG 14 1 Y 1 A LYS 617 ? CD ? A LYS 103 CD 15 1 Y 1 A LYS 617 ? CE ? A LYS 103 CE 16 1 Y 1 A LYS 617 ? NZ ? A LYS 103 NZ 17 1 Y 1 A LYS 696 ? CG ? A LYS 182 CG 18 1 Y 1 A LYS 696 ? CD ? A LYS 182 CD 19 1 Y 1 A LYS 696 ? CE ? A LYS 182 CE 20 1 Y 1 A LYS 696 ? NZ ? A LYS 182 NZ 21 1 Y 1 A LYS 777 ? CD ? A LYS 263 CD 22 1 Y 1 A LYS 777 ? CE ? A LYS 263 CE 23 1 Y 1 A LYS 777 ? NZ ? A LYS 263 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.17.1_3660 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7CHM _cell.details ? _cell.formula_units_Z ? _cell.length_a 70.492 _cell.length_a_esd ? _cell.length_b 108.975 _cell.length_b_esd ? _cell.length_c 113.134 _cell.length_c_esd ? _cell.volume 869080.194 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7CHM _symmetry.cell_setting ? _symmetry.Int_Tables_number 23 _symmetry.space_group_name_Hall 'I 2 2' _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7CHM _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.33 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 63.07 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 294.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '7-9% PEG 10000, 0.08-0.14 M magnesium acetate, 0.1 M MES pH 6.0' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 294.15 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-10-31 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9795 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PAL/PLS BEAMLINE 5C (4A)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9795 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline '5C (4A)' _diffrn_source.pdbx_synchrotron_site PAL/PLS # _reflns.B_iso_Wilson_estimate 75.95 _reflns.entry_id 7CHM _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.65 _reflns.d_resolution_low 50.00 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13070 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.6 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 35.351 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.992 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.65 _reflns_shell.d_res_low 2.70 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 655 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.710 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value 0.710 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.301 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.852 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 82.70 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7CHM _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.65 _refine.ls_d_res_low 40.89 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13009 _refine.ls_number_reflns_R_free 1296 _refine.ls_number_reflns_R_work 11713 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.80 _refine.ls_percent_reflns_R_free 9.96 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2122 _refine.ls_R_factor_R_free 0.2531 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2077 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.37 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6B4W _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 28.7501 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3814 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.65 _refine_hist.d_res_low 40.89 _refine_hist.number_atoms_solvent 6 _refine_hist.number_atoms_total 2146 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2105 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 35 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0101 ? 2190 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.1619 ? 2971 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0607 ? 323 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0065 ? 372 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 21.3766 ? 300 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.65 2.76 . . 144 1280 98.96 . . . 0.3367 . 0.2889 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.76 2.88 . . 140 1278 100.00 . . . 0.3375 . 0.2693 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.88 3.03 . . 142 1269 99.79 . . . 0.3132 . 0.2568 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.03 3.22 . . 144 1293 100.00 . . . 0.3216 . 0.2531 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.22 3.47 . . 141 1288 100.00 . . . 0.2868 . 0.2482 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.47 3.82 . . 144 1288 100.00 . . . 0.2778 . 0.2205 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.82 4.37 . . 142 1307 99.79 . . . 0.2509 . 0.1980 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.37 5.50 . . 149 1314 99.93 . . . 0.2490 . 0.1813 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.51 40.89 . . 150 1396 99.81 . . . 0.1978 . 0.1863 . . . . . . . . . . . # _struct.entry_id 7CHM _struct.title 'Crystal structure of TTK kinase domain in complex with compound 8' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7CHM _struct_keywords.text 'Kinase MPS1 TTK Structure-guided drug design, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TTK_HUMAN _struct_ref.pdbx_db_accession P33981 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;NECISVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEIT DQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPD TTSVVKDSQVGTVNYMPPEAIKDMSSSRENGKSKSKISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEI EFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQT ; _struct_ref.pdbx_align_begin 515 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7CHM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 281 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P33981 _struct_ref_seq.db_align_beg 515 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 795 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 515 _struct_ref_seq.pdbx_auth_seq_align_end 795 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 12860 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 47 ? GLN A 65 ? ASP A 561 GLN A 579 1 ? 19 HELX_P HELX_P2 AA2 LEU A 95 ? LYS A 102 ? LEU A 609 LYS A 616 1 ? 8 HELX_P HELX_P3 AA3 ASP A 106 ? HIS A 127 ? ASP A 620 HIS A 641 1 ? 22 HELX_P HELX_P4 AA4 LYS A 135 ? ALA A 137 ? LYS A 649 ALA A 651 5 ? 3 HELX_P HELX_P5 AA5 PRO A 177 ? LYS A 182 ? PRO A 691 LYS A 696 1 ? 6 HELX_P HELX_P6 AA6 SER A 198 ? GLY A 216 ? SER A 712 GLY A 730 1 ? 19 HELX_P HELX_P7 AA7 THR A 218 ? GLN A 222 ? THR A 732 GLN A 736 5 ? 5 HELX_P HELX_P8 AA8 ASN A 225 ? ASP A 235 ? ASN A 739 ASP A 749 1 ? 11 HELX_P HELX_P9 AA9 GLU A 247 ? LEU A 258 ? GLU A 761 LEU A 772 1 ? 12 HELX_P HELX_P10 AB1 ASP A 261 ? ARG A 265 ? ASP A 775 ARG A 779 5 ? 5 HELX_P HELX_P11 AB2 SER A 267 ? LEU A 272 ? SER A 781 LEU A 786 1 ? 6 HELX_P HELX_P12 AB3 HIS A 274 ? ILE A 279 ? HIS A 788 ILE A 793 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ASP 160 C ? ? ? 1_555 A TPO 161 N ? ? A ASP 674 A TPO 675 1_555 ? ? ? ? ? ? ? 1.336 ? ? covale2 covale both ? A GLY 171 C ? ? ? 1_555 A TPO 172 N ? ? A GLY 685 A TPO 686 1_555 ? ? ? ? ? ? ? 1.341 ? ? covale3 covale both ? A TPO 172 C ? ? ? 1_555 A VAL 173 N ? ? A TPO 686 A VAL 687 1_555 ? ? ? ? ? ? ? 1.326 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 TPO A 161 ? . . . . TPO A 675 ? 1_555 . . . . . . . THR 1 TPO Phosphorylation 'Named protein modification' 2 TPO A 172 ? . . . . TPO A 686 ? 1_555 . . . . . . . THR 1 TPO Phosphorylation 'Named protein modification' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 3 ? AA3 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 CYS A 3 ? VAL A 6 ? CYS A 517 VAL A 520 AA1 2 ARG A 9 ? GLY A 20 ? ARG A 523 GLY A 534 AA1 3 SER A 23 ? ASN A 30 ? SER A 537 ASN A 544 AA1 4 ILE A 35 ? ASN A 42 ? ILE A 549 ASN A 556 AA1 5 TYR A 83 ? MET A 88 ? TYR A 597 MET A 602 AA1 6 LEU A 74 ? ILE A 79 ? LEU A 588 ILE A 593 AA2 1 CYS A 3 ? VAL A 6 ? CYS A 517 VAL A 520 AA2 2 ARG A 9 ? GLY A 20 ? ARG A 523 GLY A 534 AA2 3 GLN A 158 ? PRO A 159 ? GLN A 672 PRO A 673 AA3 1 ILE A 93 ? ASP A 94 ? ILE A 607 ASP A 608 AA3 2 PHE A 139 ? VAL A 142 ? PHE A 653 VAL A 656 AA3 3 MET A 145 ? LEU A 148 ? MET A 659 LEU A 662 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 6 ? N VAL A 520 O ARG A 9 ? O ARG A 523 AA1 2 3 N GLY A 20 ? N GLY A 534 O SER A 23 ? O SER A 537 AA1 3 4 N LYS A 24 ? N LYS A 538 O TYR A 40 ? O TYR A 554 AA1 4 5 N ALA A 37 ? N ALA A 551 O MET A 88 ? O MET A 602 AA1 5 6 O VAL A 87 ? O VAL A 601 N ASP A 76 ? N ASP A 590 AA2 1 2 N VAL A 6 ? N VAL A 520 O ARG A 9 ? O ARG A 523 AA2 2 3 N SER A 19 ? N SER A 533 O GLN A 158 ? O GLN A 672 AA3 1 2 N ILE A 93 ? N ILE A 607 O ILE A 141 ? O ILE A 655 AA3 2 3 N LEU A 140 ? N LEU A 654 O LYS A 147 ? O LYS A 661 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id FZF _struct_site.pdbx_auth_seq_id 801 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 13 _struct_site.details 'binding site for residue FZF A 801' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 13 ILE A 17 ? ILE A 531 . ? 1_555 ? 2 AC1 13 GLN A 27 ? GLN A 541 . ? 1_555 ? 3 AC1 13 ALA A 37 ? ALA A 551 . ? 1_555 ? 4 AC1 13 MET A 88 ? MET A 602 . ? 1_555 ? 5 AC1 13 GLU A 89 ? GLU A 603 . ? 1_555 ? 6 AC1 13 CYS A 90 ? CYS A 604 . ? 1_555 ? 7 AC1 13 GLY A 91 ? GLY A 605 . ? 1_555 ? 8 AC1 13 ASN A 92 ? ASN A 606 . ? 1_555 ? 9 AC1 13 ILE A 93 ? ILE A 607 . ? 1_555 ? 10 AC1 13 ASP A 94 ? ASP A 608 . ? 1_555 ? 11 AC1 13 LEU A 140 ? LEU A 654 . ? 1_555 ? 12 AC1 13 ILE A 149 ? ILE A 663 . ? 1_555 ? 13 AC1 13 PRO A 159 ? PRO A 673 . ? 1_555 ? # _pdbx_entry_details.entry_id 7CHM _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD1 A ASP 561 ? ? OG1 A THR 564 ? ? 1.81 2 1 O A THR 564 ? ? OG A SER 567 ? ? 2.08 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OG _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 SER _pdbx_validate_symm_contact.auth_seq_id_1 699 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 OG _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 SER _pdbx_validate_symm_contact.auth_seq_id_2 699 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 2_455 _pdbx_validate_symm_contact.dist 1.84 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 521 ? ? 35.98 59.12 2 1 LYS A 546 ? ? -98.79 35.97 3 1 ASN A 562 ? ? -55.63 -9.47 4 1 ILE A 663 ? ? -111.88 -71.82 5 1 LYS A 696 ? ? -52.91 -0.70 6 1 GLN A 736 ? ? -35.07 -86.92 7 1 ILE A 737 ? ? -51.61 108.35 8 1 PRO A 757 ? ? -37.93 126.08 9 1 GLU A 761 ? ? -67.55 93.41 10 1 LEU A 772 ? ? -94.21 35.79 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 LYS _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 616 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 LYS _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 617 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 149.08 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A TPO 161 A TPO 675 ? THR 'modified residue' 2 A TPO 172 A TPO 686 ? THR 'modified residue' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x,-y,-z 3 -x,y,-z 4 -x,-y,z 5 x+1/2,y+1/2,z+1/2 6 x+1/2,-y+1/2,-z+1/2 7 -x+1/2,y+1/2,-z+1/2 8 -x+1/2,-y+1/2,z+1/2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ASN 515 ? A ASN 1 2 1 Y 1 A THR 676 ? A THR 162 3 1 Y 1 A SER 677 ? A SER 163 4 1 Y 1 A VAL 678 ? A VAL 164 5 1 Y 1 A VAL 679 ? A VAL 165 6 1 Y 1 A LYS 680 ? A LYS 166 7 1 Y 1 A ASP 681 ? A ASP 167 8 1 Y 1 A SER 682 ? A SER 168 9 1 Y 1 A GLN 683 ? A GLN 169 10 1 Y 1 A SER 700 ? A SER 186 11 1 Y 1 A SER 701 ? A SER 187 12 1 Y 1 A ARG 702 ? A ARG 188 13 1 Y 1 A GLU 703 ? A GLU 189 14 1 Y 1 A ASN 704 ? A ASN 190 15 1 Y 1 A GLY 705 ? A GLY 191 16 1 Y 1 A LYS 706 ? A LYS 192 17 1 Y 1 A SER 707 ? A SER 193 18 1 Y 1 A LYS 708 ? A LYS 194 19 1 Y 1 A SER 709 ? A SER 195 20 1 Y 1 A LYS 710 ? A LYS 196 21 1 Y 1 A THR 795 ? A THR 281 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 FZF C15 C Y N 88 FZF C20 C Y N 89 FZF C21 C Y N 90 FZF C22 C Y N 91 FZF C01 C N N 92 FZF C03 C Y N 93 FZF C04 C Y N 94 FZF C05 C Y N 95 FZF C06 C N N 96 FZF C08 C N N 97 FZF C09 C N N 98 FZF C11 C N N 99 FZF C12 C N N 100 FZF C14 C Y N 101 FZF C16 C Y N 102 FZF C18 C Y N 103 FZF C23 C N N 104 FZF C25 C Y N 105 FZF C27 C Y N 106 FZF C29 C N N 107 FZF C30 C N N 108 FZF C31 C N N 109 FZF C32 C N N 110 FZF C33 C N N 111 FZF C34 C N N 112 FZF N07 N N N 113 FZF N17 N N N 114 FZF N19 N Y N 115 FZF N24 N N N 116 FZF N26 N Y N 117 FZF N28 N N N 118 FZF N35 N Y N 119 FZF O02 O N N 120 FZF O10 O N N 121 FZF O13 O N N 122 FZF H151 H N N 123 FZF H013 H N N 124 FZF H011 H N N 125 FZF H012 H N N 126 FZF H041 H N N 127 FZF H082 H N N 128 FZF H081 H N N 129 FZF H092 H N N 130 FZF H091 H N N 131 FZF H112 H N N 132 FZF H111 H N N 133 FZF H121 H N N 134 FZF H122 H N N 135 FZF H141 H N N 136 FZF H251 H N N 137 FZF H291 H N N 138 FZF H301 H N N 139 FZF H302 H N N 140 FZF H312 H N N 141 FZF H311 H N N 142 FZF H322 H N N 143 FZF H321 H N N 144 FZF H332 H N N 145 FZF H331 H N N 146 FZF H341 H N N 147 FZF H342 H N N 148 FZF H171 H N N 149 FZF H261 H N N 150 FZF H281 H N N 151 GLN N N N N 152 GLN CA C N S 153 GLN C C N N 154 GLN O O N N 155 GLN CB C N N 156 GLN CG C N N 157 GLN CD C N N 158 GLN OE1 O N N 159 GLN NE2 N N N 160 GLN OXT O N N 161 GLN H H N N 162 GLN H2 H N N 163 GLN HA H N N 164 GLN HB2 H N N 165 GLN HB3 H N N 166 GLN HG2 H N N 167 GLN HG3 H N N 168 GLN HE21 H N N 169 GLN HE22 H N N 170 GLN HXT H N N 171 GLU N N N N 172 GLU CA C N S 173 GLU C C N N 174 GLU O O N N 175 GLU CB C N N 176 GLU CG C N N 177 GLU CD C N N 178 GLU OE1 O N N 179 GLU OE2 O N N 180 GLU OXT O N N 181 GLU H H N N 182 GLU H2 H N N 183 GLU HA H N N 184 GLU HB2 H N N 185 GLU HB3 H N N 186 GLU HG2 H N N 187 GLU HG3 H N N 188 GLU HE2 H N N 189 GLU HXT H N N 190 GLY N N N N 191 GLY CA C N N 192 GLY C C N N 193 GLY O O N N 194 GLY OXT O N N 195 GLY H H N N 196 GLY H2 H N N 197 GLY HA2 H N N 198 GLY HA3 H N N 199 GLY HXT H N N 200 HIS N N N N 201 HIS CA C N S 202 HIS C C N N 203 HIS O O N N 204 HIS CB C N N 205 HIS CG C Y N 206 HIS ND1 N Y N 207 HIS CD2 C Y N 208 HIS CE1 C Y N 209 HIS NE2 N Y N 210 HIS OXT O N N 211 HIS H H N N 212 HIS H2 H N N 213 HIS HA H N N 214 HIS HB2 H N N 215 HIS HB3 H N N 216 HIS HD1 H N N 217 HIS HD2 H N N 218 HIS HE1 H N N 219 HIS HE2 H N N 220 HIS HXT H N N 221 HOH O O N N 222 HOH H1 H N N 223 HOH H2 H N N 224 ILE N N N N 225 ILE CA C N S 226 ILE C C N N 227 ILE O O N N 228 ILE CB C N S 229 ILE CG1 C N N 230 ILE CG2 C N N 231 ILE CD1 C N N 232 ILE OXT O N N 233 ILE H H N N 234 ILE H2 H N N 235 ILE HA H N N 236 ILE HB H N N 237 ILE HG12 H N N 238 ILE HG13 H N N 239 ILE HG21 H N N 240 ILE HG22 H N N 241 ILE HG23 H N N 242 ILE HD11 H N N 243 ILE HD12 H N N 244 ILE HD13 H N N 245 ILE HXT H N N 246 LEU N N N N 247 LEU CA C N S 248 LEU C C N N 249 LEU O O N N 250 LEU CB C N N 251 LEU CG C N N 252 LEU CD1 C N N 253 LEU CD2 C N N 254 LEU OXT O N N 255 LEU H H N N 256 LEU H2 H N N 257 LEU HA H N N 258 LEU HB2 H N N 259 LEU HB3 H N N 260 LEU HG H N N 261 LEU HD11 H N N 262 LEU HD12 H N N 263 LEU HD13 H N N 264 LEU HD21 H N N 265 LEU HD22 H N N 266 LEU HD23 H N N 267 LEU HXT H N N 268 LYS N N N N 269 LYS CA C N S 270 LYS C C N N 271 LYS O O N N 272 LYS CB C N N 273 LYS CG C N N 274 LYS CD C N N 275 LYS CE C N N 276 LYS NZ N N N 277 LYS OXT O N N 278 LYS H H N N 279 LYS H2 H N N 280 LYS HA H N N 281 LYS HB2 H N N 282 LYS HB3 H N N 283 LYS HG2 H N N 284 LYS HG3 H N N 285 LYS HD2 H N N 286 LYS HD3 H N N 287 LYS HE2 H N N 288 LYS HE3 H N N 289 LYS HZ1 H N N 290 LYS HZ2 H N N 291 LYS HZ3 H N N 292 LYS HXT H N N 293 MET N N N N 294 MET CA C N S 295 MET C C N N 296 MET O O N N 297 MET CB C N N 298 MET CG C N N 299 MET SD S N N 300 MET CE C N N 301 MET OXT O N N 302 MET H H N N 303 MET H2 H N N 304 MET HA H N N 305 MET HB2 H N N 306 MET HB3 H N N 307 MET HG2 H N N 308 MET HG3 H N N 309 MET HE1 H N N 310 MET HE2 H N N 311 MET HE3 H N N 312 MET HXT H N N 313 PHE N N N N 314 PHE CA C N S 315 PHE C C N N 316 PHE O O N N 317 PHE CB C N N 318 PHE CG C Y N 319 PHE CD1 C Y N 320 PHE CD2 C Y N 321 PHE CE1 C Y N 322 PHE CE2 C Y N 323 PHE CZ C Y N 324 PHE OXT O N N 325 PHE H H N N 326 PHE H2 H N N 327 PHE HA H N N 328 PHE HB2 H N N 329 PHE HB3 H N N 330 PHE HD1 H N N 331 PHE HD2 H N N 332 PHE HE1 H N N 333 PHE HE2 H N N 334 PHE HZ H N N 335 PHE HXT H N N 336 PRO N N N N 337 PRO CA C N S 338 PRO C C N N 339 PRO O O N N 340 PRO CB C N N 341 PRO CG C N N 342 PRO CD C N N 343 PRO OXT O N N 344 PRO H H N N 345 PRO HA H N N 346 PRO HB2 H N N 347 PRO HB3 H N N 348 PRO HG2 H N N 349 PRO HG3 H N N 350 PRO HD2 H N N 351 PRO HD3 H N N 352 PRO HXT H N N 353 SER N N N N 354 SER CA C N S 355 SER C C N N 356 SER O O N N 357 SER CB C N N 358 SER OG O N N 359 SER OXT O N N 360 SER H H N N 361 SER H2 H N N 362 SER HA H N N 363 SER HB2 H N N 364 SER HB3 H N N 365 SER HG H N N 366 SER HXT H N N 367 THR N N N N 368 THR CA C N S 369 THR C C N N 370 THR O O N N 371 THR CB C N R 372 THR OG1 O N N 373 THR CG2 C N N 374 THR OXT O N N 375 THR H H N N 376 THR H2 H N N 377 THR HA H N N 378 THR HB H N N 379 THR HG1 H N N 380 THR HG21 H N N 381 THR HG22 H N N 382 THR HG23 H N N 383 THR HXT H N N 384 TPO N N N N 385 TPO CA C N S 386 TPO CB C N R 387 TPO CG2 C N N 388 TPO OG1 O N N 389 TPO P P N N 390 TPO O1P O N N 391 TPO O2P O N N 392 TPO O3P O N N 393 TPO C C N N 394 TPO O O N N 395 TPO OXT O N N 396 TPO H H N N 397 TPO H2 H N N 398 TPO HA H N N 399 TPO HB H N N 400 TPO HG21 H N N 401 TPO HG22 H N N 402 TPO HG23 H N N 403 TPO HOP2 H N N 404 TPO HOP3 H N N 405 TPO HXT H N N 406 TRP N N N N 407 TRP CA C N S 408 TRP C C N N 409 TRP O O N N 410 TRP CB C N N 411 TRP CG C Y N 412 TRP CD1 C Y N 413 TRP CD2 C Y N 414 TRP NE1 N Y N 415 TRP CE2 C Y N 416 TRP CE3 C Y N 417 TRP CZ2 C Y N 418 TRP CZ3 C Y N 419 TRP CH2 C Y N 420 TRP OXT O N N 421 TRP H H N N 422 TRP H2 H N N 423 TRP HA H N N 424 TRP HB2 H N N 425 TRP HB3 H N N 426 TRP HD1 H N N 427 TRP HE1 H N N 428 TRP HE3 H N N 429 TRP HZ2 H N N 430 TRP HZ3 H N N 431 TRP HH2 H N N 432 TRP HXT H N N 433 TYR N N N N 434 TYR CA C N S 435 TYR C C N N 436 TYR O O N N 437 TYR CB C N N 438 TYR CG C Y N 439 TYR CD1 C Y N 440 TYR CD2 C Y N 441 TYR CE1 C Y N 442 TYR CE2 C Y N 443 TYR CZ C Y N 444 TYR OH O N N 445 TYR OXT O N N 446 TYR H H N N 447 TYR H2 H N N 448 TYR HA H N N 449 TYR HB2 H N N 450 TYR HB3 H N N 451 TYR HD1 H N N 452 TYR HD2 H N N 453 TYR HE1 H N N 454 TYR HE2 H N N 455 TYR HH H N N 456 TYR HXT H N N 457 VAL N N N N 458 VAL CA C N S 459 VAL C C N N 460 VAL O O N N 461 VAL CB C N N 462 VAL CG1 C N N 463 VAL CG2 C N N 464 VAL OXT O N N 465 VAL H H N N 466 VAL H2 H N N 467 VAL HA H N N 468 VAL HB H N N 469 VAL HG11 H N N 470 VAL HG12 H N N 471 VAL HG13 H N N 472 VAL HG21 H N N 473 VAL HG22 H N N 474 VAL HG23 H N N 475 VAL HXT H N N 476 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 FZF N24 C23 trip N N 83 FZF C23 C22 sing N N 84 FZF C22 C25 doub Y N 85 FZF C22 C21 sing Y N 86 FZF C25 N26 sing Y N 87 FZF C32 C31 sing N N 88 FZF C32 C33 sing N N 89 FZF C31 C30 sing N N 90 FZF C30 C29 sing N N 91 FZF N28 C29 sing N N 92 FZF N28 C27 sing N N 93 FZF C34 C33 sing N N 94 FZF C34 C29 sing N N 95 FZF N26 C20 sing Y N 96 FZF C21 C27 doub Y N 97 FZF C21 C20 sing Y N 98 FZF C27 N35 sing Y N 99 FZF C20 N19 doub Y N 100 FZF N35 C18 doub Y N 101 FZF N19 C18 sing Y N 102 FZF C18 N17 sing N N 103 FZF C15 C14 doub Y N 104 FZF C15 C16 sing Y N 105 FZF N17 C16 sing N N 106 FZF C14 C05 sing Y N 107 FZF C16 C03 doub Y N 108 FZF C11 O10 sing N N 109 FZF C11 C12 sing N N 110 FZF O10 C09 sing N N 111 FZF C05 C06 sing N N 112 FZF C05 C04 doub Y N 113 FZF C12 N07 sing N N 114 FZF C03 C04 sing Y N 115 FZF C03 O02 sing N N 116 FZF C09 C08 sing N N 117 FZF N07 C06 sing N N 118 FZF N07 C08 sing N N 119 FZF C06 O13 doub N N 120 FZF O02 C01 sing N N 121 FZF C15 H151 sing N N 122 FZF C01 H013 sing N N 123 FZF C01 H011 sing N N 124 FZF C01 H012 sing N N 125 FZF C04 H041 sing N N 126 FZF C08 H082 sing N N 127 FZF C08 H081 sing N N 128 FZF C09 H092 sing N N 129 FZF C09 H091 sing N N 130 FZF C11 H112 sing N N 131 FZF C11 H111 sing N N 132 FZF C12 H121 sing N N 133 FZF C12 H122 sing N N 134 FZF C14 H141 sing N N 135 FZF C25 H251 sing N N 136 FZF C29 H291 sing N N 137 FZF C30 H301 sing N N 138 FZF C30 H302 sing N N 139 FZF C31 H312 sing N N 140 FZF C31 H311 sing N N 141 FZF C32 H322 sing N N 142 FZF C32 H321 sing N N 143 FZF C33 H332 sing N N 144 FZF C33 H331 sing N N 145 FZF C34 H341 sing N N 146 FZF C34 H342 sing N N 147 FZF N17 H171 sing N N 148 FZF N26 H261 sing N N 149 FZF N28 H281 sing N N 150 GLN N CA sing N N 151 GLN N H sing N N 152 GLN N H2 sing N N 153 GLN CA C sing N N 154 GLN CA CB sing N N 155 GLN CA HA sing N N 156 GLN C O doub N N 157 GLN C OXT sing N N 158 GLN CB CG sing N N 159 GLN CB HB2 sing N N 160 GLN CB HB3 sing N N 161 GLN CG CD sing N N 162 GLN CG HG2 sing N N 163 GLN CG HG3 sing N N 164 GLN CD OE1 doub N N 165 GLN CD NE2 sing N N 166 GLN NE2 HE21 sing N N 167 GLN NE2 HE22 sing N N 168 GLN OXT HXT sing N N 169 GLU N CA sing N N 170 GLU N H sing N N 171 GLU N H2 sing N N 172 GLU CA C sing N N 173 GLU CA CB sing N N 174 GLU CA HA sing N N 175 GLU C O doub N N 176 GLU C OXT sing N N 177 GLU CB CG sing N N 178 GLU CB HB2 sing N N 179 GLU CB HB3 sing N N 180 GLU CG CD sing N N 181 GLU CG HG2 sing N N 182 GLU CG HG3 sing N N 183 GLU CD OE1 doub N N 184 GLU CD OE2 sing N N 185 GLU OE2 HE2 sing N N 186 GLU OXT HXT sing N N 187 GLY N CA sing N N 188 GLY N H sing N N 189 GLY N H2 sing N N 190 GLY CA C sing N N 191 GLY CA HA2 sing N N 192 GLY CA HA3 sing N N 193 GLY C O doub N N 194 GLY C OXT sing N N 195 GLY OXT HXT sing N N 196 HIS N CA sing N N 197 HIS N H sing N N 198 HIS N H2 sing N N 199 HIS CA C sing N N 200 HIS CA CB sing N N 201 HIS CA HA sing N N 202 HIS C O doub N N 203 HIS C OXT sing N N 204 HIS CB CG sing N N 205 HIS CB HB2 sing N N 206 HIS CB HB3 sing N N 207 HIS CG ND1 sing Y N 208 HIS CG CD2 doub Y N 209 HIS ND1 CE1 doub Y N 210 HIS ND1 HD1 sing N N 211 HIS CD2 NE2 sing Y N 212 HIS CD2 HD2 sing N N 213 HIS CE1 NE2 sing Y N 214 HIS CE1 HE1 sing N N 215 HIS NE2 HE2 sing N N 216 HIS OXT HXT sing N N 217 HOH O H1 sing N N 218 HOH O H2 sing N N 219 ILE N CA sing N N 220 ILE N H sing N N 221 ILE N H2 sing N N 222 ILE CA C sing N N 223 ILE CA CB sing N N 224 ILE CA HA sing N N 225 ILE C O doub N N 226 ILE C OXT sing N N 227 ILE CB CG1 sing N N 228 ILE CB CG2 sing N N 229 ILE CB HB sing N N 230 ILE CG1 CD1 sing N N 231 ILE CG1 HG12 sing N N 232 ILE CG1 HG13 sing N N 233 ILE CG2 HG21 sing N N 234 ILE CG2 HG22 sing N N 235 ILE CG2 HG23 sing N N 236 ILE CD1 HD11 sing N N 237 ILE CD1 HD12 sing N N 238 ILE CD1 HD13 sing N N 239 ILE OXT HXT sing N N 240 LEU N CA sing N N 241 LEU N H sing N N 242 LEU N H2 sing N N 243 LEU CA C sing N N 244 LEU CA CB sing N N 245 LEU CA HA sing N N 246 LEU C O doub N N 247 LEU C OXT sing N N 248 LEU CB CG sing N N 249 LEU CB HB2 sing N N 250 LEU CB HB3 sing N N 251 LEU CG CD1 sing N N 252 LEU CG CD2 sing N N 253 LEU CG HG sing N N 254 LEU CD1 HD11 sing N N 255 LEU CD1 HD12 sing N N 256 LEU CD1 HD13 sing N N 257 LEU CD2 HD21 sing N N 258 LEU CD2 HD22 sing N N 259 LEU CD2 HD23 sing N N 260 LEU OXT HXT sing N N 261 LYS N CA sing N N 262 LYS N H sing N N 263 LYS N H2 sing N N 264 LYS CA C sing N N 265 LYS CA CB sing N N 266 LYS CA HA sing N N 267 LYS C O doub N N 268 LYS C OXT sing N N 269 LYS CB CG sing N N 270 LYS CB HB2 sing N N 271 LYS CB HB3 sing N N 272 LYS CG CD sing N N 273 LYS CG HG2 sing N N 274 LYS CG HG3 sing N N 275 LYS CD CE sing N N 276 LYS CD HD2 sing N N 277 LYS CD HD3 sing N N 278 LYS CE NZ sing N N 279 LYS CE HE2 sing N N 280 LYS CE HE3 sing N N 281 LYS NZ HZ1 sing N N 282 LYS NZ HZ2 sing N N 283 LYS NZ HZ3 sing N N 284 LYS OXT HXT sing N N 285 MET N CA sing N N 286 MET N H sing N N 287 MET N H2 sing N N 288 MET CA C sing N N 289 MET CA CB sing N N 290 MET CA HA sing N N 291 MET C O doub N N 292 MET C OXT sing N N 293 MET CB CG sing N N 294 MET CB HB2 sing N N 295 MET CB HB3 sing N N 296 MET CG SD sing N N 297 MET CG HG2 sing N N 298 MET CG HG3 sing N N 299 MET SD CE sing N N 300 MET CE HE1 sing N N 301 MET CE HE2 sing N N 302 MET CE HE3 sing N N 303 MET OXT HXT sing N N 304 PHE N CA sing N N 305 PHE N H sing N N 306 PHE N H2 sing N N 307 PHE CA C sing N N 308 PHE CA CB sing N N 309 PHE CA HA sing N N 310 PHE C O doub N N 311 PHE C OXT sing N N 312 PHE CB CG sing N N 313 PHE CB HB2 sing N N 314 PHE CB HB3 sing N N 315 PHE CG CD1 doub Y N 316 PHE CG CD2 sing Y N 317 PHE CD1 CE1 sing Y N 318 PHE CD1 HD1 sing N N 319 PHE CD2 CE2 doub Y N 320 PHE CD2 HD2 sing N N 321 PHE CE1 CZ doub Y N 322 PHE CE1 HE1 sing N N 323 PHE CE2 CZ sing Y N 324 PHE CE2 HE2 sing N N 325 PHE CZ HZ sing N N 326 PHE OXT HXT sing N N 327 PRO N CA sing N N 328 PRO N CD sing N N 329 PRO N H sing N N 330 PRO CA C sing N N 331 PRO CA CB sing N N 332 PRO CA HA sing N N 333 PRO C O doub N N 334 PRO C OXT sing N N 335 PRO CB CG sing N N 336 PRO CB HB2 sing N N 337 PRO CB HB3 sing N N 338 PRO CG CD sing N N 339 PRO CG HG2 sing N N 340 PRO CG HG3 sing N N 341 PRO CD HD2 sing N N 342 PRO CD HD3 sing N N 343 PRO OXT HXT sing N N 344 SER N CA sing N N 345 SER N H sing N N 346 SER N H2 sing N N 347 SER CA C sing N N 348 SER CA CB sing N N 349 SER CA HA sing N N 350 SER C O doub N N 351 SER C OXT sing N N 352 SER CB OG sing N N 353 SER CB HB2 sing N N 354 SER CB HB3 sing N N 355 SER OG HG sing N N 356 SER OXT HXT sing N N 357 THR N CA sing N N 358 THR N H sing N N 359 THR N H2 sing N N 360 THR CA C sing N N 361 THR CA CB sing N N 362 THR CA HA sing N N 363 THR C O doub N N 364 THR C OXT sing N N 365 THR CB OG1 sing N N 366 THR CB CG2 sing N N 367 THR CB HB sing N N 368 THR OG1 HG1 sing N N 369 THR CG2 HG21 sing N N 370 THR CG2 HG22 sing N N 371 THR CG2 HG23 sing N N 372 THR OXT HXT sing N N 373 TPO N CA sing N N 374 TPO N H sing N N 375 TPO N H2 sing N N 376 TPO CA CB sing N N 377 TPO CA C sing N N 378 TPO CA HA sing N N 379 TPO CB CG2 sing N N 380 TPO CB OG1 sing N N 381 TPO CB HB sing N N 382 TPO CG2 HG21 sing N N 383 TPO CG2 HG22 sing N N 384 TPO CG2 HG23 sing N N 385 TPO OG1 P sing N N 386 TPO P O1P doub N N 387 TPO P O2P sing N N 388 TPO P O3P sing N N 389 TPO O2P HOP2 sing N N 390 TPO O3P HOP3 sing N N 391 TPO C O doub N N 392 TPO C OXT sing N N 393 TPO OXT HXT sing N N 394 TRP N CA sing N N 395 TRP N H sing N N 396 TRP N H2 sing N N 397 TRP CA C sing N N 398 TRP CA CB sing N N 399 TRP CA HA sing N N 400 TRP C O doub N N 401 TRP C OXT sing N N 402 TRP CB CG sing N N 403 TRP CB HB2 sing N N 404 TRP CB HB3 sing N N 405 TRP CG CD1 doub Y N 406 TRP CG CD2 sing Y N 407 TRP CD1 NE1 sing Y N 408 TRP CD1 HD1 sing N N 409 TRP CD2 CE2 doub Y N 410 TRP CD2 CE3 sing Y N 411 TRP NE1 CE2 sing Y N 412 TRP NE1 HE1 sing N N 413 TRP CE2 CZ2 sing Y N 414 TRP CE3 CZ3 doub Y N 415 TRP CE3 HE3 sing N N 416 TRP CZ2 CH2 doub Y N 417 TRP CZ2 HZ2 sing N N 418 TRP CZ3 CH2 sing Y N 419 TRP CZ3 HZ3 sing N N 420 TRP CH2 HH2 sing N N 421 TRP OXT HXT sing N N 422 TYR N CA sing N N 423 TYR N H sing N N 424 TYR N H2 sing N N 425 TYR CA C sing N N 426 TYR CA CB sing N N 427 TYR CA HA sing N N 428 TYR C O doub N N 429 TYR C OXT sing N N 430 TYR CB CG sing N N 431 TYR CB HB2 sing N N 432 TYR CB HB3 sing N N 433 TYR CG CD1 doub Y N 434 TYR CG CD2 sing Y N 435 TYR CD1 CE1 sing Y N 436 TYR CD1 HD1 sing N N 437 TYR CD2 CE2 doub Y N 438 TYR CD2 HD2 sing N N 439 TYR CE1 CZ doub Y N 440 TYR CE1 HE1 sing N N 441 TYR CE2 CZ sing Y N 442 TYR CE2 HE2 sing N N 443 TYR CZ OH sing N N 444 TYR OH HH sing N N 445 TYR OXT HXT sing N N 446 VAL N CA sing N N 447 VAL N H sing N N 448 VAL N H2 sing N N 449 VAL CA C sing N N 450 VAL CA CB sing N N 451 VAL CA HA sing N N 452 VAL C O doub N N 453 VAL C OXT sing N N 454 VAL CB CG1 sing N N 455 VAL CB CG2 sing N N 456 VAL CB HB sing N N 457 VAL CG1 HG11 sing N N 458 VAL CG1 HG12 sing N N 459 VAL CG1 HG13 sing N N 460 VAL CG2 HG21 sing N N 461 VAL CG2 HG22 sing N N 462 VAL CG2 HG23 sing N N 463 VAL OXT HXT sing N N 464 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6B4W _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'I 2 2 2' _space_group.name_Hall 'I 2 2' _space_group.IT_number 23 _space_group.crystal_system orthorhombic _space_group.id 1 # _atom_sites.entry_id 7CHM _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.014186 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009176 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008839 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? P ? ? 9.51135 5.44231 ? ? 1.42069 35.72801 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ #