data_7CHV # _entry.id 7CHV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7CHV pdb_00007chv 10.2210/pdb7chv/pdb WWPDB D_1300017659 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7CHV _pdbx_database_status.recvd_initial_deposition_date 2020-07-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Yan, Y.-H.' 1 0000-0002-1331-1241 'Li, G.-B.' 2 0000-0002-4915-6677 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country NE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acta Pharm Sin B' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2211-3835 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 11 _citation.language ? _citation.page_first 1931 _citation.page_last 1946 _citation.title ;AncPhore: A versatile tool for anchor pharmacophore steered drug discovery with applications in discovery of new inhibitors targeting metallo-beta-lactamases and indoleamine/tryptophan 2,3-dioxygenases. ; _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.apsb.2021.01.018 _citation.pdbx_database_id_PubMed 34386329 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Dai, Q.' 1 ? primary 'Yan, Y.' 2 ? primary 'Ning, X.' 3 ? primary 'Li, G.' 4 ? primary 'Yu, J.' 5 ? primary 'Deng, J.' 6 ? primary 'Yang, L.' 7 ? primary 'Li, G.B.' 8 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7CHV _cell.details ? _cell.formula_units_Z ? _cell.length_a 68.655 _cell.length_a_esd ? _cell.length_b 78.891 _cell.length_b_esd ? _cell.length_c 79.808 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7CHV _symmetry.cell_setting ? _symmetry.Int_Tables_number 23 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Beta-lactamase class B VIM-2' 24679.439 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 3 ? ? ? ? 3 non-polymer syn '1-(phenylmethyl)imidazole-2-carboxylic acid' 202.209 1 ? ? ? ? 4 non-polymer syn 'FORMIC ACID' 46.025 2 ? ? ? ? 5 water nat water 18.015 31 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;BlaVIM-2,Metallo beta lactamase VIM-2,Metallo beta-lactamase,Metallo-beta lactamase protein,Metallo-beta-lactamase VIM-2,VIM-2 class B beta-lactamase,VIM-2 class B metallo b-lactamase,VIM-2 metallo beta-lactamase,VIM-2 type metallo-beta-lactamase ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;EYPTVSEIPVGEVRLYQIADGVWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAV STHFHDDRVGGVDVLRAAGVATYASPSTRRLAEVEGNEIPTHSLEGLSSSGDAVRFGPVELFYPGAAHSTDNLVVYVPSA SVLYGGCAIYELSRTSAGNVADADLAEWPTSIERIQQHYPEAQFVIPGHGLPGGLDLLKHTTNVVKAHTNR ; _entity_poly.pdbx_seq_one_letter_code_can ;EYPTVSEIPVGEVRLYQIADGVWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAV STHFHDDRVGGVDVLRAAGVATYASPSTRRLAEVEGNEIPTHSLEGLSSSGDAVRFGPVELFYPGAAHSTDNLVVYVPSA SVLYGGCAIYELSRTSAGNVADADLAEWPTSIERIQQHYPEAQFVIPGHGLPGGLDLLKHTTNVVKAHTNR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 TYR n 1 3 PRO n 1 4 THR n 1 5 VAL n 1 6 SER n 1 7 GLU n 1 8 ILE n 1 9 PRO n 1 10 VAL n 1 11 GLY n 1 12 GLU n 1 13 VAL n 1 14 ARG n 1 15 LEU n 1 16 TYR n 1 17 GLN n 1 18 ILE n 1 19 ALA n 1 20 ASP n 1 21 GLY n 1 22 VAL n 1 23 TRP n 1 24 SER n 1 25 HIS n 1 26 ILE n 1 27 ALA n 1 28 THR n 1 29 GLN n 1 30 SER n 1 31 PHE n 1 32 ASP n 1 33 GLY n 1 34 ALA n 1 35 VAL n 1 36 TYR n 1 37 PRO n 1 38 SER n 1 39 ASN n 1 40 GLY n 1 41 LEU n 1 42 ILE n 1 43 VAL n 1 44 ARG n 1 45 ASP n 1 46 GLY n 1 47 ASP n 1 48 GLU n 1 49 LEU n 1 50 LEU n 1 51 LEU n 1 52 ILE n 1 53 ASP n 1 54 THR n 1 55 ALA n 1 56 TRP n 1 57 GLY n 1 58 ALA n 1 59 LYS n 1 60 ASN n 1 61 THR n 1 62 ALA n 1 63 ALA n 1 64 LEU n 1 65 LEU n 1 66 ALA n 1 67 GLU n 1 68 ILE n 1 69 GLU n 1 70 LYS n 1 71 GLN n 1 72 ILE n 1 73 GLY n 1 74 LEU n 1 75 PRO n 1 76 VAL n 1 77 THR n 1 78 ARG n 1 79 ALA n 1 80 VAL n 1 81 SER n 1 82 THR n 1 83 HIS n 1 84 PHE n 1 85 HIS n 1 86 ASP n 1 87 ASP n 1 88 ARG n 1 89 VAL n 1 90 GLY n 1 91 GLY n 1 92 VAL n 1 93 ASP n 1 94 VAL n 1 95 LEU n 1 96 ARG n 1 97 ALA n 1 98 ALA n 1 99 GLY n 1 100 VAL n 1 101 ALA n 1 102 THR n 1 103 TYR n 1 104 ALA n 1 105 SER n 1 106 PRO n 1 107 SER n 1 108 THR n 1 109 ARG n 1 110 ARG n 1 111 LEU n 1 112 ALA n 1 113 GLU n 1 114 VAL n 1 115 GLU n 1 116 GLY n 1 117 ASN n 1 118 GLU n 1 119 ILE n 1 120 PRO n 1 121 THR n 1 122 HIS n 1 123 SER n 1 124 LEU n 1 125 GLU n 1 126 GLY n 1 127 LEU n 1 128 SER n 1 129 SER n 1 130 SER n 1 131 GLY n 1 132 ASP n 1 133 ALA n 1 134 VAL n 1 135 ARG n 1 136 PHE n 1 137 GLY n 1 138 PRO n 1 139 VAL n 1 140 GLU n 1 141 LEU n 1 142 PHE n 1 143 TYR n 1 144 PRO n 1 145 GLY n 1 146 ALA n 1 147 ALA n 1 148 HIS n 1 149 SER n 1 150 THR n 1 151 ASP n 1 152 ASN n 1 153 LEU n 1 154 VAL n 1 155 VAL n 1 156 TYR n 1 157 VAL n 1 158 PRO n 1 159 SER n 1 160 ALA n 1 161 SER n 1 162 VAL n 1 163 LEU n 1 164 TYR n 1 165 GLY n 1 166 GLY n 1 167 CYS n 1 168 ALA n 1 169 ILE n 1 170 TYR n 1 171 GLU n 1 172 LEU n 1 173 SER n 1 174 ARG n 1 175 THR n 1 176 SER n 1 177 ALA n 1 178 GLY n 1 179 ASN n 1 180 VAL n 1 181 ALA n 1 182 ASP n 1 183 ALA n 1 184 ASP n 1 185 LEU n 1 186 ALA n 1 187 GLU n 1 188 TRP n 1 189 PRO n 1 190 THR n 1 191 SER n 1 192 ILE n 1 193 GLU n 1 194 ARG n 1 195 ILE n 1 196 GLN n 1 197 GLN n 1 198 HIS n 1 199 TYR n 1 200 PRO n 1 201 GLU n 1 202 ALA n 1 203 GLN n 1 204 PHE n 1 205 VAL n 1 206 ILE n 1 207 PRO n 1 208 GLY n 1 209 HIS n 1 210 GLY n 1 211 LEU n 1 212 PRO n 1 213 GLY n 1 214 GLY n 1 215 LEU n 1 216 ASP n 1 217 LEU n 1 218 LEU n 1 219 LYS n 1 220 HIS n 1 221 THR n 1 222 THR n 1 223 ASN n 1 224 VAL n 1 225 VAL n 1 226 LYS n 1 227 ALA n 1 228 HIS n 1 229 THR n 1 230 ASN n 1 231 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 231 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'blaVIM-2, bla vim-2, bla-VIM-2, blasVIM-2, blaVIM2, blm, VIM-2, vim-2, PAERUG_P32_London_17_VIM_2_10_11_06255' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas aeruginosa' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 287 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9K2N0_PSEAI _struct_ref.pdbx_db_accession Q9K2N0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EYPTVSEIPVGEVRLYQIADGVWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAV STHFHDDRVGGVDVLRAAGVATYASPSTRRLAEVEGNEIPTHSLEGLSSSGDAVRFGPVELFYPGAAHSTDNLVVYVPSA SVLYGGCAIYELSRTSAGNVADADLAEWPTSIERIQQHYPEAQFVIPGHGLPGGLDLLKHTTNVVKAHTNR ; _struct_ref.pdbx_align_begin 32 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7CHV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 231 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9K2N0 _struct_ref_seq.db_align_beg 32 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 262 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 32 _struct_ref_seq.pdbx_auth_seq_align_end 262 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FMT non-polymer . 'FORMIC ACID' ? 'C H2 O2' 46.025 FZX non-polymer . '1-(phenylmethyl)imidazole-2-carboxylic acid' ? 'C11 H10 N2 O2' 202.209 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7CHV _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.19 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 43.82 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '28%-35%PEG3350, 0.1M Mg(COOH)2' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 195 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 X CdTe 1M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-05-09 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL19U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL19U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate 41.040 _reflns.entry_id 7CHV _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.17 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11610 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.000 _reflns.pdbx_Rmerge_I_obs 0.226 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 3.700 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 2.163 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.240 _reflns.pdbx_Rpim_I_all 0.078 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 2.200 2.240 ? ? ? ? ? ? 569 99.800 ? ? ? ? 1.001 ? ? ? ? ? ? ? ? 8.200 ? 0.863 ? ? 1.067 0.364 ? 1 1 0.564 ? ? 2.240 2.280 ? ? ? ? ? ? 572 100.000 ? ? ? ? 1.004 ? ? ? ? ? ? ? ? 9.700 ? 0.783 ? ? 1.061 0.338 ? 2 1 0.692 ? ? 2.280 2.320 ? ? ? ? ? ? 562 100.000 ? ? ? ? 0.929 ? ? ? ? ? ? ? ? 10.100 ? 0.843 ? ? 0.979 0.305 ? 3 1 0.721 ? ? 2.320 2.370 ? ? ? ? ? ? 589 100.000 ? ? ? ? 0.796 ? ? ? ? ? ? ? ? 10.200 ? 0.948 ? ? 0.838 0.259 ? 4 1 0.795 ? ? 2.370 2.420 ? ? ? ? ? ? 554 100.000 ? ? ? ? 0.711 ? ? ? ? ? ? ? ? 10.500 ? 1.155 ? ? 0.748 0.230 ? 5 1 0.775 ? ? 2.420 2.480 ? ? ? ? ? ? 575 100.000 ? ? ? ? 0.672 ? ? ? ? ? ? ? ? 10.400 ? 1.219 ? ? 0.707 0.218 ? 6 1 0.810 ? ? 2.480 2.540 ? ? ? ? ? ? 570 100.000 ? ? ? ? 0.606 ? ? ? ? ? ? ? ? 10.400 ? 1.414 ? ? 0.638 0.196 ? 7 1 0.813 ? ? 2.540 2.610 ? ? ? ? ? ? 562 100.000 ? ? ? ? 0.554 ? ? ? ? ? ? ? ? 10.600 ? 1.453 ? ? 0.582 0.179 ? 8 1 0.846 ? ? 2.610 2.690 ? ? ? ? ? ? 591 100.000 ? ? ? ? 0.498 ? ? ? ? ? ? ? ? 10.300 ? 1.767 ? ? 0.525 0.163 ? 9 1 0.881 ? ? 2.690 2.770 ? ? ? ? ? ? 581 99.700 ? ? ? ? 0.460 ? ? ? ? ? ? ? ? 10.100 ? 2.049 ? ? 0.485 0.151 ? 10 1 0.905 ? ? 2.770 2.870 ? ? ? ? ? ? 571 99.800 ? ? ? ? 0.385 ? ? ? ? ? ? ? ? 9.000 ? 2.239 ? ? 0.409 0.135 ? 11 1 0.932 ? ? 2.870 2.990 ? ? ? ? ? ? 573 100.000 ? ? ? ? 0.348 ? ? ? ? ? ? ? ? 10.400 ? 2.252 ? ? 0.367 0.114 ? 12 1 0.948 ? ? 2.990 3.120 ? ? ? ? ? ? 572 100.000 ? ? ? ? 0.313 ? ? ? ? ? ? ? ? 10.800 ? 2.472 ? ? 0.329 0.101 ? 13 1 0.963 ? ? 3.120 3.290 ? ? ? ? ? ? 586 100.000 ? ? ? ? 0.265 ? ? ? ? ? ? ? ? 10.700 ? 2.816 ? ? 0.279 0.087 ? 14 1 0.954 ? ? 3.290 3.490 ? ? ? ? ? ? 583 100.000 ? ? ? ? 0.238 ? ? ? ? ? ? ? ? 10.300 ? 3.381 ? ? 0.251 0.080 ? 15 1 0.963 ? ? 3.490 3.760 ? ? ? ? ? ? 580 100.000 ? ? ? ? 0.200 ? ? ? ? ? ? ? ? 10.000 ? 3.366 ? ? 0.211 0.068 ? 16 1 0.966 ? ? 3.760 4.140 ? ? ? ? ? ? 588 99.700 ? ? ? ? 0.179 ? ? ? ? ? ? ? ? 9.100 ? 3.494 ? ? 0.191 0.065 ? 17 1 0.977 ? ? 4.140 4.740 ? ? ? ? ? ? 598 99.800 ? ? ? ? 0.159 ? ? ? ? ? ? ? ? 9.800 ? 3.598 ? ? 0.169 0.056 ? 18 1 0.973 ? ? 4.740 5.970 ? ? ? ? ? ? 596 99.700 ? ? ? ? 0.152 ? ? ? ? ? ? ? ? 10.200 ? 3.117 ? ? 0.161 0.051 ? 19 1 0.987 ? ? 5.970 50.000 ? ? ? ? ? ? 638 99.400 ? ? ? ? 0.146 ? ? ? ? ? ? ? ? 9.100 ? 3.780 ? ? 0.157 0.056 ? 20 1 0.895 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 92.530 _refine.B_iso_mean 44.1638 _refine.B_iso_min 16.330 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7CHV _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.1740 _refine.ls_d_res_low 34.3270 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11602 _refine.ls_number_reflns_R_free 1160 _refine.ls_number_reflns_R_work 10442 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.8700 _refine.ls_percent_reflns_R_free 10.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2566 _refine.ls_R_factor_R_free 0.3635 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2453 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6JN6 _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 38.7800 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4700 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.1740 _refine_hist.d_res_low 34.3270 _refine_hist.number_atoms_solvent 31 _refine_hist.number_atoms_total 1775 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 231 _refine_hist.pdbx_B_iso_mean_ligand 43.34 _refine_hist.pdbx_B_iso_mean_solvent 37.91 _refine_hist.pdbx_number_atoms_protein 1720 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 24 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.021 ? 1793 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.276 ? 2435 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.060 ? 279 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.008 ? 319 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 15.629 ? 1030 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.1740 2.2727 . . 134 1194 92.0000 . . . 0.4222 0.0000 0.3286 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2727 2.3925 . . 141 1293 100.0000 . . . 0.4132 0.0000 0.3314 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3925 2.5423 . . 145 1310 100.0000 . . . 0.4051 0.0000 0.3112 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5423 2.7385 . . 146 1296 100.0000 . . . 0.3844 0.0000 0.2948 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7385 3.0140 . . 145 1309 100.0000 . . . 0.4203 0.0000 0.2806 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0140 3.4498 . . 149 1320 100.0000 . . . 0.4242 0.0000 0.2713 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.4498 4.3450 . . 147 1333 100.0000 . . . 0.3518 0.0000 0.2198 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.3450 34.3270 . . 153 1387 99.0000 . . . 0.2899 0.0000 0.1914 . . . . . . . . . . . # _struct.entry_id 7CHV _struct.title 'Metallo-Beta-Lactamase VIM-2 in complex with 1-benzyl-1H-imidazole-2-carboxylic acid' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7CHV _struct_keywords.text 'Metallo-beta-lactamase VIM-2, VIM-2, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 4 ? G N N 4 ? H N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 4 ? ILE A 8 ? THR A 35 ILE A 39 5 ? 5 HELX_P HELX_P2 AA2 GLY A 57 ? ILE A 72 ? GLY A 88 ILE A 103 1 ? 16 HELX_P HELX_P3 AA3 HIS A 85 ? GLY A 90 ? HIS A 116 GLY A 121 1 ? 6 HELX_P HELX_P4 AA4 GLY A 91 ? ALA A 98 ? GLY A 122 ALA A 129 1 ? 8 HELX_P HELX_P5 AA5 SER A 105 ? GLY A 116 ? SER A 136 GLY A 147 1 ? 12 HELX_P HELX_P6 AA6 PRO A 158 ? ALA A 160 ? PRO A 189 ALA A 191 5 ? 3 HELX_P HELX_P7 AA7 CYS A 167 ? ILE A 169 ? CYS A 198 ILE A 200 5 ? 3 HELX_P HELX_P8 AA8 GLU A 187 ? TYR A 199 ? GLU A 218 TYR A 230 1 ? 13 HELX_P HELX_P9 AA9 LEU A 215 ? ASN A 230 ? LEU A 246 ASN A 261 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 83 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 114 A ZN 301 1_555 ? ? ? ? ? ? ? 2.058 ? ? metalc2 metalc ? ? A HIS 85 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 116 A ZN 301 1_555 ? ? ? ? ? ? ? 1.902 ? ? metalc3 metalc ? ? A ASP 87 OD2 ? ? ? 1_555 C ZN . ZN ? ? A ASP 118 A ZN 302 1_555 ? ? ? ? ? ? ? 2.167 ? ? metalc4 metalc ? ? A HIS 122 NE2 ? ? ? 1_555 D ZN . ZN ? ? A HIS 153 A ZN 303 6_444 ? ? ? ? ? ? ? 2.217 ? ? metalc5 metalc ? ? A HIS 148 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 179 A ZN 301 1_555 ? ? ? ? ? ? ? 2.007 ? ? metalc6 metalc ? ? A CYS 167 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 198 A ZN 302 1_555 ? ? ? ? ? ? ? 2.380 ? ? metalc7 metalc ? ? A HIS 209 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 240 A ZN 302 1_555 ? ? ? ? ? ? ? 2.221 ? ? metalc8 metalc ? ? A HIS 220 ND1 ? ? ? 1_555 D ZN . ZN ? ? A HIS 251 A ZN 303 1_555 ? ? ? ? ? ? ? 2.120 ? ? metalc9 metalc ? ? B ZN . ZN ? ? ? 1_555 H HOH . O ? ? A ZN 301 A HOH 411 1_555 ? ? ? ? ? ? ? 2.040 ? ? metalc10 metalc ? ? C ZN . ZN ? ? ? 1_555 E FZX . O08 ? ? A ZN 302 A FZX 304 1_555 ? ? ? ? ? ? ? 2.241 ? ? metalc11 metalc ? ? C ZN . ZN ? ? ? 1_555 E FZX . N05 ? ? A ZN 302 A FZX 304 1_555 ? ? ? ? ? ? ? 2.325 ? ? metalc12 metalc ? ? C ZN . ZN ? ? ? 1_555 H HOH . O ? ? A ZN 302 A HOH 411 1_555 ? ? ? ? ? ? ? 2.432 ? ? metalc13 metalc ? ? D ZN . ZN ? ? ? 1_555 F FMT . O1 ? ? A ZN 303 A FMT 305 1_555 ? ? ? ? ? ? ? 2.458 ? ? metalc14 metalc ? ? D ZN . ZN ? ? ? 1_555 G FMT . O2 ? ? A ZN 303 A FMT 306 1_555 ? ? ? ? ? ? ? 1.766 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id SER _struct_mon_prot_cis.label_seq_id 130 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id SER _struct_mon_prot_cis.auth_seq_id 161 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 GLY _struct_mon_prot_cis.pdbx_label_seq_id_2 131 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 GLY _struct_mon_prot_cis.pdbx_auth_seq_id_2 162 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -12.78 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 14 ? ALA A 19 ? ARG A 45 ALA A 50 AA1 2 VAL A 22 ? PHE A 31 ? VAL A 53 PHE A 62 AA1 3 ALA A 34 ? ASP A 45 ? ALA A 65 ASP A 76 AA1 4 GLU A 48 ? ILE A 52 ? GLU A 79 ILE A 83 AA1 5 VAL A 76 ? VAL A 80 ? VAL A 107 VAL A 111 AA1 6 ALA A 101 ? ALA A 104 ? ALA A 132 ALA A 135 AA1 7 HIS A 122 ? SER A 123 ? HIS A 153 SER A 154 AA2 1 ASP A 132 ? PHE A 136 ? ASP A 163 PHE A 167 AA2 2 VAL A 139 ? TYR A 143 ? VAL A 170 TYR A 174 AA2 3 VAL A 154 ? VAL A 157 ? VAL A 185 VAL A 188 AA2 4 VAL A 162 ? GLY A 166 ? VAL A 193 GLY A 197 AA2 5 PHE A 204 ? PRO A 207 ? PHE A 235 PRO A 238 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ALA A 19 ? N ALA A 50 O VAL A 22 ? O VAL A 53 AA1 2 3 N TRP A 23 ? N TRP A 54 O ILE A 42 ? O ILE A 73 AA1 3 4 N LEU A 41 ? N LEU A 72 O ILE A 52 ? O ILE A 83 AA1 4 5 N LEU A 49 ? N LEU A 80 O THR A 77 ? O THR A 108 AA1 5 6 N THR A 77 ? N THR A 108 O ALA A 101 ? O ALA A 132 AA1 6 7 N THR A 102 ? N THR A 133 O HIS A 122 ? O HIS A 153 AA2 1 2 N VAL A 134 ? N VAL A 165 O LEU A 141 ? O LEU A 172 AA2 2 3 N PHE A 142 ? N PHE A 173 O VAL A 154 ? O VAL A 185 AA2 3 4 N VAL A 157 ? N VAL A 188 O VAL A 162 ? O VAL A 193 AA2 4 5 N GLY A 165 ? N GLY A 196 O ILE A 206 ? O ILE A 237 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 301 ? 4 'binding site for residue ZN A 301' AC2 Software A ZN 302 ? 5 'binding site for residue ZN A 302' AC3 Software A ZN 303 ? 4 'binding site for residue ZN A 303' AC4 Software A FZX 304 ? 9 'binding site for residue FZX A 304' AC5 Software A FMT 305 ? 6 'binding site for residue FMT A 305' AC6 Software A FMT 306 ? 6 'binding site for residue FMT A 306' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 HIS A 83 ? HIS A 114 . ? 1_555 ? 2 AC1 4 HIS A 85 ? HIS A 116 . ? 1_555 ? 3 AC1 4 HIS A 148 ? HIS A 179 . ? 1_555 ? 4 AC1 4 HOH H . ? HOH A 411 . ? 1_555 ? 5 AC2 5 ASP A 87 ? ASP A 118 . ? 1_555 ? 6 AC2 5 CYS A 167 ? CYS A 198 . ? 1_555 ? 7 AC2 5 HIS A 209 ? HIS A 240 . ? 1_555 ? 8 AC2 5 FZX E . ? FZX A 304 . ? 1_555 ? 9 AC2 5 HOH H . ? HOH A 411 . ? 1_555 ? 10 AC3 4 HIS A 122 ? HIS A 153 . ? 6_445 ? 11 AC3 4 HIS A 220 ? HIS A 251 . ? 1_555 ? 12 AC3 4 FMT F . ? FMT A 305 . ? 1_555 ? 13 AC3 4 FMT G . ? FMT A 306 . ? 1_555 ? 14 AC4 9 TYR A 36 ? TYR A 67 . ? 1_555 ? 15 AC4 9 ASP A 87 ? ASP A 118 . ? 1_555 ? 16 AC4 9 HIS A 148 ? HIS A 179 . ? 1_555 ? 17 AC4 9 CYS A 167 ? CYS A 198 . ? 1_555 ? 18 AC4 9 ARG A 174 ? ARG A 205 . ? 1_555 ? 19 AC4 9 HIS A 209 ? HIS A 240 . ? 1_555 ? 20 AC4 9 ZN C . ? ZN A 302 . ? 1_555 ? 21 AC4 9 HOH H . ? HOH A 409 . ? 1_555 ? 22 AC4 9 HOH H . ? HOH A 411 . ? 1_555 ? 23 AC5 6 ALA A 101 ? ALA A 132 . ? 6_445 ? 24 AC5 6 HIS A 122 ? HIS A 153 . ? 6_445 ? 25 AC5 6 THR A 175 ? THR A 206 . ? 1_555 ? 26 AC5 6 HIS A 220 ? HIS A 251 . ? 1_555 ? 27 AC5 6 ZN D . ? ZN A 303 . ? 1_555 ? 28 AC5 6 FMT G . ? FMT A 306 . ? 1_555 ? 29 AC6 6 THR A 121 ? THR A 152 . ? 6_445 ? 30 AC6 6 HIS A 122 ? HIS A 153 . ? 6_445 ? 31 AC6 6 HIS A 220 ? HIS A 251 . ? 1_555 ? 32 AC6 6 ASN A 223 ? ASN A 254 . ? 1_555 ? 33 AC6 6 ZN D . ? ZN A 303 . ? 1_555 ? 34 AC6 6 FMT F . ? FMT A 305 . ? 1_555 ? # _atom_sites.entry_id 7CHV _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.014566 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012676 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012530 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 32 32 GLU GLU A . n A 1 2 TYR 2 33 33 TYR TYR A . n A 1 3 PRO 3 34 34 PRO PRO A . n A 1 4 THR 4 35 35 THR THR A . n A 1 5 VAL 5 36 36 VAL VAL A . n A 1 6 SER 6 37 37 SER SER A . n A 1 7 GLU 7 38 38 GLU GLU A . n A 1 8 ILE 8 39 39 ILE ILE A . n A 1 9 PRO 9 40 40 PRO PRO A . n A 1 10 VAL 10 41 41 VAL VAL A . n A 1 11 GLY 11 42 42 GLY GLY A . n A 1 12 GLU 12 43 43 GLU GLU A . n A 1 13 VAL 13 44 44 VAL VAL A . n A 1 14 ARG 14 45 45 ARG ARG A . n A 1 15 LEU 15 46 46 LEU LEU A . n A 1 16 TYR 16 47 47 TYR TYR A . n A 1 17 GLN 17 48 48 GLN GLN A . n A 1 18 ILE 18 49 49 ILE ILE A . n A 1 19 ALA 19 50 50 ALA ALA A . n A 1 20 ASP 20 51 51 ASP ASP A . n A 1 21 GLY 21 52 52 GLY GLY A . n A 1 22 VAL 22 53 53 VAL VAL A . n A 1 23 TRP 23 54 54 TRP TRP A . n A 1 24 SER 24 55 55 SER SER A . n A 1 25 HIS 25 56 56 HIS HIS A . n A 1 26 ILE 26 57 57 ILE ILE A . n A 1 27 ALA 27 58 58 ALA ALA A . n A 1 28 THR 28 59 59 THR THR A . n A 1 29 GLN 29 60 60 GLN GLN A . n A 1 30 SER 30 61 61 SER SER A . n A 1 31 PHE 31 62 62 PHE PHE A . n A 1 32 ASP 32 63 63 ASP ASP A . n A 1 33 GLY 33 64 64 GLY GLY A . n A 1 34 ALA 34 65 65 ALA ALA A . n A 1 35 VAL 35 66 66 VAL VAL A . n A 1 36 TYR 36 67 67 TYR TYR A . n A 1 37 PRO 37 68 68 PRO PRO A . n A 1 38 SER 38 69 69 SER SER A . n A 1 39 ASN 39 70 70 ASN ASN A . n A 1 40 GLY 40 71 71 GLY GLY A . n A 1 41 LEU 41 72 72 LEU LEU A . n A 1 42 ILE 42 73 73 ILE ILE A . n A 1 43 VAL 43 74 74 VAL VAL A . n A 1 44 ARG 44 75 75 ARG ARG A . n A 1 45 ASP 45 76 76 ASP ASP A . n A 1 46 GLY 46 77 77 GLY GLY A . n A 1 47 ASP 47 78 78 ASP ASP A . n A 1 48 GLU 48 79 79 GLU GLU A . n A 1 49 LEU 49 80 80 LEU LEU A . n A 1 50 LEU 50 81 81 LEU LEU A . n A 1 51 LEU 51 82 82 LEU LEU A . n A 1 52 ILE 52 83 83 ILE ILE A . n A 1 53 ASP 53 84 84 ASP ASP A . n A 1 54 THR 54 85 85 THR THR A . n A 1 55 ALA 55 86 86 ALA ALA A . n A 1 56 TRP 56 87 87 TRP TRP A . n A 1 57 GLY 57 88 88 GLY GLY A . n A 1 58 ALA 58 89 89 ALA ALA A . n A 1 59 LYS 59 90 90 LYS LYS A . n A 1 60 ASN 60 91 91 ASN ASN A . n A 1 61 THR 61 92 92 THR THR A . n A 1 62 ALA 62 93 93 ALA ALA A . n A 1 63 ALA 63 94 94 ALA ALA A . n A 1 64 LEU 64 95 95 LEU LEU A . n A 1 65 LEU 65 96 96 LEU LEU A . n A 1 66 ALA 66 97 97 ALA ALA A . n A 1 67 GLU 67 98 98 GLU GLU A . n A 1 68 ILE 68 99 99 ILE ILE A . n A 1 69 GLU 69 100 100 GLU GLU A . n A 1 70 LYS 70 101 101 LYS LYS A . n A 1 71 GLN 71 102 102 GLN GLN A . n A 1 72 ILE 72 103 103 ILE ILE A . n A 1 73 GLY 73 104 104 GLY GLY A . n A 1 74 LEU 74 105 105 LEU LEU A . n A 1 75 PRO 75 106 106 PRO PRO A . n A 1 76 VAL 76 107 107 VAL VAL A . n A 1 77 THR 77 108 108 THR THR A . n A 1 78 ARG 78 109 109 ARG ARG A . n A 1 79 ALA 79 110 110 ALA ALA A . n A 1 80 VAL 80 111 111 VAL VAL A . n A 1 81 SER 81 112 112 SER SER A . n A 1 82 THR 82 113 113 THR THR A . n A 1 83 HIS 83 114 114 HIS HIS A . n A 1 84 PHE 84 115 115 PHE PHE A . n A 1 85 HIS 85 116 116 HIS HIS A . n A 1 86 ASP 86 117 117 ASP ASP A . n A 1 87 ASP 87 118 118 ASP ASP A . n A 1 88 ARG 88 119 119 ARG ARG A . n A 1 89 VAL 89 120 120 VAL VAL A . n A 1 90 GLY 90 121 121 GLY GLY A . n A 1 91 GLY 91 122 122 GLY GLY A . n A 1 92 VAL 92 123 123 VAL VAL A . n A 1 93 ASP 93 124 124 ASP ASP A . n A 1 94 VAL 94 125 125 VAL VAL A . n A 1 95 LEU 95 126 126 LEU LEU A . n A 1 96 ARG 96 127 127 ARG ARG A . n A 1 97 ALA 97 128 128 ALA ALA A . n A 1 98 ALA 98 129 129 ALA ALA A . n A 1 99 GLY 99 130 130 GLY GLY A . n A 1 100 VAL 100 131 131 VAL VAL A . n A 1 101 ALA 101 132 132 ALA ALA A . n A 1 102 THR 102 133 133 THR THR A . n A 1 103 TYR 103 134 134 TYR TYR A . n A 1 104 ALA 104 135 135 ALA ALA A . n A 1 105 SER 105 136 136 SER SER A . n A 1 106 PRO 106 137 137 PRO PRO A . n A 1 107 SER 107 138 138 SER SER A . n A 1 108 THR 108 139 139 THR THR A . n A 1 109 ARG 109 140 140 ARG ARG A . n A 1 110 ARG 110 141 141 ARG ARG A . n A 1 111 LEU 111 142 142 LEU LEU A . n A 1 112 ALA 112 143 143 ALA ALA A . n A 1 113 GLU 113 144 144 GLU GLU A . n A 1 114 VAL 114 145 145 VAL VAL A . n A 1 115 GLU 115 146 146 GLU GLU A . n A 1 116 GLY 116 147 147 GLY GLY A . n A 1 117 ASN 117 148 148 ASN ASN A . n A 1 118 GLU 118 149 149 GLU GLU A . n A 1 119 ILE 119 150 150 ILE ILE A . n A 1 120 PRO 120 151 151 PRO PRO A . n A 1 121 THR 121 152 152 THR THR A . n A 1 122 HIS 122 153 153 HIS HIS A . n A 1 123 SER 123 154 154 SER SER A . n A 1 124 LEU 124 155 155 LEU LEU A . n A 1 125 GLU 125 156 156 GLU GLU A . n A 1 126 GLY 126 157 157 GLY GLY A . n A 1 127 LEU 127 158 158 LEU LEU A . n A 1 128 SER 128 159 159 SER SER A . n A 1 129 SER 129 160 160 SER SER A . n A 1 130 SER 130 161 161 SER SER A . n A 1 131 GLY 131 162 162 GLY GLY A . n A 1 132 ASP 132 163 163 ASP ASP A . n A 1 133 ALA 133 164 164 ALA ALA A . n A 1 134 VAL 134 165 165 VAL VAL A . n A 1 135 ARG 135 166 166 ARG ARG A . n A 1 136 PHE 136 167 167 PHE PHE A . n A 1 137 GLY 137 168 168 GLY GLY A . n A 1 138 PRO 138 169 169 PRO PRO A . n A 1 139 VAL 139 170 170 VAL VAL A . n A 1 140 GLU 140 171 171 GLU GLU A . n A 1 141 LEU 141 172 172 LEU LEU A . n A 1 142 PHE 142 173 173 PHE PHE A . n A 1 143 TYR 143 174 174 TYR TYR A . n A 1 144 PRO 144 175 175 PRO PRO A . n A 1 145 GLY 145 176 176 GLY GLY A . n A 1 146 ALA 146 177 177 ALA ALA A . n A 1 147 ALA 147 178 178 ALA ALA A . n A 1 148 HIS 148 179 179 HIS HIS A . n A 1 149 SER 149 180 180 SER SER A . n A 1 150 THR 150 181 181 THR THR A . n A 1 151 ASP 151 182 182 ASP ASP A . n A 1 152 ASN 152 183 183 ASN ASN A . n A 1 153 LEU 153 184 184 LEU LEU A . n A 1 154 VAL 154 185 185 VAL VAL A . n A 1 155 VAL 155 186 186 VAL VAL A . n A 1 156 TYR 156 187 187 TYR TYR A . n A 1 157 VAL 157 188 188 VAL VAL A . n A 1 158 PRO 158 189 189 PRO PRO A . n A 1 159 SER 159 190 190 SER SER A . n A 1 160 ALA 160 191 191 ALA ALA A . n A 1 161 SER 161 192 192 SER SER A . n A 1 162 VAL 162 193 193 VAL VAL A . n A 1 163 LEU 163 194 194 LEU LEU A . n A 1 164 TYR 164 195 195 TYR TYR A . n A 1 165 GLY 165 196 196 GLY GLY A . n A 1 166 GLY 166 197 197 GLY GLY A . n A 1 167 CYS 167 198 198 CYS CYS A . n A 1 168 ALA 168 199 199 ALA ALA A . n A 1 169 ILE 169 200 200 ILE ILE A . n A 1 170 TYR 170 201 201 TYR TYR A . n A 1 171 GLU 171 202 202 GLU GLU A . n A 1 172 LEU 172 203 203 LEU LEU A . n A 1 173 SER 173 204 204 SER SER A . n A 1 174 ARG 174 205 205 ARG ARG A . n A 1 175 THR 175 206 206 THR THR A . n A 1 176 SER 176 207 207 SER SER A . n A 1 177 ALA 177 208 208 ALA ALA A . n A 1 178 GLY 178 209 209 GLY GLY A . n A 1 179 ASN 179 210 210 ASN ASN A . n A 1 180 VAL 180 211 211 VAL VAL A . n A 1 181 ALA 181 212 212 ALA ALA A . n A 1 182 ASP 182 213 213 ASP ASP A . n A 1 183 ALA 183 214 214 ALA ALA A . n A 1 184 ASP 184 215 215 ASP ASP A . n A 1 185 LEU 185 216 216 LEU LEU A . n A 1 186 ALA 186 217 217 ALA ALA A . n A 1 187 GLU 187 218 218 GLU GLU A . n A 1 188 TRP 188 219 219 TRP TRP A . n A 1 189 PRO 189 220 220 PRO PRO A . n A 1 190 THR 190 221 221 THR THR A . n A 1 191 SER 191 222 222 SER SER A . n A 1 192 ILE 192 223 223 ILE ILE A . n A 1 193 GLU 193 224 224 GLU GLU A . n A 1 194 ARG 194 225 225 ARG ARG A . n A 1 195 ILE 195 226 226 ILE ILE A . n A 1 196 GLN 196 227 227 GLN GLN A . n A 1 197 GLN 197 228 228 GLN GLN A . n A 1 198 HIS 198 229 229 HIS HIS A . n A 1 199 TYR 199 230 230 TYR TYR A . n A 1 200 PRO 200 231 231 PRO PRO A . n A 1 201 GLU 201 232 232 GLU GLU A . n A 1 202 ALA 202 233 233 ALA ALA A . n A 1 203 GLN 203 234 234 GLN GLN A . n A 1 204 PHE 204 235 235 PHE PHE A . n A 1 205 VAL 205 236 236 VAL VAL A . n A 1 206 ILE 206 237 237 ILE ILE A . n A 1 207 PRO 207 238 238 PRO PRO A . n A 1 208 GLY 208 239 239 GLY GLY A . n A 1 209 HIS 209 240 240 HIS HIS A . n A 1 210 GLY 210 241 241 GLY GLY A . n A 1 211 LEU 211 242 242 LEU LEU A . n A 1 212 PRO 212 243 243 PRO PRO A . n A 1 213 GLY 213 244 244 GLY GLY A . n A 1 214 GLY 214 245 245 GLY GLY A . n A 1 215 LEU 215 246 246 LEU LEU A . n A 1 216 ASP 216 247 247 ASP ASP A . n A 1 217 LEU 217 248 248 LEU LEU A . n A 1 218 LEU 218 249 249 LEU LEU A . n A 1 219 LYS 219 250 250 LYS LYS A . n A 1 220 HIS 220 251 251 HIS HIS A . n A 1 221 THR 221 252 252 THR THR A . n A 1 222 THR 222 253 253 THR THR A . n A 1 223 ASN 223 254 254 ASN ASN A . n A 1 224 VAL 224 255 255 VAL VAL A . n A 1 225 VAL 225 256 256 VAL VAL A . n A 1 226 LYS 226 257 257 LYS LYS A . n A 1 227 ALA 227 258 258 ALA ALA A . n A 1 228 HIS 228 259 259 HIS HIS A . n A 1 229 THR 229 260 260 THR THR A . n A 1 230 ASN 230 261 261 ASN ASN A . n A 1 231 ARG 231 262 262 ARG ARG A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 301 301 ZN ZN A . C 2 ZN 1 302 302 ZN ZN A . D 2 ZN 1 303 303 ZN ZN A . E 3 FZX 1 304 401 FZX L76 A . F 4 FMT 1 305 501 FMT FMT A . G 4 FMT 1 306 502 FMT FMT A . H 5 HOH 1 401 26 HOH HOH A . H 5 HOH 2 402 20 HOH HOH A . H 5 HOH 3 403 4 HOH HOH A . H 5 HOH 4 404 13 HOH HOH A . H 5 HOH 5 405 31 HOH HOH A . H 5 HOH 6 406 32 HOH HOH A . H 5 HOH 7 407 10 HOH HOH A . H 5 HOH 8 408 21 HOH HOH A . H 5 HOH 9 409 3 HOH HOH A . H 5 HOH 10 410 5 HOH HOH A . H 5 HOH 11 411 1 HOH HOH A . H 5 HOH 12 412 7 HOH HOH A . H 5 HOH 13 413 12 HOH HOH A . H 5 HOH 14 414 28 HOH HOH A . H 5 HOH 15 415 2 HOH HOH A . H 5 HOH 16 416 34 HOH HOH A . H 5 HOH 17 417 25 HOH HOH A . H 5 HOH 18 418 19 HOH HOH A . H 5 HOH 19 419 8 HOH HOH A . H 5 HOH 20 420 22 HOH HOH A . H 5 HOH 21 421 23 HOH HOH A . H 5 HOH 22 422 35 HOH HOH A . H 5 HOH 23 423 24 HOH HOH A . H 5 HOH 24 424 18 HOH HOH A . H 5 HOH 25 425 6 HOH HOH A . H 5 HOH 26 426 11 HOH HOH A . H 5 HOH 27 427 17 HOH HOH A . H 5 HOH 28 428 27 HOH HOH A . H 5 HOH 29 429 29 HOH HOH A . H 5 HOH 30 430 33 HOH HOH A . H 5 HOH 31 431 30 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 200 ? 1 MORE -80 ? 1 'SSA (A^2)' 9620 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 83 ? A HIS 114 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 ND1 ? A HIS 85 ? A HIS 116 ? 1_555 90.0 ? 2 NE2 ? A HIS 83 ? A HIS 114 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 NE2 ? A HIS 148 ? A HIS 179 ? 1_555 111.6 ? 3 ND1 ? A HIS 85 ? A HIS 116 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 NE2 ? A HIS 148 ? A HIS 179 ? 1_555 109.5 ? 4 NE2 ? A HIS 83 ? A HIS 114 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O ? H HOH . ? A HOH 411 ? 1_555 118.2 ? 5 ND1 ? A HIS 85 ? A HIS 116 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O ? H HOH . ? A HOH 411 ? 1_555 111.8 ? 6 NE2 ? A HIS 148 ? A HIS 179 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O ? H HOH . ? A HOH 411 ? 1_555 113.3 ? 7 OD2 ? A ASP 87 ? A ASP 118 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 SG ? A CYS 167 ? A CYS 198 ? 1_555 97.7 ? 8 OD2 ? A ASP 87 ? A ASP 118 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 NE2 ? A HIS 209 ? A HIS 240 ? 1_555 83.9 ? 9 SG ? A CYS 167 ? A CYS 198 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 NE2 ? A HIS 209 ? A HIS 240 ? 1_555 87.7 ? 10 OD2 ? A ASP 87 ? A ASP 118 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O08 ? E FZX . ? A FZX 304 ? 1_555 169.7 ? 11 SG ? A CYS 167 ? A CYS 198 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O08 ? E FZX . ? A FZX 304 ? 1_555 92.5 ? 12 NE2 ? A HIS 209 ? A HIS 240 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O08 ? E FZX . ? A FZX 304 ? 1_555 94.9 ? 13 OD2 ? A ASP 87 ? A ASP 118 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 N05 ? E FZX . ? A FZX 304 ? 1_555 92.0 ? 14 SG ? A CYS 167 ? A CYS 198 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 N05 ? E FZX . ? A FZX 304 ? 1_555 170.2 ? 15 NE2 ? A HIS 209 ? A HIS 240 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 N05 ? E FZX . ? A FZX 304 ? 1_555 92.6 ? 16 O08 ? E FZX . ? A FZX 304 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 N05 ? E FZX . ? A FZX 304 ? 1_555 77.8 ? 17 OD2 ? A ASP 87 ? A ASP 118 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O ? H HOH . ? A HOH 411 ? 1_555 76.7 ? 18 SG ? A CYS 167 ? A CYS 198 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O ? H HOH . ? A HOH 411 ? 1_555 107.6 ? 19 NE2 ? A HIS 209 ? A HIS 240 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O ? H HOH . ? A HOH 411 ? 1_555 156.6 ? 20 O08 ? E FZX . ? A FZX 304 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O ? H HOH . ? A HOH 411 ? 1_555 101.8 ? 21 N05 ? E FZX . ? A FZX 304 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O ? H HOH . ? A HOH 411 ? 1_555 75.3 ? 22 NE2 ? A HIS 122 ? A HIS 153 ? 1_555 ZN ? D ZN . ? A ZN 303 ? 6_444 ND1 ? A HIS 220 ? A HIS 251 ? 1_555 61.6 ? 23 NE2 ? A HIS 122 ? A HIS 153 ? 1_555 ZN ? D ZN . ? A ZN 303 ? 6_444 O1 ? F FMT . ? A FMT 305 ? 1_555 59.9 ? 24 ND1 ? A HIS 220 ? A HIS 251 ? 1_555 ZN ? D ZN . ? A ZN 303 ? 6_444 O1 ? F FMT . ? A FMT 305 ? 1_555 2.2 ? 25 NE2 ? A HIS 122 ? A HIS 153 ? 1_555 ZN ? D ZN . ? A ZN 303 ? 6_444 O2 ? G FMT . ? A FMT 306 ? 1_555 59.1 ? 26 ND1 ? A HIS 220 ? A HIS 251 ? 1_555 ZN ? D ZN . ? A ZN 303 ? 6_444 O2 ? G FMT . ? A FMT 306 ? 1_555 3.5 ? 27 O1 ? F FMT . ? A FMT 305 ? 1_555 ZN ? D ZN . ? A ZN 303 ? 6_444 O2 ? G FMT . ? A FMT 306 ? 1_555 4.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-07-14 2 'Structure model' 1 1 2022-04-27 3 'Structure model' 1 2 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' database_2 4 3 'Structure model' chem_comp_atom 5 3 'Structure model' chem_comp_bond 6 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 2 'Structure model' '_database_2.pdbx_DOI' 13 2 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_phasing_MR.entry_id 7CHV _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details ? _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 5.980 _pdbx_phasing_MR.d_res_low_rotation 39.450 _pdbx_phasing_MR.d_res_high_translation 5.980 _pdbx_phasing_MR.d_res_low_translation 39.450 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.6.0 3 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.10.1-2155 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 5 # _pdbx_entry_details.entry_id 7CHV _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OH _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 TYR _pdbx_validate_close_contact.auth_seq_id_1 33 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 OD1 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 ASN _pdbx_validate_close_contact.auth_seq_id_2 70 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.14 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 37 ? ? -69.91 4.85 2 1 ASP A 63 ? ? 16.45 72.47 3 1 ASP A 84 ? ? 67.39 146.45 4 1 TRP A 87 ? ? 66.52 69.77 5 1 ALA A 135 ? ? -171.87 149.37 6 1 SER A 136 ? ? -49.60 150.60 7 1 ALA A 178 ? ? -157.52 -100.79 8 1 SER A 190 ? ? -35.11 -34.07 9 1 ASN A 210 ? ? -63.76 92.91 10 1 VAL A 211 ? ? -97.33 38.01 11 1 TYR A 230 ? ? -144.15 51.23 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 32 ? CG ? A GLU 1 CG 2 1 Y 1 A GLU 32 ? CD ? A GLU 1 CD 3 1 Y 1 A GLU 32 ? OE1 ? A GLU 1 OE1 4 1 Y 1 A GLU 32 ? OE2 ? A GLU 1 OE2 5 1 Y 1 A SER 37 ? CB ? A SER 6 CB 6 1 Y 1 A SER 37 ? OG ? A SER 6 OG 7 1 Y 1 A ARG 45 ? CG ? A ARG 14 CG 8 1 Y 1 A ARG 45 ? CD ? A ARG 14 CD 9 1 Y 1 A ARG 45 ? NE ? A ARG 14 NE 10 1 Y 1 A ARG 45 ? CZ ? A ARG 14 CZ 11 1 Y 1 A ARG 45 ? NH1 ? A ARG 14 NH1 12 1 Y 1 A ARG 45 ? NH2 ? A ARG 14 NH2 13 1 Y 1 A ASP 51 ? OD1 ? A ASP 20 OD1 14 1 Y 1 A ASP 51 ? OD2 ? A ASP 20 OD2 15 1 Y 1 A GLU 224 ? CD ? A GLU 193 CD 16 1 Y 1 A GLU 224 ? OE1 ? A GLU 193 OE1 17 1 Y 1 A GLU 224 ? OE2 ? A GLU 193 OE2 18 1 Y 1 A ARG 262 ? CG ? A ARG 231 CG 19 1 Y 1 A ARG 262 ? CD ? A ARG 231 CD 20 1 Y 1 A ARG 262 ? NE ? A ARG 231 NE 21 1 Y 1 A ARG 262 ? CZ ? A ARG 231 CZ 22 1 Y 1 A ARG 262 ? NH1 ? A ARG 231 NH1 23 1 Y 1 A ARG 262 ? NH2 ? A ARG 231 NH2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 FMT C C N N 88 FMT O1 O N N 89 FMT O2 O N N 90 FMT H H N N 91 FMT HO2 H N N 92 FZX C11 C Y N 93 FZX C10 C Y N 94 FZX C12 C Y N 95 FZX C13 C Y N 96 FZX C14 C Y N 97 FZX C15 C Y N 98 FZX C01 C Y N 99 FZX C02 C Y N 100 FZX N03 N Y N 101 FZX C04 C Y N 102 FZX N05 N Y N 103 FZX C06 C N N 104 FZX O07 O N N 105 FZX O08 O N N 106 FZX C09 C N N 107 FZX H1 H N N 108 FZX H2 H N N 109 FZX H3 H N N 110 FZX H4 H N N 111 FZX H5 H N N 112 FZX H6 H N N 113 FZX H7 H N N 114 FZX H8 H N N 115 FZX H9 H N N 116 FZX H10 H N N 117 GLN N N N N 118 GLN CA C N S 119 GLN C C N N 120 GLN O O N N 121 GLN CB C N N 122 GLN CG C N N 123 GLN CD C N N 124 GLN OE1 O N N 125 GLN NE2 N N N 126 GLN OXT O N N 127 GLN H H N N 128 GLN H2 H N N 129 GLN HA H N N 130 GLN HB2 H N N 131 GLN HB3 H N N 132 GLN HG2 H N N 133 GLN HG3 H N N 134 GLN HE21 H N N 135 GLN HE22 H N N 136 GLN HXT H N N 137 GLU N N N N 138 GLU CA C N S 139 GLU C C N N 140 GLU O O N N 141 GLU CB C N N 142 GLU CG C N N 143 GLU CD C N N 144 GLU OE1 O N N 145 GLU OE2 O N N 146 GLU OXT O N N 147 GLU H H N N 148 GLU H2 H N N 149 GLU HA H N N 150 GLU HB2 H N N 151 GLU HB3 H N N 152 GLU HG2 H N N 153 GLU HG3 H N N 154 GLU HE2 H N N 155 GLU HXT H N N 156 GLY N N N N 157 GLY CA C N N 158 GLY C C N N 159 GLY O O N N 160 GLY OXT O N N 161 GLY H H N N 162 GLY H2 H N N 163 GLY HA2 H N N 164 GLY HA3 H N N 165 GLY HXT H N N 166 HIS N N N N 167 HIS CA C N S 168 HIS C C N N 169 HIS O O N N 170 HIS CB C N N 171 HIS CG C Y N 172 HIS ND1 N Y N 173 HIS CD2 C Y N 174 HIS CE1 C Y N 175 HIS NE2 N Y N 176 HIS OXT O N N 177 HIS H H N N 178 HIS H2 H N N 179 HIS HA H N N 180 HIS HB2 H N N 181 HIS HB3 H N N 182 HIS HD1 H N N 183 HIS HD2 H N N 184 HIS HE1 H N N 185 HIS HE2 H N N 186 HIS HXT H N N 187 HOH O O N N 188 HOH H1 H N N 189 HOH H2 H N N 190 ILE N N N N 191 ILE CA C N S 192 ILE C C N N 193 ILE O O N N 194 ILE CB C N S 195 ILE CG1 C N N 196 ILE CG2 C N N 197 ILE CD1 C N N 198 ILE OXT O N N 199 ILE H H N N 200 ILE H2 H N N 201 ILE HA H N N 202 ILE HB H N N 203 ILE HG12 H N N 204 ILE HG13 H N N 205 ILE HG21 H N N 206 ILE HG22 H N N 207 ILE HG23 H N N 208 ILE HD11 H N N 209 ILE HD12 H N N 210 ILE HD13 H N N 211 ILE HXT H N N 212 LEU N N N N 213 LEU CA C N S 214 LEU C C N N 215 LEU O O N N 216 LEU CB C N N 217 LEU CG C N N 218 LEU CD1 C N N 219 LEU CD2 C N N 220 LEU OXT O N N 221 LEU H H N N 222 LEU H2 H N N 223 LEU HA H N N 224 LEU HB2 H N N 225 LEU HB3 H N N 226 LEU HG H N N 227 LEU HD11 H N N 228 LEU HD12 H N N 229 LEU HD13 H N N 230 LEU HD21 H N N 231 LEU HD22 H N N 232 LEU HD23 H N N 233 LEU HXT H N N 234 LYS N N N N 235 LYS CA C N S 236 LYS C C N N 237 LYS O O N N 238 LYS CB C N N 239 LYS CG C N N 240 LYS CD C N N 241 LYS CE C N N 242 LYS NZ N N N 243 LYS OXT O N N 244 LYS H H N N 245 LYS H2 H N N 246 LYS HA H N N 247 LYS HB2 H N N 248 LYS HB3 H N N 249 LYS HG2 H N N 250 LYS HG3 H N N 251 LYS HD2 H N N 252 LYS HD3 H N N 253 LYS HE2 H N N 254 LYS HE3 H N N 255 LYS HZ1 H N N 256 LYS HZ2 H N N 257 LYS HZ3 H N N 258 LYS HXT H N N 259 PHE N N N N 260 PHE CA C N S 261 PHE C C N N 262 PHE O O N N 263 PHE CB C N N 264 PHE CG C Y N 265 PHE CD1 C Y N 266 PHE CD2 C Y N 267 PHE CE1 C Y N 268 PHE CE2 C Y N 269 PHE CZ C Y N 270 PHE OXT O N N 271 PHE H H N N 272 PHE H2 H N N 273 PHE HA H N N 274 PHE HB2 H N N 275 PHE HB3 H N N 276 PHE HD1 H N N 277 PHE HD2 H N N 278 PHE HE1 H N N 279 PHE HE2 H N N 280 PHE HZ H N N 281 PHE HXT H N N 282 PRO N N N N 283 PRO CA C N S 284 PRO C C N N 285 PRO O O N N 286 PRO CB C N N 287 PRO CG C N N 288 PRO CD C N N 289 PRO OXT O N N 290 PRO H H N N 291 PRO HA H N N 292 PRO HB2 H N N 293 PRO HB3 H N N 294 PRO HG2 H N N 295 PRO HG3 H N N 296 PRO HD2 H N N 297 PRO HD3 H N N 298 PRO HXT H N N 299 SER N N N N 300 SER CA C N S 301 SER C C N N 302 SER O O N N 303 SER CB C N N 304 SER OG O N N 305 SER OXT O N N 306 SER H H N N 307 SER H2 H N N 308 SER HA H N N 309 SER HB2 H N N 310 SER HB3 H N N 311 SER HG H N N 312 SER HXT H N N 313 THR N N N N 314 THR CA C N S 315 THR C C N N 316 THR O O N N 317 THR CB C N R 318 THR OG1 O N N 319 THR CG2 C N N 320 THR OXT O N N 321 THR H H N N 322 THR H2 H N N 323 THR HA H N N 324 THR HB H N N 325 THR HG1 H N N 326 THR HG21 H N N 327 THR HG22 H N N 328 THR HG23 H N N 329 THR HXT H N N 330 TRP N N N N 331 TRP CA C N S 332 TRP C C N N 333 TRP O O N N 334 TRP CB C N N 335 TRP CG C Y N 336 TRP CD1 C Y N 337 TRP CD2 C Y N 338 TRP NE1 N Y N 339 TRP CE2 C Y N 340 TRP CE3 C Y N 341 TRP CZ2 C Y N 342 TRP CZ3 C Y N 343 TRP CH2 C Y N 344 TRP OXT O N N 345 TRP H H N N 346 TRP H2 H N N 347 TRP HA H N N 348 TRP HB2 H N N 349 TRP HB3 H N N 350 TRP HD1 H N N 351 TRP HE1 H N N 352 TRP HE3 H N N 353 TRP HZ2 H N N 354 TRP HZ3 H N N 355 TRP HH2 H N N 356 TRP HXT H N N 357 TYR N N N N 358 TYR CA C N S 359 TYR C C N N 360 TYR O O N N 361 TYR CB C N N 362 TYR CG C Y N 363 TYR CD1 C Y N 364 TYR CD2 C Y N 365 TYR CE1 C Y N 366 TYR CE2 C Y N 367 TYR CZ C Y N 368 TYR OH O N N 369 TYR OXT O N N 370 TYR H H N N 371 TYR H2 H N N 372 TYR HA H N N 373 TYR HB2 H N N 374 TYR HB3 H N N 375 TYR HD1 H N N 376 TYR HD2 H N N 377 TYR HE1 H N N 378 TYR HE2 H N N 379 TYR HH H N N 380 TYR HXT H N N 381 VAL N N N N 382 VAL CA C N S 383 VAL C C N N 384 VAL O O N N 385 VAL CB C N N 386 VAL CG1 C N N 387 VAL CG2 C N N 388 VAL OXT O N N 389 VAL H H N N 390 VAL H2 H N N 391 VAL HA H N N 392 VAL HB H N N 393 VAL HG11 H N N 394 VAL HG12 H N N 395 VAL HG13 H N N 396 VAL HG21 H N N 397 VAL HG22 H N N 398 VAL HG23 H N N 399 VAL HXT H N N 400 ZN ZN ZN N N 401 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 FMT C O1 doub N N 83 FMT C O2 sing N N 84 FMT C H sing N N 85 FMT O2 HO2 sing N N 86 FZX C01 N05 sing Y N 87 FZX C01 C02 doub Y N 88 FZX N05 C04 doub Y N 89 FZX C02 N03 sing Y N 90 FZX O08 C06 doub N N 91 FZX C04 C06 sing N N 92 FZX C04 N03 sing Y N 93 FZX C06 O07 sing N N 94 FZX N03 C09 sing N N 95 FZX C09 C10 sing N N 96 FZX C11 C10 doub Y N 97 FZX C11 C12 sing Y N 98 FZX C10 C15 sing Y N 99 FZX C12 C13 doub Y N 100 FZX C15 C14 doub Y N 101 FZX C13 C14 sing Y N 102 FZX C11 H1 sing N N 103 FZX C12 H2 sing N N 104 FZX C13 H3 sing N N 105 FZX C14 H4 sing N N 106 FZX C15 H5 sing N N 107 FZX C01 H6 sing N N 108 FZX C02 H7 sing N N 109 FZX O07 H8 sing N N 110 FZX C09 H9 sing N N 111 FZX C09 H10 sing N N 112 GLN N CA sing N N 113 GLN N H sing N N 114 GLN N H2 sing N N 115 GLN CA C sing N N 116 GLN CA CB sing N N 117 GLN CA HA sing N N 118 GLN C O doub N N 119 GLN C OXT sing N N 120 GLN CB CG sing N N 121 GLN CB HB2 sing N N 122 GLN CB HB3 sing N N 123 GLN CG CD sing N N 124 GLN CG HG2 sing N N 125 GLN CG HG3 sing N N 126 GLN CD OE1 doub N N 127 GLN CD NE2 sing N N 128 GLN NE2 HE21 sing N N 129 GLN NE2 HE22 sing N N 130 GLN OXT HXT sing N N 131 GLU N CA sing N N 132 GLU N H sing N N 133 GLU N H2 sing N N 134 GLU CA C sing N N 135 GLU CA CB sing N N 136 GLU CA HA sing N N 137 GLU C O doub N N 138 GLU C OXT sing N N 139 GLU CB CG sing N N 140 GLU CB HB2 sing N N 141 GLU CB HB3 sing N N 142 GLU CG CD sing N N 143 GLU CG HG2 sing N N 144 GLU CG HG3 sing N N 145 GLU CD OE1 doub N N 146 GLU CD OE2 sing N N 147 GLU OE2 HE2 sing N N 148 GLU OXT HXT sing N N 149 GLY N CA sing N N 150 GLY N H sing N N 151 GLY N H2 sing N N 152 GLY CA C sing N N 153 GLY CA HA2 sing N N 154 GLY CA HA3 sing N N 155 GLY C O doub N N 156 GLY C OXT sing N N 157 GLY OXT HXT sing N N 158 HIS N CA sing N N 159 HIS N H sing N N 160 HIS N H2 sing N N 161 HIS CA C sing N N 162 HIS CA CB sing N N 163 HIS CA HA sing N N 164 HIS C O doub N N 165 HIS C OXT sing N N 166 HIS CB CG sing N N 167 HIS CB HB2 sing N N 168 HIS CB HB3 sing N N 169 HIS CG ND1 sing Y N 170 HIS CG CD2 doub Y N 171 HIS ND1 CE1 doub Y N 172 HIS ND1 HD1 sing N N 173 HIS CD2 NE2 sing Y N 174 HIS CD2 HD2 sing N N 175 HIS CE1 NE2 sing Y N 176 HIS CE1 HE1 sing N N 177 HIS NE2 HE2 sing N N 178 HIS OXT HXT sing N N 179 HOH O H1 sing N N 180 HOH O H2 sing N N 181 ILE N CA sing N N 182 ILE N H sing N N 183 ILE N H2 sing N N 184 ILE CA C sing N N 185 ILE CA CB sing N N 186 ILE CA HA sing N N 187 ILE C O doub N N 188 ILE C OXT sing N N 189 ILE CB CG1 sing N N 190 ILE CB CG2 sing N N 191 ILE CB HB sing N N 192 ILE CG1 CD1 sing N N 193 ILE CG1 HG12 sing N N 194 ILE CG1 HG13 sing N N 195 ILE CG2 HG21 sing N N 196 ILE CG2 HG22 sing N N 197 ILE CG2 HG23 sing N N 198 ILE CD1 HD11 sing N N 199 ILE CD1 HD12 sing N N 200 ILE CD1 HD13 sing N N 201 ILE OXT HXT sing N N 202 LEU N CA sing N N 203 LEU N H sing N N 204 LEU N H2 sing N N 205 LEU CA C sing N N 206 LEU CA CB sing N N 207 LEU CA HA sing N N 208 LEU C O doub N N 209 LEU C OXT sing N N 210 LEU CB CG sing N N 211 LEU CB HB2 sing N N 212 LEU CB HB3 sing N N 213 LEU CG CD1 sing N N 214 LEU CG CD2 sing N N 215 LEU CG HG sing N N 216 LEU CD1 HD11 sing N N 217 LEU CD1 HD12 sing N N 218 LEU CD1 HD13 sing N N 219 LEU CD2 HD21 sing N N 220 LEU CD2 HD22 sing N N 221 LEU CD2 HD23 sing N N 222 LEU OXT HXT sing N N 223 LYS N CA sing N N 224 LYS N H sing N N 225 LYS N H2 sing N N 226 LYS CA C sing N N 227 LYS CA CB sing N N 228 LYS CA HA sing N N 229 LYS C O doub N N 230 LYS C OXT sing N N 231 LYS CB CG sing N N 232 LYS CB HB2 sing N N 233 LYS CB HB3 sing N N 234 LYS CG CD sing N N 235 LYS CG HG2 sing N N 236 LYS CG HG3 sing N N 237 LYS CD CE sing N N 238 LYS CD HD2 sing N N 239 LYS CD HD3 sing N N 240 LYS CE NZ sing N N 241 LYS CE HE2 sing N N 242 LYS CE HE3 sing N N 243 LYS NZ HZ1 sing N N 244 LYS NZ HZ2 sing N N 245 LYS NZ HZ3 sing N N 246 LYS OXT HXT sing N N 247 PHE N CA sing N N 248 PHE N H sing N N 249 PHE N H2 sing N N 250 PHE CA C sing N N 251 PHE CA CB sing N N 252 PHE CA HA sing N N 253 PHE C O doub N N 254 PHE C OXT sing N N 255 PHE CB CG sing N N 256 PHE CB HB2 sing N N 257 PHE CB HB3 sing N N 258 PHE CG CD1 doub Y N 259 PHE CG CD2 sing Y N 260 PHE CD1 CE1 sing Y N 261 PHE CD1 HD1 sing N N 262 PHE CD2 CE2 doub Y N 263 PHE CD2 HD2 sing N N 264 PHE CE1 CZ doub Y N 265 PHE CE1 HE1 sing N N 266 PHE CE2 CZ sing Y N 267 PHE CE2 HE2 sing N N 268 PHE CZ HZ sing N N 269 PHE OXT HXT sing N N 270 PRO N CA sing N N 271 PRO N CD sing N N 272 PRO N H sing N N 273 PRO CA C sing N N 274 PRO CA CB sing N N 275 PRO CA HA sing N N 276 PRO C O doub N N 277 PRO C OXT sing N N 278 PRO CB CG sing N N 279 PRO CB HB2 sing N N 280 PRO CB HB3 sing N N 281 PRO CG CD sing N N 282 PRO CG HG2 sing N N 283 PRO CG HG3 sing N N 284 PRO CD HD2 sing N N 285 PRO CD HD3 sing N N 286 PRO OXT HXT sing N N 287 SER N CA sing N N 288 SER N H sing N N 289 SER N H2 sing N N 290 SER CA C sing N N 291 SER CA CB sing N N 292 SER CA HA sing N N 293 SER C O doub N N 294 SER C OXT sing N N 295 SER CB OG sing N N 296 SER CB HB2 sing N N 297 SER CB HB3 sing N N 298 SER OG HG sing N N 299 SER OXT HXT sing N N 300 THR N CA sing N N 301 THR N H sing N N 302 THR N H2 sing N N 303 THR CA C sing N N 304 THR CA CB sing N N 305 THR CA HA sing N N 306 THR C O doub N N 307 THR C OXT sing N N 308 THR CB OG1 sing N N 309 THR CB CG2 sing N N 310 THR CB HB sing N N 311 THR OG1 HG1 sing N N 312 THR CG2 HG21 sing N N 313 THR CG2 HG22 sing N N 314 THR CG2 HG23 sing N N 315 THR OXT HXT sing N N 316 TRP N CA sing N N 317 TRP N H sing N N 318 TRP N H2 sing N N 319 TRP CA C sing N N 320 TRP CA CB sing N N 321 TRP CA HA sing N N 322 TRP C O doub N N 323 TRP C OXT sing N N 324 TRP CB CG sing N N 325 TRP CB HB2 sing N N 326 TRP CB HB3 sing N N 327 TRP CG CD1 doub Y N 328 TRP CG CD2 sing Y N 329 TRP CD1 NE1 sing Y N 330 TRP CD1 HD1 sing N N 331 TRP CD2 CE2 doub Y N 332 TRP CD2 CE3 sing Y N 333 TRP NE1 CE2 sing Y N 334 TRP NE1 HE1 sing N N 335 TRP CE2 CZ2 sing Y N 336 TRP CE3 CZ3 doub Y N 337 TRP CE3 HE3 sing N N 338 TRP CZ2 CH2 doub Y N 339 TRP CZ2 HZ2 sing N N 340 TRP CZ3 CH2 sing Y N 341 TRP CZ3 HZ3 sing N N 342 TRP CH2 HH2 sing N N 343 TRP OXT HXT sing N N 344 TYR N CA sing N N 345 TYR N H sing N N 346 TYR N H2 sing N N 347 TYR CA C sing N N 348 TYR CA CB sing N N 349 TYR CA HA sing N N 350 TYR C O doub N N 351 TYR C OXT sing N N 352 TYR CB CG sing N N 353 TYR CB HB2 sing N N 354 TYR CB HB3 sing N N 355 TYR CG CD1 doub Y N 356 TYR CG CD2 sing Y N 357 TYR CD1 CE1 sing Y N 358 TYR CD1 HD1 sing N N 359 TYR CD2 CE2 doub Y N 360 TYR CD2 HD2 sing N N 361 TYR CE1 CZ doub Y N 362 TYR CE1 HE1 sing N N 363 TYR CE2 CZ sing Y N 364 TYR CE2 HE2 sing N N 365 TYR CZ OH sing N N 366 TYR OH HH sing N N 367 TYR OXT HXT sing N N 368 VAL N CA sing N N 369 VAL N H sing N N 370 VAL N H2 sing N N 371 VAL CA C sing N N 372 VAL CA CB sing N N 373 VAL CA HA sing N N 374 VAL C O doub N N 375 VAL C OXT sing N N 376 VAL CB CG1 sing N N 377 VAL CB CG2 sing N N 378 VAL CB HB sing N N 379 VAL CG1 HG11 sing N N 380 VAL CG1 HG12 sing N N 381 VAL CG1 HG13 sing N N 382 VAL CG2 HG21 sing N N 383 VAL CG2 HG22 sing N N 384 VAL CG2 HG23 sing N N 385 VAL OXT HXT sing N N 386 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Science Foundation (NSF, China)' China 81874291 1 'National Science Foundation (NSF, China)' China 81502989 2 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id FZX _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id FZX _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 '1-(phenylmethyl)imidazole-2-carboxylic acid' FZX 4 'FORMIC ACID' FMT 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6JN6 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #