data_7CQF # _entry.id 7CQF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7CQF pdb_00007cqf 10.2210/pdb7cqf/pdb WWPDB D_1300018011 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7CQF _pdbx_database_status.recvd_initial_deposition_date 2020-08-10 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Yamagata, A.' 1 ? 'Fukai, S.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 118 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'LGI1-ADAM22-MAGUK configures transsynaptic nanoalignment for synaptic transmission and epilepsy prevention.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.2022580118 _citation.pdbx_database_id_PubMed 33397806 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Fukata, Y.' 1 ? primary 'Chen, X.' 2 ? primary 'Chiken, S.' 3 ? primary 'Hirano, Y.' 4 ? primary 'Yamagata, A.' 5 ? primary 'Inahashi, H.' 6 ? primary 'Sanbo, M.' 7 ? primary 'Sano, H.' 8 ? primary 'Goto, T.' 9 ? primary 'Hirabayashi, M.' 10 ? primary 'Kornau, H.C.' 11 ? primary 'Pruss, H.' 12 ? primary 'Nambu, A.' 13 ? primary 'Fukai, S.' 14 ? primary 'Nicoll, R.A.' 15 ? primary 'Fukata, M.' 16 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 7CQF _cell.details ? _cell.formula_units_Z ? _cell.length_a 63.961 _cell.length_a_esd ? _cell.length_b 63.961 _cell.length_b_esd ? _cell.length_c 48.795 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7CQF _symmetry.cell_setting ? _symmetry.Int_Tables_number 169 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 61' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Disks large homolog 4,Disintegrin and metalloproteinase domain-containing protein 22' 16446.395 1 ? ? ? 'Fusion protein of PSD-95 PDZ3, linker, and ADAM22 C-terminal peptide' 2 non-polymer man 'CHLORIDE ION' 35.453 1 ? ? ? ? 3 non-polymer syn 'CHOLINE ION' 104.171 1 ? ? ? ? 4 non-polymer syn 1,2-ETHANEDIOL 62.068 4 ? ? ? ? 5 water nat water 18.015 46 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Postsynaptic density protein 95,PSD-95,Synapse-associated protein 90,SAP90,ADAM 22,Metalloproteinase-disintegrin ADAM22-3,Metalloproteinase-like,disintegrin-like,and cysteine-rich protein 2 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MNHKVHHHHHHIEGRHNREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNAS HEQAAIALKNAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNSSLGSGTASGSSGKKVNRQSARLWETSI ; _entity_poly.pdbx_seq_one_letter_code_can ;MNHKVHHHHHHIEGRHNREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNAS HEQAAIALKNAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNSSLGSGTASGSSGKKVNRQSARLWETSI ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASN n 1 3 HIS n 1 4 LYS n 1 5 VAL n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 HIS n 1 12 ILE n 1 13 GLU n 1 14 GLY n 1 15 ARG n 1 16 HIS n 1 17 ASN n 1 18 ARG n 1 19 GLU n 1 20 PRO n 1 21 ARG n 1 22 ARG n 1 23 ILE n 1 24 VAL n 1 25 ILE n 1 26 HIS n 1 27 ARG n 1 28 GLY n 1 29 SER n 1 30 THR n 1 31 GLY n 1 32 LEU n 1 33 GLY n 1 34 PHE n 1 35 ASN n 1 36 ILE n 1 37 VAL n 1 38 GLY n 1 39 GLY n 1 40 GLU n 1 41 ASP n 1 42 GLY n 1 43 GLU n 1 44 GLY n 1 45 ILE n 1 46 PHE n 1 47 ILE n 1 48 SER n 1 49 PHE n 1 50 ILE n 1 51 LEU n 1 52 ALA n 1 53 GLY n 1 54 GLY n 1 55 PRO n 1 56 ALA n 1 57 ASP n 1 58 LEU n 1 59 SER n 1 60 GLY n 1 61 GLU n 1 62 LEU n 1 63 ARG n 1 64 LYS n 1 65 GLY n 1 66 ASP n 1 67 GLN n 1 68 ILE n 1 69 LEU n 1 70 SER n 1 71 VAL n 1 72 ASN n 1 73 GLY n 1 74 VAL n 1 75 ASP n 1 76 LEU n 1 77 ARG n 1 78 ASN n 1 79 ALA n 1 80 SER n 1 81 HIS n 1 82 GLU n 1 83 GLN n 1 84 ALA n 1 85 ALA n 1 86 ILE n 1 87 ALA n 1 88 LEU n 1 89 LYS n 1 90 ASN n 1 91 ALA n 1 92 GLY n 1 93 GLN n 1 94 THR n 1 95 VAL n 1 96 THR n 1 97 ILE n 1 98 ILE n 1 99 ALA n 1 100 GLN n 1 101 TYR n 1 102 LYS n 1 103 PRO n 1 104 GLU n 1 105 GLU n 1 106 TYR n 1 107 SER n 1 108 ARG n 1 109 PHE n 1 110 GLU n 1 111 ALA n 1 112 LYS n 1 113 ILE n 1 114 HIS n 1 115 ASP n 1 116 LEU n 1 117 ARG n 1 118 GLU n 1 119 GLN n 1 120 LEU n 1 121 MET n 1 122 ASN n 1 123 SER n 1 124 SER n 1 125 LEU n 1 126 GLY n 1 127 SER n 1 128 GLY n 1 129 THR n 1 130 ALA n 1 131 SER n 1 132 GLY n 1 133 SER n 1 134 SER n 1 135 GLY n 1 136 LYS n 1 137 LYS n 1 138 VAL n 1 139 ASN n 1 140 ARG n 1 141 GLN n 1 142 SER n 1 143 ALA n 1 144 ARG n 1 145 LEU n 1 146 TRP n 1 147 GLU n 1 148 THR n 1 149 SER n 1 150 ILE n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 131 Rat ? 'Dlg4, Dlgh4, Psd95' ? ? ? ? ? ? 'Rattus norvegicus' 10116 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 2 sample 'Biological sequence' 132 150 Human ? 'ADAM22, MDC2' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP DLG4_RAT P31016 ? 1 ;REPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTI IAQYKPEEYSRFEAKIHDLREQLMNSSLGSGTAS ; 309 2 UNP ADA22_HUMAN Q9P0K1 ? 1 KKVNRQSARLWETSI 892 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7CQF A 18 ? 131 ? P31016 309 ? 422 ? 309 422 2 2 7CQF A 136 ? 150 ? Q9P0K1 892 ? 906 ? 427 441 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7CQF MET A 1 ? UNP P31016 ? ? 'initiating methionine' 292 1 1 7CQF ASN A 2 ? UNP P31016 ? ? 'expression tag' 293 2 1 7CQF HIS A 3 ? UNP P31016 ? ? 'expression tag' 294 3 1 7CQF LYS A 4 ? UNP P31016 ? ? 'expression tag' 295 4 1 7CQF VAL A 5 ? UNP P31016 ? ? 'expression tag' 296 5 1 7CQF HIS A 6 ? UNP P31016 ? ? 'expression tag' 297 6 1 7CQF HIS A 7 ? UNP P31016 ? ? 'expression tag' 298 7 1 7CQF HIS A 8 ? UNP P31016 ? ? 'expression tag' 299 8 1 7CQF HIS A 9 ? UNP P31016 ? ? 'expression tag' 300 9 1 7CQF HIS A 10 ? UNP P31016 ? ? 'expression tag' 301 10 1 7CQF HIS A 11 ? UNP P31016 ? ? 'expression tag' 302 11 1 7CQF ILE A 12 ? UNP P31016 ? ? 'expression tag' 303 12 1 7CQF GLU A 13 ? UNP P31016 ? ? 'expression tag' 304 13 1 7CQF GLY A 14 ? UNP P31016 ? ? 'expression tag' 305 14 1 7CQF ARG A 15 ? UNP P31016 ? ? 'expression tag' 306 15 1 7CQF HIS A 16 ? UNP P31016 ? ? 'expression tag' 307 16 1 7CQF ASN A 17 ? UNP P31016 ? ? 'expression tag' 308 17 1 7CQF GLY A 132 ? UNP P31016 ? ? linker 423 18 1 7CQF SER A 133 ? UNP P31016 ? ? linker 424 19 1 7CQF SER A 134 ? UNP P31016 ? ? linker 425 20 1 7CQF GLY A 135 ? UNP P31016 ? ? linker 426 21 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CHT non-polymer . 'CHOLINE ION' ? 'C5 H14 N O 1' 104.171 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7CQF _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.75 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 29.79 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M choline chloride, 0.1 M Tris-HCl (pH 7.5), 14 % (w/v) PEG 2000 MME' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-04-17 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SPRING-8 BEAMLINE BL41XU' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL41XU _diffrn_source.pdbx_synchrotron_site SPring-8 # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7CQF _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.80 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10624 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 16.1 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.130 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 26.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.134 _reflns.pdbx_Rpim_I_all 0.031 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.80 _reflns_shell.d_res_low 1.83 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 532 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value 0.745 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.791 _reflns_shell.pdbx_Rpim_I_all 0.262 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.944 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 0.54 _refine.aniso_B[1][2] 0.27 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 0.54 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] -1.76 _refine.B_iso_max ? _refine.B_iso_mean 31.530 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.966 _refine.correlation_coeff_Fo_to_Fc_free 0.941 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7CQF _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.80 _refine.ls_d_res_low 36.64 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10052 _refine.ls_number_reflns_R_free 548 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.99 _refine.ls_percent_reflns_R_free 5.2 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.16893 _refine.ls_R_factor_R_free 0.20513 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.16684 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1TP3 _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.120 _refine.pdbx_overall_ESU_R_Free 0.116 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 2.781 _refine.overall_SU_ML 0.084 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.details ? _refine_hist.d_res_high 1.80 _refine_hist.d_res_low 36.64 _refine_hist.number_atoms_solvent 46 _refine_hist.number_atoms_total 947 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 877 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 24 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 0.013 915 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 876 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.660 1.652 1225 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.413 1.599 2018 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.080 5.000 113 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 27.697 21.296 54 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 15.046 15.000 155 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 17.496 15.000 9 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.073 0.200 118 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.009 0.020 1034 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 197 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 2.521 2.962 455 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 2.511 2.961 454 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 3.548 4.408 567 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 3.549 4.408 568 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 4.080 3.691 460 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 4.076 3.695 461 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 6.361 5.302 659 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 8.071 35.265 951 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 8.071 35.248 951 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.802 _refine_ls_shell.d_res_low 1.848 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 37 _refine_ls_shell.number_reflns_R_work 728 _refine_ls_shell.percent_reflns_obs 100.00 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.287 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.264 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7CQF _struct.title 'Crystal structure of PSD-95 PDZ3 fused with ADAM22 C-terminal peptide' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7CQF _struct_keywords.text 'Scaffold protein, Membrane receptor, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 4 ? G N N 4 ? H N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 54 ? GLY A 60 ? GLY A 345 GLY A 351 1 ? 7 HELX_P HELX_P2 AA2 SER A 80 ? ASN A 90 ? SER A 371 ASN A 381 1 ? 11 HELX_P HELX_P3 AA3 LYS A 102 ? LEU A 120 ? LYS A 393 LEU A 411 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 21 ? HIS A 26 ? ARG A 312 HIS A 317 AA1 2 THR A 94 ? TYR A 101 ? THR A 385 TYR A 392 AA1 3 ASP A 66 ? VAL A 71 ? ASP A 357 VAL A 362 AA1 4 VAL A 74 ? ASP A 75 ? VAL A 365 ASP A 366 AA2 1 ILE A 45 ? ILE A 50 ? ILE A 336 ILE A 341 AA2 2 PHE A 34 ? GLY A 38 ? PHE A 325 GLY A 329 AA2 3 THR A 148 ? SER A 149 ? THR A 439 SER A 440 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 23 ? N ILE A 314 O ILE A 97 ? O ILE A 388 AA1 2 3 O GLN A 100 ? O GLN A 391 N GLN A 67 ? N GLN A 358 AA1 3 4 N VAL A 71 ? N VAL A 362 O VAL A 74 ? O VAL A 365 AA2 1 2 O PHE A 46 ? O PHE A 337 N VAL A 37 ? N VAL A 328 AA2 2 3 N ILE A 36 ? N ILE A 327 O THR A 148 ? O THR A 439 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CL 601 ? 4 'binding site for residue CL A 601' AC2 Software A CHT 602 ? 8 'binding site for residue CHT A 602' AC3 Software A EDO 603 ? 4 'binding site for residue EDO A 603' AC4 Software A EDO 604 ? 6 'binding site for residue EDO A 604' AC5 Software A EDO 605 ? 9 'binding site for residue EDO A 605' AC6 Software A EDO 606 ? 6 'binding site for residue EDO A 606' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 ARG A 22 ? ARG A 313 . ? 1_555 ? 2 AC1 4 GLY A 39 ? GLY A 330 . ? 4_445 ? 3 AC1 4 HIS A 81 ? HIS A 372 . ? 4_445 ? 4 AC1 4 EDO F . ? EDO A 605 . ? 4_445 ? 5 AC2 8 ASP A 57 ? ASP A 348 . ? 3_444 ? 6 AC2 8 LEU A 58 ? LEU A 349 . ? 3_444 ? 7 AC2 8 GLY A 60 ? GLY A 351 . ? 3_444 ? 8 AC2 8 ARG A 77 ? ARG A 368 . ? 4_444 ? 9 AC2 8 TRP A 146 ? TRP A 437 . ? 1_555 ? 10 AC2 8 GLU A 147 ? GLU A 438 . ? 1_555 ? 11 AC2 8 THR A 148 ? THR A 439 . ? 1_555 ? 12 AC2 8 HOH H . ? HOH A 743 . ? 1_555 ? 13 AC3 4 ASN A 72 ? ASN A 363 . ? 4_444 ? 14 AC3 4 ALA A 87 ? ALA A 378 . ? 4_444 ? 15 AC3 4 ASN A 90 ? ASN A 381 . ? 4_444 ? 16 AC3 4 ALA A 91 ? ALA A 382 . ? 4_444 ? 17 AC4 6 GLU A 43 ? GLU A 334 . ? 1_555 ? 18 AC4 6 PHE A 46 ? PHE A 337 . ? 1_555 ? 19 AC4 6 GLU A 105 ? GLU A 396 . ? 1_555 ? 20 AC4 6 ARG A 108 ? ARG A 399 . ? 1_555 ? 21 AC4 6 EDO G . ? EDO A 606 . ? 1_555 ? 22 AC4 6 HOH H . ? HOH A 721 . ? 1_555 ? 23 AC5 9 GLY A 38 ? GLY A 329 . ? 1_555 ? 24 AC5 9 GLY A 73 ? GLY A 364 . ? 4_444 ? 25 AC5 9 HIS A 81 ? HIS A 372 . ? 1_555 ? 26 AC5 9 THR A 96 ? THR A 387 . ? 4_444 ? 27 AC5 9 TRP A 146 ? TRP A 437 . ? 1_555 ? 28 AC5 9 CL B . ? CL A 601 . ? 4_444 ? 29 AC5 9 HOH H . ? HOH A 704 . ? 1_555 ? 30 AC5 9 HOH H . ? HOH A 706 . ? 1_555 ? 31 AC5 9 HOH H . ? HOH A 710 . ? 1_555 ? 32 AC6 6 GLY A 42 ? GLY A 333 . ? 1_555 ? 33 AC6 6 GLN A 67 ? GLN A 358 . ? 1_555 ? 34 AC6 6 LYS A 102 ? LYS A 393 . ? 1_555 ? 35 AC6 6 GLU A 105 ? GLU A 396 . ? 1_555 ? 36 AC6 6 EDO E . ? EDO A 604 . ? 1_555 ? 37 AC6 6 HOH H . ? HOH A 717 . ? 1_555 ? # _atom_sites.entry_id 7CQF _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.015635 _atom_sites.fract_transf_matrix[1][2] 0.009027 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018053 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.020494 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CL N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 292 ? ? ? A . n A 1 2 ASN 2 293 ? ? ? A . n A 1 3 HIS 3 294 ? ? ? A . n A 1 4 LYS 4 295 ? ? ? A . n A 1 5 VAL 5 296 ? ? ? A . n A 1 6 HIS 6 297 ? ? ? A . n A 1 7 HIS 7 298 ? ? ? A . n A 1 8 HIS 8 299 ? ? ? A . n A 1 9 HIS 9 300 ? ? ? A . n A 1 10 HIS 10 301 ? ? ? A . n A 1 11 HIS 11 302 ? ? ? A . n A 1 12 ILE 12 303 ? ? ? A . n A 1 13 GLU 13 304 ? ? ? A . n A 1 14 GLY 14 305 ? ? ? A . n A 1 15 ARG 15 306 ? ? ? A . n A 1 16 HIS 16 307 307 HIS HIS A . n A 1 17 ASN 17 308 308 ASN ASN A . n A 1 18 ARG 18 309 309 ARG ARG A . n A 1 19 GLU 19 310 310 GLU GLU A . n A 1 20 PRO 20 311 311 PRO PRO A . n A 1 21 ARG 21 312 312 ARG ARG A . n A 1 22 ARG 22 313 313 ARG ARG A . n A 1 23 ILE 23 314 314 ILE ILE A . n A 1 24 VAL 24 315 315 VAL VAL A . n A 1 25 ILE 25 316 316 ILE ILE A . n A 1 26 HIS 26 317 317 HIS HIS A . n A 1 27 ARG 27 318 318 ARG ARG A . n A 1 28 GLY 28 319 319 GLY GLY A . n A 1 29 SER 29 320 320 SER SER A . n A 1 30 THR 30 321 321 THR THR A . n A 1 31 GLY 31 322 322 GLY GLY A . n A 1 32 LEU 32 323 323 LEU LEU A . n A 1 33 GLY 33 324 324 GLY GLY A . n A 1 34 PHE 34 325 325 PHE PHE A . n A 1 35 ASN 35 326 326 ASN ASN A . n A 1 36 ILE 36 327 327 ILE ILE A . n A 1 37 VAL 37 328 328 VAL VAL A . n A 1 38 GLY 38 329 329 GLY GLY A . n A 1 39 GLY 39 330 330 GLY GLY A . n A 1 40 GLU 40 331 331 GLU GLU A . n A 1 41 ASP 41 332 332 ASP ASP A . n A 1 42 GLY 42 333 333 GLY GLY A . n A 1 43 GLU 43 334 334 GLU GLU A . n A 1 44 GLY 44 335 335 GLY GLY A . n A 1 45 ILE 45 336 336 ILE ILE A . n A 1 46 PHE 46 337 337 PHE PHE A . n A 1 47 ILE 47 338 338 ILE ILE A . n A 1 48 SER 48 339 339 SER SER A . n A 1 49 PHE 49 340 340 PHE PHE A . n A 1 50 ILE 50 341 341 ILE ILE A . n A 1 51 LEU 51 342 342 LEU LEU A . n A 1 52 ALA 52 343 343 ALA ALA A . n A 1 53 GLY 53 344 344 GLY GLY A . n A 1 54 GLY 54 345 345 GLY GLY A . n A 1 55 PRO 55 346 346 PRO PRO A . n A 1 56 ALA 56 347 347 ALA ALA A . n A 1 57 ASP 57 348 348 ASP ASP A . n A 1 58 LEU 58 349 349 LEU LEU A . n A 1 59 SER 59 350 350 SER SER A . n A 1 60 GLY 60 351 351 GLY GLY A . n A 1 61 GLU 61 352 352 GLU GLU A . n A 1 62 LEU 62 353 353 LEU LEU A . n A 1 63 ARG 63 354 354 ARG ARG A . n A 1 64 LYS 64 355 355 LYS LYS A . n A 1 65 GLY 65 356 356 GLY GLY A . n A 1 66 ASP 66 357 357 ASP ASP A . n A 1 67 GLN 67 358 358 GLN GLN A . n A 1 68 ILE 68 359 359 ILE ILE A . n A 1 69 LEU 69 360 360 LEU LEU A . n A 1 70 SER 70 361 361 SER SER A . n A 1 71 VAL 71 362 362 VAL VAL A . n A 1 72 ASN 72 363 363 ASN ASN A . n A 1 73 GLY 73 364 364 GLY GLY A . n A 1 74 VAL 74 365 365 VAL VAL A . n A 1 75 ASP 75 366 366 ASP ASP A . n A 1 76 LEU 76 367 367 LEU LEU A . n A 1 77 ARG 77 368 368 ARG ARG A . n A 1 78 ASN 78 369 369 ASN ASN A . n A 1 79 ALA 79 370 370 ALA ALA A . n A 1 80 SER 80 371 371 SER SER A . n A 1 81 HIS 81 372 372 HIS HIS A . n A 1 82 GLU 82 373 373 GLU GLU A . n A 1 83 GLN 83 374 374 GLN GLN A . n A 1 84 ALA 84 375 375 ALA ALA A . n A 1 85 ALA 85 376 376 ALA ALA A . n A 1 86 ILE 86 377 377 ILE ILE A . n A 1 87 ALA 87 378 378 ALA ALA A . n A 1 88 LEU 88 379 379 LEU LEU A . n A 1 89 LYS 89 380 380 LYS LYS A . n A 1 90 ASN 90 381 381 ASN ASN A . n A 1 91 ALA 91 382 382 ALA ALA A . n A 1 92 GLY 92 383 383 GLY GLY A . n A 1 93 GLN 93 384 384 GLN GLN A . n A 1 94 THR 94 385 385 THR THR A . n A 1 95 VAL 95 386 386 VAL VAL A . n A 1 96 THR 96 387 387 THR THR A . n A 1 97 ILE 97 388 388 ILE ILE A . n A 1 98 ILE 98 389 389 ILE ILE A . n A 1 99 ALA 99 390 390 ALA ALA A . n A 1 100 GLN 100 391 391 GLN GLN A . n A 1 101 TYR 101 392 392 TYR TYR A . n A 1 102 LYS 102 393 393 LYS LYS A . n A 1 103 PRO 103 394 394 PRO PRO A . n A 1 104 GLU 104 395 395 GLU GLU A . n A 1 105 GLU 105 396 396 GLU GLU A . n A 1 106 TYR 106 397 397 TYR TYR A . n A 1 107 SER 107 398 398 SER SER A . n A 1 108 ARG 108 399 399 ARG ARG A . n A 1 109 PHE 109 400 400 PHE PHE A . n A 1 110 GLU 110 401 401 GLU GLU A . n A 1 111 ALA 111 402 402 ALA ALA A . n A 1 112 LYS 112 403 403 LYS LYS A . n A 1 113 ILE 113 404 404 ILE ILE A . n A 1 114 HIS 114 405 405 HIS HIS A . n A 1 115 ASP 115 406 406 ASP ASP A . n A 1 116 LEU 116 407 407 LEU LEU A . n A 1 117 ARG 117 408 408 ARG ARG A . n A 1 118 GLU 118 409 409 GLU GLU A . n A 1 119 GLN 119 410 410 GLN GLN A . n A 1 120 LEU 120 411 411 LEU LEU A . n A 1 121 MET 121 412 ? ? ? A . n A 1 122 ASN 122 413 ? ? ? A . n A 1 123 SER 123 414 ? ? ? A . n A 1 124 SER 124 415 ? ? ? A . n A 1 125 LEU 125 416 ? ? ? A . n A 1 126 GLY 126 417 ? ? ? A . n A 1 127 SER 127 418 ? ? ? A . n A 1 128 GLY 128 419 ? ? ? A . n A 1 129 THR 129 420 ? ? ? A . n A 1 130 ALA 130 421 ? ? ? A . n A 1 131 SER 131 422 ? ? ? A . n A 1 132 GLY 132 423 ? ? ? A . n A 1 133 SER 133 424 ? ? ? A . n A 1 134 SER 134 425 ? ? ? A . n A 1 135 GLY 135 426 ? ? ? A . n A 1 136 LYS 136 427 ? ? ? A . n A 1 137 LYS 137 428 ? ? ? A . n A 1 138 VAL 138 429 ? ? ? A . n A 1 139 ASN 139 430 ? ? ? A . n A 1 140 ARG 140 431 ? ? ? A . n A 1 141 GLN 141 432 ? ? ? A . n A 1 142 SER 142 433 ? ? ? A . n A 1 143 ALA 143 434 434 ALA ALA A . n A 1 144 ARG 144 435 435 ARG ARG A . n A 1 145 LEU 145 436 436 LEU LEU A . n A 1 146 TRP 146 437 437 TRP TRP A . n A 1 147 GLU 147 438 438 GLU GLU A . n A 1 148 THR 148 439 439 THR THR A . n A 1 149 SER 149 440 440 SER SER A . n A 1 150 ILE 150 441 441 ILE ILE A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CL 1 601 601 CL CL A . C 3 CHT 1 602 1 CHT CHT A . D 4 EDO 1 603 1 EDO EDO A . E 4 EDO 1 604 2 EDO EDO A . F 4 EDO 1 605 3 EDO EDO A . G 4 EDO 1 606 4 EDO EDO A . H 5 HOH 1 701 95 HOH HOH A . H 5 HOH 2 702 28 HOH HOH A . H 5 HOH 3 703 68 HOH HOH A . H 5 HOH 4 704 99 HOH HOH A . H 5 HOH 5 705 41 HOH HOH A . H 5 HOH 6 706 5 HOH HOH A . H 5 HOH 7 707 44 HOH HOH A . H 5 HOH 8 708 22 HOH HOH A . H 5 HOH 9 709 6 HOH HOH A . H 5 HOH 10 710 14 HOH HOH A . H 5 HOH 11 711 36 HOH HOH A . H 5 HOH 12 712 1 HOH HOH A . H 5 HOH 13 713 3 HOH HOH A . H 5 HOH 14 714 20 HOH HOH A . H 5 HOH 15 715 34 HOH HOH A . H 5 HOH 16 716 16 HOH HOH A . H 5 HOH 17 717 31 HOH HOH A . H 5 HOH 18 718 45 HOH HOH A . H 5 HOH 19 719 46 HOH HOH A . H 5 HOH 20 720 13 HOH HOH A . H 5 HOH 21 721 101 HOH HOH A . H 5 HOH 22 722 4 HOH HOH A . H 5 HOH 23 723 32 HOH HOH A . H 5 HOH 24 724 51 HOH HOH A . H 5 HOH 25 725 25 HOH HOH A . H 5 HOH 26 726 78 HOH HOH A . H 5 HOH 27 727 17 HOH HOH A . H 5 HOH 28 728 48 HOH HOH A . H 5 HOH 29 729 39 HOH HOH A . H 5 HOH 30 730 8 HOH HOH A . H 5 HOH 31 731 12 HOH HOH A . H 5 HOH 32 732 21 HOH HOH A . H 5 HOH 33 733 15 HOH HOH A . H 5 HOH 34 734 42 HOH HOH A . H 5 HOH 35 735 24 HOH HOH A . H 5 HOH 36 736 26 HOH HOH A . H 5 HOH 37 737 18 HOH HOH A . H 5 HOH 38 738 35 HOH HOH A . H 5 HOH 39 739 37 HOH HOH A . H 5 HOH 40 740 102 HOH HOH A . H 5 HOH 41 741 7 HOH HOH A . H 5 HOH 42 742 19 HOH HOH A . H 5 HOH 43 743 57 HOH HOH A . H 5 HOH 44 744 100 HOH HOH A . H 5 HOH 45 745 59 HOH HOH A . H 5 HOH 46 746 60 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1000 ? 1 MORE 9 ? 1 'SSA (A^2)' 6620 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-01-06 2 'Structure model' 1 1 2021-01-20 3 'Structure model' 1 2 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.journal_id_CSD' 3 2 'Structure model' '_citation.journal_volume' 4 2 'Structure model' '_citation.pdbx_database_id_PubMed' 5 2 'Structure model' '_citation.title' 6 2 'Structure model' '_citation.year' 7 3 'Structure model' '_database_2.pdbx_DOI' 8 3 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0258 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _pdbx_entry_details.entry_id 7CQF _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OG _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 SER _pdbx_validate_close_contact.auth_seq_id_1 350 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 701 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.14 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id SER _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 320 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -100.42 _pdbx_validate_torsion.psi 45.05 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 292 ? A MET 1 2 1 Y 1 A ASN 293 ? A ASN 2 3 1 Y 1 A HIS 294 ? A HIS 3 4 1 Y 1 A LYS 295 ? A LYS 4 5 1 Y 1 A VAL 296 ? A VAL 5 6 1 Y 1 A HIS 297 ? A HIS 6 7 1 Y 1 A HIS 298 ? A HIS 7 8 1 Y 1 A HIS 299 ? A HIS 8 9 1 Y 1 A HIS 300 ? A HIS 9 10 1 Y 1 A HIS 301 ? A HIS 10 11 1 Y 1 A HIS 302 ? A HIS 11 12 1 Y 1 A ILE 303 ? A ILE 12 13 1 Y 1 A GLU 304 ? A GLU 13 14 1 Y 1 A GLY 305 ? A GLY 14 15 1 Y 1 A ARG 306 ? A ARG 15 16 1 Y 1 A MET 412 ? A MET 121 17 1 Y 1 A ASN 413 ? A ASN 122 18 1 Y 1 A SER 414 ? A SER 123 19 1 Y 1 A SER 415 ? A SER 124 20 1 Y 1 A LEU 416 ? A LEU 125 21 1 Y 1 A GLY 417 ? A GLY 126 22 1 Y 1 A SER 418 ? A SER 127 23 1 Y 1 A GLY 419 ? A GLY 128 24 1 Y 1 A THR 420 ? A THR 129 25 1 Y 1 A ALA 421 ? A ALA 130 26 1 Y 1 A SER 422 ? A SER 131 27 1 Y 1 A GLY 423 ? A GLY 132 28 1 Y 1 A SER 424 ? A SER 133 29 1 Y 1 A SER 425 ? A SER 134 30 1 Y 1 A GLY 426 ? A GLY 135 31 1 Y 1 A LYS 427 ? A LYS 136 32 1 Y 1 A LYS 428 ? A LYS 137 33 1 Y 1 A VAL 429 ? A VAL 138 34 1 Y 1 A ASN 430 ? A ASN 139 35 1 Y 1 A ARG 431 ? A ARG 140 36 1 Y 1 A GLN 432 ? A GLN 141 37 1 Y 1 A SER 433 ? A SER 142 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CHT C4 C N N 74 CHT C5 C N N 75 CHT C6 C N N 76 CHT C7 C N N 77 CHT C8 C N N 78 CHT O6 O N N 79 CHT N1 N N N 80 CHT HC41 H N N 81 CHT HC42 H N N 82 CHT HC51 H N N 83 CHT HC52 H N N 84 CHT H61 H N N 85 CHT H62 H N N 86 CHT H63 H N N 87 CHT H71 H N N 88 CHT H72 H N N 89 CHT H73 H N N 90 CHT H81 H N N 91 CHT H82 H N N 92 CHT H83 H N N 93 CHT HO6 H N N 94 CL CL CL N N 95 EDO C1 C N N 96 EDO O1 O N N 97 EDO C2 C N N 98 EDO O2 O N N 99 EDO H11 H N N 100 EDO H12 H N N 101 EDO HO1 H N N 102 EDO H21 H N N 103 EDO H22 H N N 104 EDO HO2 H N N 105 GLN N N N N 106 GLN CA C N S 107 GLN C C N N 108 GLN O O N N 109 GLN CB C N N 110 GLN CG C N N 111 GLN CD C N N 112 GLN OE1 O N N 113 GLN NE2 N N N 114 GLN OXT O N N 115 GLN H H N N 116 GLN H2 H N N 117 GLN HA H N N 118 GLN HB2 H N N 119 GLN HB3 H N N 120 GLN HG2 H N N 121 GLN HG3 H N N 122 GLN HE21 H N N 123 GLN HE22 H N N 124 GLN HXT H N N 125 GLU N N N N 126 GLU CA C N S 127 GLU C C N N 128 GLU O O N N 129 GLU CB C N N 130 GLU CG C N N 131 GLU CD C N N 132 GLU OE1 O N N 133 GLU OE2 O N N 134 GLU OXT O N N 135 GLU H H N N 136 GLU H2 H N N 137 GLU HA H N N 138 GLU HB2 H N N 139 GLU HB3 H N N 140 GLU HG2 H N N 141 GLU HG3 H N N 142 GLU HE2 H N N 143 GLU HXT H N N 144 GLY N N N N 145 GLY CA C N N 146 GLY C C N N 147 GLY O O N N 148 GLY OXT O N N 149 GLY H H N N 150 GLY H2 H N N 151 GLY HA2 H N N 152 GLY HA3 H N N 153 GLY HXT H N N 154 HIS N N N N 155 HIS CA C N S 156 HIS C C N N 157 HIS O O N N 158 HIS CB C N N 159 HIS CG C Y N 160 HIS ND1 N Y N 161 HIS CD2 C Y N 162 HIS CE1 C Y N 163 HIS NE2 N Y N 164 HIS OXT O N N 165 HIS H H N N 166 HIS H2 H N N 167 HIS HA H N N 168 HIS HB2 H N N 169 HIS HB3 H N N 170 HIS HD1 H N N 171 HIS HD2 H N N 172 HIS HE1 H N N 173 HIS HE2 H N N 174 HIS HXT H N N 175 HOH O O N N 176 HOH H1 H N N 177 HOH H2 H N N 178 ILE N N N N 179 ILE CA C N S 180 ILE C C N N 181 ILE O O N N 182 ILE CB C N S 183 ILE CG1 C N N 184 ILE CG2 C N N 185 ILE CD1 C N N 186 ILE OXT O N N 187 ILE H H N N 188 ILE H2 H N N 189 ILE HA H N N 190 ILE HB H N N 191 ILE HG12 H N N 192 ILE HG13 H N N 193 ILE HG21 H N N 194 ILE HG22 H N N 195 ILE HG23 H N N 196 ILE HD11 H N N 197 ILE HD12 H N N 198 ILE HD13 H N N 199 ILE HXT H N N 200 LEU N N N N 201 LEU CA C N S 202 LEU C C N N 203 LEU O O N N 204 LEU CB C N N 205 LEU CG C N N 206 LEU CD1 C N N 207 LEU CD2 C N N 208 LEU OXT O N N 209 LEU H H N N 210 LEU H2 H N N 211 LEU HA H N N 212 LEU HB2 H N N 213 LEU HB3 H N N 214 LEU HG H N N 215 LEU HD11 H N N 216 LEU HD12 H N N 217 LEU HD13 H N N 218 LEU HD21 H N N 219 LEU HD22 H N N 220 LEU HD23 H N N 221 LEU HXT H N N 222 LYS N N N N 223 LYS CA C N S 224 LYS C C N N 225 LYS O O N N 226 LYS CB C N N 227 LYS CG C N N 228 LYS CD C N N 229 LYS CE C N N 230 LYS NZ N N N 231 LYS OXT O N N 232 LYS H H N N 233 LYS H2 H N N 234 LYS HA H N N 235 LYS HB2 H N N 236 LYS HB3 H N N 237 LYS HG2 H N N 238 LYS HG3 H N N 239 LYS HD2 H N N 240 LYS HD3 H N N 241 LYS HE2 H N N 242 LYS HE3 H N N 243 LYS HZ1 H N N 244 LYS HZ2 H N N 245 LYS HZ3 H N N 246 LYS HXT H N N 247 MET N N N N 248 MET CA C N S 249 MET C C N N 250 MET O O N N 251 MET CB C N N 252 MET CG C N N 253 MET SD S N N 254 MET CE C N N 255 MET OXT O N N 256 MET H H N N 257 MET H2 H N N 258 MET HA H N N 259 MET HB2 H N N 260 MET HB3 H N N 261 MET HG2 H N N 262 MET HG3 H N N 263 MET HE1 H N N 264 MET HE2 H N N 265 MET HE3 H N N 266 MET HXT H N N 267 PHE N N N N 268 PHE CA C N S 269 PHE C C N N 270 PHE O O N N 271 PHE CB C N N 272 PHE CG C Y N 273 PHE CD1 C Y N 274 PHE CD2 C Y N 275 PHE CE1 C Y N 276 PHE CE2 C Y N 277 PHE CZ C Y N 278 PHE OXT O N N 279 PHE H H N N 280 PHE H2 H N N 281 PHE HA H N N 282 PHE HB2 H N N 283 PHE HB3 H N N 284 PHE HD1 H N N 285 PHE HD2 H N N 286 PHE HE1 H N N 287 PHE HE2 H N N 288 PHE HZ H N N 289 PHE HXT H N N 290 PRO N N N N 291 PRO CA C N S 292 PRO C C N N 293 PRO O O N N 294 PRO CB C N N 295 PRO CG C N N 296 PRO CD C N N 297 PRO OXT O N N 298 PRO H H N N 299 PRO HA H N N 300 PRO HB2 H N N 301 PRO HB3 H N N 302 PRO HG2 H N N 303 PRO HG3 H N N 304 PRO HD2 H N N 305 PRO HD3 H N N 306 PRO HXT H N N 307 SER N N N N 308 SER CA C N S 309 SER C C N N 310 SER O O N N 311 SER CB C N N 312 SER OG O N N 313 SER OXT O N N 314 SER H H N N 315 SER H2 H N N 316 SER HA H N N 317 SER HB2 H N N 318 SER HB3 H N N 319 SER HG H N N 320 SER HXT H N N 321 THR N N N N 322 THR CA C N S 323 THR C C N N 324 THR O O N N 325 THR CB C N R 326 THR OG1 O N N 327 THR CG2 C N N 328 THR OXT O N N 329 THR H H N N 330 THR H2 H N N 331 THR HA H N N 332 THR HB H N N 333 THR HG1 H N N 334 THR HG21 H N N 335 THR HG22 H N N 336 THR HG23 H N N 337 THR HXT H N N 338 TRP N N N N 339 TRP CA C N S 340 TRP C C N N 341 TRP O O N N 342 TRP CB C N N 343 TRP CG C Y N 344 TRP CD1 C Y N 345 TRP CD2 C Y N 346 TRP NE1 N Y N 347 TRP CE2 C Y N 348 TRP CE3 C Y N 349 TRP CZ2 C Y N 350 TRP CZ3 C Y N 351 TRP CH2 C Y N 352 TRP OXT O N N 353 TRP H H N N 354 TRP H2 H N N 355 TRP HA H N N 356 TRP HB2 H N N 357 TRP HB3 H N N 358 TRP HD1 H N N 359 TRP HE1 H N N 360 TRP HE3 H N N 361 TRP HZ2 H N N 362 TRP HZ3 H N N 363 TRP HH2 H N N 364 TRP HXT H N N 365 TYR N N N N 366 TYR CA C N S 367 TYR C C N N 368 TYR O O N N 369 TYR CB C N N 370 TYR CG C Y N 371 TYR CD1 C Y N 372 TYR CD2 C Y N 373 TYR CE1 C Y N 374 TYR CE2 C Y N 375 TYR CZ C Y N 376 TYR OH O N N 377 TYR OXT O N N 378 TYR H H N N 379 TYR H2 H N N 380 TYR HA H N N 381 TYR HB2 H N N 382 TYR HB3 H N N 383 TYR HD1 H N N 384 TYR HD2 H N N 385 TYR HE1 H N N 386 TYR HE2 H N N 387 TYR HH H N N 388 TYR HXT H N N 389 VAL N N N N 390 VAL CA C N S 391 VAL C C N N 392 VAL O O N N 393 VAL CB C N N 394 VAL CG1 C N N 395 VAL CG2 C N N 396 VAL OXT O N N 397 VAL H H N N 398 VAL H2 H N N 399 VAL HA H N N 400 VAL HB H N N 401 VAL HG11 H N N 402 VAL HG12 H N N 403 VAL HG13 H N N 404 VAL HG21 H N N 405 VAL HG22 H N N 406 VAL HG23 H N N 407 VAL HXT H N N 408 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CHT C4 C5 sing N N 70 CHT C4 O6 sing N N 71 CHT C4 HC41 sing N N 72 CHT C4 HC42 sing N N 73 CHT C5 N1 sing N N 74 CHT C5 HC51 sing N N 75 CHT C5 HC52 sing N N 76 CHT C6 N1 sing N N 77 CHT C6 H61 sing N N 78 CHT C6 H62 sing N N 79 CHT C6 H63 sing N N 80 CHT C7 N1 sing N N 81 CHT C7 H71 sing N N 82 CHT C7 H72 sing N N 83 CHT C7 H73 sing N N 84 CHT C8 N1 sing N N 85 CHT C8 H81 sing N N 86 CHT C8 H82 sing N N 87 CHT C8 H83 sing N N 88 CHT O6 HO6 sing N N 89 EDO C1 O1 sing N N 90 EDO C1 C2 sing N N 91 EDO C1 H11 sing N N 92 EDO C1 H12 sing N N 93 EDO O1 HO1 sing N N 94 EDO C2 O2 sing N N 95 EDO C2 H21 sing N N 96 EDO C2 H22 sing N N 97 EDO O2 HO2 sing N N 98 GLN N CA sing N N 99 GLN N H sing N N 100 GLN N H2 sing N N 101 GLN CA C sing N N 102 GLN CA CB sing N N 103 GLN CA HA sing N N 104 GLN C O doub N N 105 GLN C OXT sing N N 106 GLN CB CG sing N N 107 GLN CB HB2 sing N N 108 GLN CB HB3 sing N N 109 GLN CG CD sing N N 110 GLN CG HG2 sing N N 111 GLN CG HG3 sing N N 112 GLN CD OE1 doub N N 113 GLN CD NE2 sing N N 114 GLN NE2 HE21 sing N N 115 GLN NE2 HE22 sing N N 116 GLN OXT HXT sing N N 117 GLU N CA sing N N 118 GLU N H sing N N 119 GLU N H2 sing N N 120 GLU CA C sing N N 121 GLU CA CB sing N N 122 GLU CA HA sing N N 123 GLU C O doub N N 124 GLU C OXT sing N N 125 GLU CB CG sing N N 126 GLU CB HB2 sing N N 127 GLU CB HB3 sing N N 128 GLU CG CD sing N N 129 GLU CG HG2 sing N N 130 GLU CG HG3 sing N N 131 GLU CD OE1 doub N N 132 GLU CD OE2 sing N N 133 GLU OE2 HE2 sing N N 134 GLU OXT HXT sing N N 135 GLY N CA sing N N 136 GLY N H sing N N 137 GLY N H2 sing N N 138 GLY CA C sing N N 139 GLY CA HA2 sing N N 140 GLY CA HA3 sing N N 141 GLY C O doub N N 142 GLY C OXT sing N N 143 GLY OXT HXT sing N N 144 HIS N CA sing N N 145 HIS N H sing N N 146 HIS N H2 sing N N 147 HIS CA C sing N N 148 HIS CA CB sing N N 149 HIS CA HA sing N N 150 HIS C O doub N N 151 HIS C OXT sing N N 152 HIS CB CG sing N N 153 HIS CB HB2 sing N N 154 HIS CB HB3 sing N N 155 HIS CG ND1 sing Y N 156 HIS CG CD2 doub Y N 157 HIS ND1 CE1 doub Y N 158 HIS ND1 HD1 sing N N 159 HIS CD2 NE2 sing Y N 160 HIS CD2 HD2 sing N N 161 HIS CE1 NE2 sing Y N 162 HIS CE1 HE1 sing N N 163 HIS NE2 HE2 sing N N 164 HIS OXT HXT sing N N 165 HOH O H1 sing N N 166 HOH O H2 sing N N 167 ILE N CA sing N N 168 ILE N H sing N N 169 ILE N H2 sing N N 170 ILE CA C sing N N 171 ILE CA CB sing N N 172 ILE CA HA sing N N 173 ILE C O doub N N 174 ILE C OXT sing N N 175 ILE CB CG1 sing N N 176 ILE CB CG2 sing N N 177 ILE CB HB sing N N 178 ILE CG1 CD1 sing N N 179 ILE CG1 HG12 sing N N 180 ILE CG1 HG13 sing N N 181 ILE CG2 HG21 sing N N 182 ILE CG2 HG22 sing N N 183 ILE CG2 HG23 sing N N 184 ILE CD1 HD11 sing N N 185 ILE CD1 HD12 sing N N 186 ILE CD1 HD13 sing N N 187 ILE OXT HXT sing N N 188 LEU N CA sing N N 189 LEU N H sing N N 190 LEU N H2 sing N N 191 LEU CA C sing N N 192 LEU CA CB sing N N 193 LEU CA HA sing N N 194 LEU C O doub N N 195 LEU C OXT sing N N 196 LEU CB CG sing N N 197 LEU CB HB2 sing N N 198 LEU CB HB3 sing N N 199 LEU CG CD1 sing N N 200 LEU CG CD2 sing N N 201 LEU CG HG sing N N 202 LEU CD1 HD11 sing N N 203 LEU CD1 HD12 sing N N 204 LEU CD1 HD13 sing N N 205 LEU CD2 HD21 sing N N 206 LEU CD2 HD22 sing N N 207 LEU CD2 HD23 sing N N 208 LEU OXT HXT sing N N 209 LYS N CA sing N N 210 LYS N H sing N N 211 LYS N H2 sing N N 212 LYS CA C sing N N 213 LYS CA CB sing N N 214 LYS CA HA sing N N 215 LYS C O doub N N 216 LYS C OXT sing N N 217 LYS CB CG sing N N 218 LYS CB HB2 sing N N 219 LYS CB HB3 sing N N 220 LYS CG CD sing N N 221 LYS CG HG2 sing N N 222 LYS CG HG3 sing N N 223 LYS CD CE sing N N 224 LYS CD HD2 sing N N 225 LYS CD HD3 sing N N 226 LYS CE NZ sing N N 227 LYS CE HE2 sing N N 228 LYS CE HE3 sing N N 229 LYS NZ HZ1 sing N N 230 LYS NZ HZ2 sing N N 231 LYS NZ HZ3 sing N N 232 LYS OXT HXT sing N N 233 MET N CA sing N N 234 MET N H sing N N 235 MET N H2 sing N N 236 MET CA C sing N N 237 MET CA CB sing N N 238 MET CA HA sing N N 239 MET C O doub N N 240 MET C OXT sing N N 241 MET CB CG sing N N 242 MET CB HB2 sing N N 243 MET CB HB3 sing N N 244 MET CG SD sing N N 245 MET CG HG2 sing N N 246 MET CG HG3 sing N N 247 MET SD CE sing N N 248 MET CE HE1 sing N N 249 MET CE HE2 sing N N 250 MET CE HE3 sing N N 251 MET OXT HXT sing N N 252 PHE N CA sing N N 253 PHE N H sing N N 254 PHE N H2 sing N N 255 PHE CA C sing N N 256 PHE CA CB sing N N 257 PHE CA HA sing N N 258 PHE C O doub N N 259 PHE C OXT sing N N 260 PHE CB CG sing N N 261 PHE CB HB2 sing N N 262 PHE CB HB3 sing N N 263 PHE CG CD1 doub Y N 264 PHE CG CD2 sing Y N 265 PHE CD1 CE1 sing Y N 266 PHE CD1 HD1 sing N N 267 PHE CD2 CE2 doub Y N 268 PHE CD2 HD2 sing N N 269 PHE CE1 CZ doub Y N 270 PHE CE1 HE1 sing N N 271 PHE CE2 CZ sing Y N 272 PHE CE2 HE2 sing N N 273 PHE CZ HZ sing N N 274 PHE OXT HXT sing N N 275 PRO N CA sing N N 276 PRO N CD sing N N 277 PRO N H sing N N 278 PRO CA C sing N N 279 PRO CA CB sing N N 280 PRO CA HA sing N N 281 PRO C O doub N N 282 PRO C OXT sing N N 283 PRO CB CG sing N N 284 PRO CB HB2 sing N N 285 PRO CB HB3 sing N N 286 PRO CG CD sing N N 287 PRO CG HG2 sing N N 288 PRO CG HG3 sing N N 289 PRO CD HD2 sing N N 290 PRO CD HD3 sing N N 291 PRO OXT HXT sing N N 292 SER N CA sing N N 293 SER N H sing N N 294 SER N H2 sing N N 295 SER CA C sing N N 296 SER CA CB sing N N 297 SER CA HA sing N N 298 SER C O doub N N 299 SER C OXT sing N N 300 SER CB OG sing N N 301 SER CB HB2 sing N N 302 SER CB HB3 sing N N 303 SER OG HG sing N N 304 SER OXT HXT sing N N 305 THR N CA sing N N 306 THR N H sing N N 307 THR N H2 sing N N 308 THR CA C sing N N 309 THR CA CB sing N N 310 THR CA HA sing N N 311 THR C O doub N N 312 THR C OXT sing N N 313 THR CB OG1 sing N N 314 THR CB CG2 sing N N 315 THR CB HB sing N N 316 THR OG1 HG1 sing N N 317 THR CG2 HG21 sing N N 318 THR CG2 HG22 sing N N 319 THR CG2 HG23 sing N N 320 THR OXT HXT sing N N 321 TRP N CA sing N N 322 TRP N H sing N N 323 TRP N H2 sing N N 324 TRP CA C sing N N 325 TRP CA CB sing N N 326 TRP CA HA sing N N 327 TRP C O doub N N 328 TRP C OXT sing N N 329 TRP CB CG sing N N 330 TRP CB HB2 sing N N 331 TRP CB HB3 sing N N 332 TRP CG CD1 doub Y N 333 TRP CG CD2 sing Y N 334 TRP CD1 NE1 sing Y N 335 TRP CD1 HD1 sing N N 336 TRP CD2 CE2 doub Y N 337 TRP CD2 CE3 sing Y N 338 TRP NE1 CE2 sing Y N 339 TRP NE1 HE1 sing N N 340 TRP CE2 CZ2 sing Y N 341 TRP CE3 CZ3 doub Y N 342 TRP CE3 HE3 sing N N 343 TRP CZ2 CH2 doub Y N 344 TRP CZ2 HZ2 sing N N 345 TRP CZ3 CH2 sing Y N 346 TRP CZ3 HZ3 sing N N 347 TRP CH2 HH2 sing N N 348 TRP OXT HXT sing N N 349 TYR N CA sing N N 350 TYR N H sing N N 351 TYR N H2 sing N N 352 TYR CA C sing N N 353 TYR CA CB sing N N 354 TYR CA HA sing N N 355 TYR C O doub N N 356 TYR C OXT sing N N 357 TYR CB CG sing N N 358 TYR CB HB2 sing N N 359 TYR CB HB3 sing N N 360 TYR CG CD1 doub Y N 361 TYR CG CD2 sing Y N 362 TYR CD1 CE1 sing Y N 363 TYR CD1 HD1 sing N N 364 TYR CD2 CE2 doub Y N 365 TYR CD2 HD2 sing N N 366 TYR CE1 CZ doub Y N 367 TYR CE1 HE1 sing N N 368 TYR CE2 CZ sing Y N 369 TYR CE2 HE2 sing N N 370 TYR CZ OH sing N N 371 TYR OH HH sing N N 372 TYR OXT HXT sing N N 373 VAL N CA sing N N 374 VAL N H sing N N 375 VAL N H2 sing N N 376 VAL CA C sing N N 377 VAL CA CB sing N N 378 VAL CA HA sing N N 379 VAL C O doub N N 380 VAL C OXT sing N N 381 VAL CB CG1 sing N N 382 VAL CB CG2 sing N N 383 VAL CB HB sing N N 384 VAL CG1 HG11 sing N N 385 VAL CG1 HG12 sing N N 386 VAL CG1 HG13 sing N N 387 VAL CG2 HG21 sing N N 388 VAL CG2 HG22 sing N N 389 VAL CG2 HG23 sing N N 390 VAL OXT HXT sing N N 391 # _pdbx_audit_support.funding_organization 'Japan Society for the Promotion of Science (JSPS)' _pdbx_audit_support.country Japan _pdbx_audit_support.grant_number 18H03983 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CHLORIDE ION' CL 3 'CHOLINE ION' CHT 4 1,2-ETHANEDIOL EDO 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1TP3 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #