data_7D83 # _entry.id 7D83 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7D83 pdb_00007d83 10.2210/pdb7d83/pdb WWPDB D_1300018416 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7D83 _pdbx_database_status.recvd_initial_deposition_date 2020-10-07 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Sugiyama, S.' 1 0000-0001-8141-6080 'Sekiguchi, Y.' 2 0000-0003-4683-373X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Bioorg.Med.Chem.Lett. _citation.journal_id_ASTM BMCLE8 _citation.journal_id_CSD 1127 _citation.journal_id_ISSN 1464-3405 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 33 _citation.language ? _citation.page_first 127742 _citation.page_last 127742 _citation.title ;Discovery of novel HIV-1 integrase-LEDGF/p75 allosteric inhibitors based on a pyridine scaffold forming an intramolecular hydrogen bond. ; _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.bmcl.2020.127742 _citation.pdbx_database_id_PubMed 33316407 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sugiyama, S.' 1 ? primary 'Akiyama, T.' 2 ? primary 'Taoda, Y.' 3 ? primary 'Iwaki, T.' 4 ? primary 'Matsuoka, E.' 5 ? primary 'Akihisa, E.' 6 ? primary 'Seki, T.' 7 ? primary 'Yoshinaga, T.' 8 ? primary 'Kawasuji, T.' 9 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7D83 _cell.details ? _cell.formula_units_Z ? _cell.length_a 72.312 _cell.length_a_esd ? _cell.length_b 72.312 _cell.length_b_esd ? _cell.length_c 65.845 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7D83 _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Integrase 18434.723 1 2.7.7.- F1332K ? ? 2 non-polymer syn 'SULFATE ION' 96.063 3 ? ? ? ? 3 non-polymer syn ;(2S)-2-[2-(cyclohexylcarbamoylamino)-3,6-dimethyl-5-(5-methyl-3,4-dihydro-2H-chromen-6-yl)pyridin-4-yl]-2-[(2-methylpropan-2-yl)oxy]ethanoic acid ; 523.664 1 ? ? ? ? 4 water nat water 18.015 15 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;GSHMHGQVDCSPGIWQLD(CAF)THLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFT STTVKAA(CAF)WWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGE RIVDIIATDIQTKE ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTV KAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIAT DIQTKE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 HIS n 1 6 GLY n 1 7 GLN n 1 8 VAL n 1 9 ASP n 1 10 CYS n 1 11 SER n 1 12 PRO n 1 13 GLY n 1 14 ILE n 1 15 TRP n 1 16 GLN n 1 17 LEU n 1 18 ASP n 1 19 CAF n 1 20 THR n 1 21 HIS n 1 22 LEU n 1 23 GLU n 1 24 GLY n 1 25 LYS n 1 26 VAL n 1 27 ILE n 1 28 LEU n 1 29 VAL n 1 30 ALA n 1 31 VAL n 1 32 HIS n 1 33 VAL n 1 34 ALA n 1 35 SER n 1 36 GLY n 1 37 TYR n 1 38 ILE n 1 39 GLU n 1 40 ALA n 1 41 GLU n 1 42 VAL n 1 43 ILE n 1 44 PRO n 1 45 ALA n 1 46 GLU n 1 47 THR n 1 48 GLY n 1 49 GLN n 1 50 GLU n 1 51 THR n 1 52 ALA n 1 53 TYR n 1 54 PHE n 1 55 LEU n 1 56 LEU n 1 57 LYS n 1 58 LEU n 1 59 ALA n 1 60 GLY n 1 61 ARG n 1 62 TRP n 1 63 PRO n 1 64 VAL n 1 65 LYS n 1 66 THR n 1 67 VAL n 1 68 HIS n 1 69 THR n 1 70 ASP n 1 71 ASN n 1 72 GLY n 1 73 SER n 1 74 ASN n 1 75 PHE n 1 76 THR n 1 77 SER n 1 78 THR n 1 79 THR n 1 80 VAL n 1 81 LYS n 1 82 ALA n 1 83 ALA n 1 84 CAF n 1 85 TRP n 1 86 TRP n 1 87 ALA n 1 88 GLY n 1 89 ILE n 1 90 LYS n 1 91 GLN n 1 92 GLU n 1 93 PHE n 1 94 GLY n 1 95 ILE n 1 96 PRO n 1 97 TYR n 1 98 ASN n 1 99 PRO n 1 100 GLN n 1 101 SER n 1 102 GLN n 1 103 GLY n 1 104 VAL n 1 105 ILE n 1 106 GLU n 1 107 SER n 1 108 MET n 1 109 ASN n 1 110 LYS n 1 111 GLU n 1 112 LEU n 1 113 LYS n 1 114 LYS n 1 115 ILE n 1 116 ILE n 1 117 GLY n 1 118 GLN n 1 119 VAL n 1 120 ARG n 1 121 ASP n 1 122 GLN n 1 123 ALA n 1 124 GLU n 1 125 HIS n 1 126 LEU n 1 127 LYS n 1 128 THR n 1 129 ALA n 1 130 VAL n 1 131 GLN n 1 132 MET n 1 133 ALA n 1 134 VAL n 1 135 PHE n 1 136 ILE n 1 137 HIS n 1 138 ASN n 1 139 LYS n 1 140 LYS n 1 141 ARG n 1 142 LYS n 1 143 GLY n 1 144 GLY n 1 145 ILE n 1 146 GLY n 1 147 GLY n 1 148 TYR n 1 149 SER n 1 150 ALA n 1 151 GLY n 1 152 GLU n 1 153 ARG n 1 154 ILE n 1 155 VAL n 1 156 ASP n 1 157 ILE n 1 158 ILE n 1 159 ALA n 1 160 THR n 1 161 ASP n 1 162 ILE n 1 163 GLN n 1 164 THR n 1 165 LYS n 1 166 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 166 _entity_src_gen.gene_src_common_name HIV-1 _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'isolate NY5' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Human immunodeficiency virus type 1 group M subtype B (isolate NY5)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 11698 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code POL_HV1N5 _struct_ref.pdbx_db_accession P12497 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAA CWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQ TKE ; _struct_ref.pdbx_align_begin 1197 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7D83 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 166 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P12497 _struct_ref_seq.db_align_beg 1197 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1359 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 50 _struct_ref_seq.pdbx_auth_seq_align_end 212 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7D83 GLY A 1 ? UNP P12497 ? ? 'expression tag' 47 1 1 7D83 SER A 2 ? UNP P12497 ? ? 'expression tag' 48 2 1 7D83 HIS A 3 ? UNP P12497 ? ? 'expression tag' 49 3 1 7D83 LYS A 139 ? UNP P12497 PHE 1332 'engineered mutation' 185 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CAF 'L-peptide linking' n S-DIMETHYLARSINOYL-CYSTEINE 'CYSTEIN-S-YL CACODYLATE' 'C5 H12 As N O3 S' 241.140 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GZ9 non-polymer . ;(2S)-2-[2-(cyclohexylcarbamoylamino)-3,6-dimethyl-5-(5-methyl-3,4-dihydro-2H-chromen-6-yl)pyridin-4-yl]-2-[(2-methylpropan-2-yl)oxy]ethanoic acid ; ? 'C30 H41 N3 O5' 523.664 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7D83 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.70 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 54.37 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M Sodium cacodylate pH 6.5, 0.2M Ammonium sulfate, 1% PEG 8000, 5mM DTT' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RIGAKU RAXIS IV++' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-04-05 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU MICROMAX-007 HF' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.5 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7D83 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.430 _reflns.d_resolution_low 62.62 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7819 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.800 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.500 _reflns.pdbx_Rmerge_I_obs 0.083 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.800 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.358 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 2.430 2.470 ? ? ? ? ? ? 366 96.800 ? ? ? ? 0.560 ? ? ? ? ? ? ? ? 5.600 ? 0.748 ? ? ? ? ? 1 1 ? ? ? 2.470 2.520 ? ? ? ? ? ? 400 100.000 ? ? ? ? 0.550 ? ? ? ? ? ? ? ? 6.100 ? 0.736 ? ? ? ? ? 2 1 ? ? ? 2.520 2.570 ? ? ? ? ? ? 377 100.000 ? ? ? ? 0.474 ? ? ? ? ? ? ? ? 6.400 ? 0.792 ? ? ? ? ? 3 1 ? ? ? 2.570 2.620 ? ? ? ? ? ? 376 100.000 ? ? ? ? 0.431 ? ? ? ? ? ? ? ? 6.300 ? 0.739 ? ? ? ? ? 4 1 ? ? ? 2.620 2.670 ? ? ? ? ? ? 392 100.000 ? ? ? ? 0.411 ? ? ? ? ? ? ? ? 6.300 ? 0.784 ? ? ? ? ? 5 1 ? ? ? 2.670 2.740 ? ? ? ? ? ? 385 100.000 ? ? ? ? 0.310 ? ? ? ? ? ? ? ? 6.500 ? 0.774 ? ? ? ? ? 6 1 ? ? ? 2.740 2.810 ? ? ? ? ? ? 380 100.000 ? ? ? ? 0.312 ? ? ? ? ? ? ? ? 6.400 ? 0.777 ? ? ? ? ? 7 1 ? ? ? 2.810 2.880 ? ? ? ? ? ? 390 100.000 ? ? ? ? 0.236 ? ? ? ? ? ? ? ? 6.500 ? 0.939 ? ? ? ? ? 8 1 ? ? ? 2.880 2.970 ? ? ? ? ? ? 377 100.000 ? ? ? ? 0.212 ? ? ? ? ? ? ? ? 6.500 ? 0.996 ? ? ? ? ? 9 1 ? ? ? 2.970 3.060 ? ? ? ? ? ? 395 100.000 ? ? ? ? 0.176 ? ? ? ? ? ? ? ? 6.600 ? 1.073 ? ? ? ? ? 10 1 ? ? ? 3.060 3.170 ? ? ? ? ? ? 379 100.000 ? ? ? ? 0.147 ? ? ? ? ? ? ? ? 6.600 ? 1.078 ? ? ? ? ? 11 1 ? ? ? 3.170 3.300 ? ? ? ? ? ? 397 100.000 ? ? ? ? 0.128 ? ? ? ? ? ? ? ? 6.700 ? 1.215 ? ? ? ? ? 12 1 ? ? ? 3.300 3.450 ? ? ? ? ? ? 388 100.000 ? ? ? ? 0.104 ? ? ? ? ? ? ? ? 6.800 ? 1.473 ? ? ? ? ? 13 1 ? ? ? 3.450 3.630 ? ? ? ? ? ? 399 100.000 ? ? ? ? 0.085 ? ? ? ? ? ? ? ? 6.800 ? 1.669 ? ? ? ? ? 14 1 ? ? ? 3.630 3.860 ? ? ? ? ? ? 374 100.000 ? ? ? ? 0.073 ? ? ? ? ? ? ? ? 6.800 ? 1.757 ? ? ? ? ? 15 1 ? ? ? 3.860 4.150 ? ? ? ? ? ? 399 100.000 ? ? ? ? 0.068 ? ? ? ? ? ? ? ? 6.700 ? 2.093 ? ? ? ? ? 16 1 ? ? ? 4.150 4.570 ? ? ? ? ? ? 401 100.000 ? ? ? ? 0.060 ? ? ? ? ? ? ? ? 6.800 ? 2.296 ? ? ? ? ? 17 1 ? ? ? 4.570 5.230 ? ? ? ? ? ? 400 100.000 ? ? ? ? 0.055 ? ? ? ? ? ? ? ? 6.700 ? 2.099 ? ? ? ? ? 18 1 ? ? ? 5.230 6.590 ? ? ? ? ? ? 412 100.000 ? ? ? ? 0.057 ? ? ? ? ? ? ? ? 6.700 ? 2.103 ? ? ? ? ? 19 1 ? ? ? 6.590 50.000 ? ? ? ? ? ? 432 98.600 ? ? ? ? 0.044 ? ? ? ? ? ? ? ? 6.000 ? 2.430 ? ? ? ? ? 20 1 ? ? ? # _refine.aniso_B[1][1] 0.8400 _refine.aniso_B[1][2] 0.4200 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 0.8400 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] -1.2600 _refine.B_iso_max 122.450 _refine.B_iso_mean 53.3440 _refine.B_iso_min 27.610 _refine.correlation_coeff_Fo_to_Fc 0.9340 _refine.correlation_coeff_Fo_to_Fc_free 0.8960 _refine.details 'U VALUES : WITH TLS ADDED HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7D83 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.4300 _refine.ls_d_res_low 62.6200 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7444 _refine.ls_number_reflns_R_free 359 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.8600 _refine.ls_percent_reflns_R_free 4.6000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2263 _refine.ls_R_factor_R_free 0.2779 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2239 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6LMQ _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.3550 _refine.pdbx_overall_ESU_R_Free 0.2710 _refine.pdbx_solvent_vdw_probe_radii 1.4000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 17.8680 _refine.overall_SU_ML 0.1990 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.4300 _refine_hist.d_res_low 62.6200 _refine_hist.number_atoms_solvent 15 _refine_hist.number_atoms_total 1156 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 139 _refine_hist.pdbx_B_iso_mean_ligand 64.01 _refine_hist.pdbx_B_iso_mean_solvent 41.11 _refine_hist.pdbx_number_atoms_protein 1088 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 53 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 0.022 1165 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 1.043 1.990 1580 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 5.184 5.000 136 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 31.824 24.783 46 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 16.329 15.000 196 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 16.848 15.000 4 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.063 0.200 175 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 0.020 831 ? r_gen_planes_refined ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.43 _refine_ls_shell.d_res_low 2.4920 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 28 _refine_ls_shell.number_reflns_R_work 541 _refine_ls_shell.percent_reflns_obs 99.1300 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.284 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.246 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7D83 _struct.title ;Crystal structure of HIV-1 integrase catalytic core domain in complex with 2-(tert-butoxy)-2-(2-(3-cyclohexylureido)-3,6-dimethyl-5-(5-methylchroman-6-yl)pyridin-4-yl)acetic acid ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7D83 _struct_keywords.text 'HIV-1 Integrase, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 47 ? TRP A 62 ? THR A 93 TRP A 108 1 ? 16 HELX_P HELX_P2 AA2 ASN A 71 ? THR A 76 ? ASN A 117 THR A 122 5 ? 6 HELX_P HELX_P3 AA3 SER A 77 ? GLY A 88 ? SER A 123 GLY A 134 1 ? 12 HELX_P HELX_P4 AA4 SER A 107 ? ARG A 120 ? SER A 153 ARG A 166 1 ? 14 HELX_P HELX_P5 AA5 ASP A 121 ? ALA A 123 ? ASP A 167 ALA A 169 5 ? 3 HELX_P HELX_P6 AA6 HIS A 125 ? LYS A 140 ? HIS A 171 LYS A 186 1 ? 16 HELX_P HELX_P7 AA7 SER A 149 ? GLN A 163 ? SER A 195 GLN A 209 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ASP 18 C ? ? ? 1_555 A CAF 19 N ? ? A ASP 64 A CAF 65 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale2 covale both ? A CAF 19 C ? ? ? 1_555 A THR 20 N ? ? A CAF 65 A THR 66 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale3 covale both ? A ALA 83 C ? ? ? 1_555 A CAF 84 N ? ? A ALA 129 A CAF 130 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale4 covale both ? A CAF 84 C ? ? ? 1_555 A TRP 85 N ? ? A CAF 130 A TRP 131 1_555 ? ? ? ? ? ? ? 1.334 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLU _struct_mon_prot_cis.label_seq_id 106 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLU _struct_mon_prot_cis.auth_seq_id 152 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 SER _struct_mon_prot_cis.pdbx_label_seq_id_2 107 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 SER _struct_mon_prot_cis.pdbx_auth_seq_id_2 153 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -10.98 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 37 ? ILE A 43 ? TYR A 83 ILE A 89 AA1 2 LYS A 25 ? HIS A 32 ? LYS A 71 HIS A 78 AA1 3 ILE A 14 ? LEU A 22 ? ILE A 60 LEU A 68 AA1 4 THR A 66 ? HIS A 68 ? THR A 112 HIS A 114 AA1 5 LYS A 90 ? GLN A 91 ? LYS A 136 GLN A 137 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLU A 39 ? O GLU A 85 N ALA A 30 ? N ALA A 76 AA1 2 3 O VAL A 29 ? O VAL A 75 N ASP A 18 ? N ASP A 64 AA1 3 4 N LEU A 17 ? N LEU A 63 O HIS A 68 ? O HIS A 114 AA1 4 5 N VAL A 67 ? N VAL A 113 O LYS A 90 ? O LYS A 136 # _atom_sites.entry_id 7D83 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.013829 _atom_sites.fract_transf_matrix[1][2] 0.007984 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015968 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015187 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol AS C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 47 ? ? ? A . n A 1 2 SER 2 48 ? ? ? A . n A 1 3 HIS 3 49 ? ? ? A . n A 1 4 MET 4 50 ? ? ? A . n A 1 5 HIS 5 51 ? ? ? A . n A 1 6 GLY 6 52 ? ? ? A . n A 1 7 GLN 7 53 ? ? ? A . n A 1 8 VAL 8 54 ? ? ? A . n A 1 9 ASP 9 55 ? ? ? A . n A 1 10 CYS 10 56 56 CYS CYS A . n A 1 11 SER 11 57 57 SER SER A . n A 1 12 PRO 12 58 58 PRO PRO A . n A 1 13 GLY 13 59 59 GLY GLY A . n A 1 14 ILE 14 60 60 ILE ILE A . n A 1 15 TRP 15 61 61 TRP TRP A . n A 1 16 GLN 16 62 62 GLN GLN A . n A 1 17 LEU 17 63 63 LEU LEU A . n A 1 18 ASP 18 64 64 ASP ASP A . n A 1 19 CAF 19 65 65 CAF CAF A . n A 1 20 THR 20 66 66 THR THR A . n A 1 21 HIS 21 67 67 HIS HIS A . n A 1 22 LEU 22 68 68 LEU LEU A . n A 1 23 GLU 23 69 69 GLU GLU A . n A 1 24 GLY 24 70 70 GLY GLY A . n A 1 25 LYS 25 71 71 LYS LYS A . n A 1 26 VAL 26 72 72 VAL VAL A . n A 1 27 ILE 27 73 73 ILE ILE A . n A 1 28 LEU 28 74 74 LEU LEU A . n A 1 29 VAL 29 75 75 VAL VAL A . n A 1 30 ALA 30 76 76 ALA ALA A . n A 1 31 VAL 31 77 77 VAL VAL A . n A 1 32 HIS 32 78 78 HIS HIS A . n A 1 33 VAL 33 79 79 VAL VAL A . n A 1 34 ALA 34 80 80 ALA ALA A . n A 1 35 SER 35 81 81 SER SER A . n A 1 36 GLY 36 82 82 GLY GLY A . n A 1 37 TYR 37 83 83 TYR TYR A . n A 1 38 ILE 38 84 84 ILE ILE A . n A 1 39 GLU 39 85 85 GLU GLU A . n A 1 40 ALA 40 86 86 ALA ALA A . n A 1 41 GLU 41 87 87 GLU GLU A . n A 1 42 VAL 42 88 88 VAL VAL A . n A 1 43 ILE 43 89 89 ILE ILE A . n A 1 44 PRO 44 90 90 PRO PRO A . n A 1 45 ALA 45 91 91 ALA ALA A . n A 1 46 GLU 46 92 92 GLU GLU A . n A 1 47 THR 47 93 93 THR THR A . n A 1 48 GLY 48 94 94 GLY GLY A . n A 1 49 GLN 49 95 95 GLN GLN A . n A 1 50 GLU 50 96 96 GLU GLU A . n A 1 51 THR 51 97 97 THR THR A . n A 1 52 ALA 52 98 98 ALA ALA A . n A 1 53 TYR 53 99 99 TYR TYR A . n A 1 54 PHE 54 100 100 PHE PHE A . n A 1 55 LEU 55 101 101 LEU LEU A . n A 1 56 LEU 56 102 102 LEU LEU A . n A 1 57 LYS 57 103 103 LYS LYS A . n A 1 58 LEU 58 104 104 LEU LEU A . n A 1 59 ALA 59 105 105 ALA ALA A . n A 1 60 GLY 60 106 106 GLY GLY A . n A 1 61 ARG 61 107 107 ARG ARG A . n A 1 62 TRP 62 108 108 TRP TRP A . n A 1 63 PRO 63 109 109 PRO PRO A . n A 1 64 VAL 64 110 110 VAL VAL A . n A 1 65 LYS 65 111 111 LYS LYS A . n A 1 66 THR 66 112 112 THR THR A . n A 1 67 VAL 67 113 113 VAL VAL A . n A 1 68 HIS 68 114 114 HIS HIS A . n A 1 69 THR 69 115 115 THR THR A . n A 1 70 ASP 70 116 116 ASP ASP A . n A 1 71 ASN 71 117 117 ASN ASN A . n A 1 72 GLY 72 118 118 GLY GLY A . n A 1 73 SER 73 119 119 SER SER A . n A 1 74 ASN 74 120 120 ASN ASN A . n A 1 75 PHE 75 121 121 PHE PHE A . n A 1 76 THR 76 122 122 THR THR A . n A 1 77 SER 77 123 123 SER SER A . n A 1 78 THR 78 124 124 THR THR A . n A 1 79 THR 79 125 125 THR THR A . n A 1 80 VAL 80 126 126 VAL VAL A . n A 1 81 LYS 81 127 127 LYS LYS A . n A 1 82 ALA 82 128 128 ALA ALA A . n A 1 83 ALA 83 129 129 ALA ALA A . n A 1 84 CAF 84 130 130 CAF CAF A . n A 1 85 TRP 85 131 131 TRP TRP A . n A 1 86 TRP 86 132 132 TRP TRP A . n A 1 87 ALA 87 133 133 ALA ALA A . n A 1 88 GLY 88 134 134 GLY GLY A . n A 1 89 ILE 89 135 135 ILE ILE A . n A 1 90 LYS 90 136 136 LYS LYS A . n A 1 91 GLN 91 137 137 GLN GLN A . n A 1 92 GLU 92 138 138 GLU GLU A . n A 1 93 PHE 93 139 139 PHE PHE A . n A 1 94 GLY 94 140 ? ? ? A . n A 1 95 ILE 95 141 ? ? ? A . n A 1 96 PRO 96 142 ? ? ? A . n A 1 97 TYR 97 143 ? ? ? A . n A 1 98 ASN 98 144 ? ? ? A . n A 1 99 PRO 99 145 ? ? ? A . n A 1 100 GLN 100 146 ? ? ? A . n A 1 101 SER 101 147 ? ? ? A . n A 1 102 GLN 102 148 ? ? ? A . n A 1 103 GLY 103 149 ? ? ? A . n A 1 104 VAL 104 150 ? ? ? A . n A 1 105 ILE 105 151 151 ILE ILE A . n A 1 106 GLU 106 152 152 GLU GLU A . n A 1 107 SER 107 153 153 SER SER A . n A 1 108 MET 108 154 154 MET MET A . n A 1 109 ASN 109 155 155 ASN ASN A . n A 1 110 LYS 110 156 156 LYS LYS A . n A 1 111 GLU 111 157 157 GLU GLU A . n A 1 112 LEU 112 158 158 LEU LEU A . n A 1 113 LYS 113 159 159 LYS LYS A . n A 1 114 LYS 114 160 160 LYS LYS A . n A 1 115 ILE 115 161 161 ILE ILE A . n A 1 116 ILE 116 162 162 ILE ILE A . n A 1 117 GLY 117 163 163 GLY GLY A . n A 1 118 GLN 118 164 164 GLN GLN A . n A 1 119 VAL 119 165 165 VAL VAL A . n A 1 120 ARG 120 166 166 ARG ARG A . n A 1 121 ASP 121 167 167 ASP ASP A . n A 1 122 GLN 122 168 168 GLN GLN A . n A 1 123 ALA 123 169 169 ALA ALA A . n A 1 124 GLU 124 170 170 GLU GLU A . n A 1 125 HIS 125 171 171 HIS HIS A . n A 1 126 LEU 126 172 172 LEU LEU A . n A 1 127 LYS 127 173 173 LYS LYS A . n A 1 128 THR 128 174 174 THR THR A . n A 1 129 ALA 129 175 175 ALA ALA A . n A 1 130 VAL 130 176 176 VAL VAL A . n A 1 131 GLN 131 177 177 GLN GLN A . n A 1 132 MET 132 178 178 MET MET A . n A 1 133 ALA 133 179 179 ALA ALA A . n A 1 134 VAL 134 180 180 VAL VAL A . n A 1 135 PHE 135 181 181 PHE PHE A . n A 1 136 ILE 136 182 182 ILE ILE A . n A 1 137 HIS 137 183 183 HIS HIS A . n A 1 138 ASN 138 184 184 ASN ASN A . n A 1 139 LYS 139 185 185 LYS LYS A . n A 1 140 LYS 140 186 186 LYS LYS A . n A 1 141 ARG 141 187 187 ARG ARG A . n A 1 142 LYS 142 188 188 LYS LYS A . n A 1 143 GLY 143 189 ? ? ? A . n A 1 144 GLY 144 190 ? ? ? A . n A 1 145 ILE 145 191 ? ? ? A . n A 1 146 GLY 146 192 ? ? ? A . n A 1 147 GLY 147 193 193 GLY GLY A . n A 1 148 TYR 148 194 194 TYR TYR A . n A 1 149 SER 149 195 195 SER SER A . n A 1 150 ALA 150 196 196 ALA ALA A . n A 1 151 GLY 151 197 197 GLY GLY A . n A 1 152 GLU 152 198 198 GLU GLU A . n A 1 153 ARG 153 199 199 ARG ARG A . n A 1 154 ILE 154 200 200 ILE ILE A . n A 1 155 VAL 155 201 201 VAL VAL A . n A 1 156 ASP 156 202 202 ASP ASP A . n A 1 157 ILE 157 203 203 ILE ILE A . n A 1 158 ILE 158 204 204 ILE ILE A . n A 1 159 ALA 159 205 205 ALA ALA A . n A 1 160 THR 160 206 206 THR THR A . n A 1 161 ASP 161 207 207 ASP ASP A . n A 1 162 ILE 162 208 208 ILE ILE A . n A 1 163 GLN 163 209 209 GLN GLN A . n A 1 164 THR 164 210 ? ? ? A . n A 1 165 LYS 165 211 ? ? ? A . n A 1 166 GLU 166 212 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 301 1 SO4 SO4 A . C 2 SO4 1 302 2 SO4 SO4 A . D 2 SO4 1 303 3 SO4 SO4 A . E 3 GZ9 1 304 1 GZ9 MOL A . F 4 HOH 1 401 7 HOH HOH A . F 4 HOH 2 402 20 HOH HOH A . F 4 HOH 3 403 22 HOH HOH A . F 4 HOH 4 404 17 HOH HOH A . F 4 HOH 5 405 1 HOH HOH A . F 4 HOH 6 406 19 HOH HOH A . F 4 HOH 7 407 21 HOH HOH A . F 4 HOH 8 408 4 HOH HOH A . F 4 HOH 9 409 23 HOH HOH A . F 4 HOH 10 410 9 HOH HOH A . F 4 HOH 11 411 8 HOH HOH A . F 4 HOH 12 412 5 HOH HOH A . F 4 HOH 13 413 6 HOH HOH A . F 4 HOH 14 414 15 HOH HOH A . F 4 HOH 15 415 24 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A CAF 19 A CAF 65 ? CYS 'modified residue' 2 A CAF 84 A CAF 130 ? CYS 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4390 ? 1 MORE -93 ? 1 'SSA (A^2)' 13100 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 6_555 -x,-x+y,-z+1/3 -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 -0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 21.9483333333 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-01-13 2 'Structure model' 1 1 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 23.509 _pdbx_refine_tls.origin_y -30.137 _pdbx_refine_tls.origin_z 3.243 _pdbx_refine_tls.T[1][1] 0.1130 _pdbx_refine_tls.T[2][2] 0.0800 _pdbx_refine_tls.T[3][3] 0.0548 _pdbx_refine_tls.T[1][2] -0.0210 _pdbx_refine_tls.T[1][3] 0.0649 _pdbx_refine_tls.T[2][3] -0.0117 _pdbx_refine_tls.L[1][1] 2.6233 _pdbx_refine_tls.L[2][2] 1.9657 _pdbx_refine_tls.L[3][3] 2.0599 _pdbx_refine_tls.L[1][2] 1.9472 _pdbx_refine_tls.L[1][3] 0.4615 _pdbx_refine_tls.L[2][3] -0.0745 _pdbx_refine_tls.S[1][1] -0.3111 _pdbx_refine_tls.S[2][2] 0.1515 _pdbx_refine_tls.S[3][3] 0.1596 _pdbx_refine_tls.S[1][2] 0.1914 _pdbx_refine_tls.S[1][3] -0.1054 _pdbx_refine_tls.S[2][3] -0.1876 _pdbx_refine_tls.S[2][1] -0.3506 _pdbx_refine_tls.S[3][1] -0.0222 _pdbx_refine_tls.S[3][2] 0.1191 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 56 _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 209 _pdbx_refine_tls_group.selection_details ? _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.5.0102 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 5 # _pdbx_entry_details.entry_id 7D83 _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id GLU _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 152 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -25.01 _pdbx_validate_torsion.psi -103.44 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A CAF 65 ? CE2 ? A CAF 19 CE2 2 1 Y 1 A CAF 130 ? CE2 ? A CAF 84 CE2 3 1 Y 1 A GLU 152 ? CG ? A GLU 106 CG 4 1 Y 1 A GLU 152 ? CD ? A GLU 106 CD 5 1 Y 1 A GLU 152 ? OE1 ? A GLU 106 OE1 6 1 Y 1 A GLU 152 ? OE2 ? A GLU 106 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 47 ? A GLY 1 2 1 Y 1 A SER 48 ? A SER 2 3 1 Y 1 A HIS 49 ? A HIS 3 4 1 Y 1 A MET 50 ? A MET 4 5 1 Y 1 A HIS 51 ? A HIS 5 6 1 Y 1 A GLY 52 ? A GLY 6 7 1 Y 1 A GLN 53 ? A GLN 7 8 1 Y 1 A VAL 54 ? A VAL 8 9 1 Y 1 A ASP 55 ? A ASP 9 10 1 Y 1 A GLY 140 ? A GLY 94 11 1 Y 1 A ILE 141 ? A ILE 95 12 1 Y 1 A PRO 142 ? A PRO 96 13 1 Y 1 A TYR 143 ? A TYR 97 14 1 Y 1 A ASN 144 ? A ASN 98 15 1 Y 1 A PRO 145 ? A PRO 99 16 1 Y 1 A GLN 146 ? A GLN 100 17 1 Y 1 A SER 147 ? A SER 101 18 1 Y 1 A GLN 148 ? A GLN 102 19 1 Y 1 A GLY 149 ? A GLY 103 20 1 Y 1 A VAL 150 ? A VAL 104 21 1 Y 1 A GLY 189 ? A GLY 143 22 1 Y 1 A GLY 190 ? A GLY 144 23 1 Y 1 A ILE 191 ? A ILE 145 24 1 Y 1 A GLY 192 ? A GLY 146 25 1 Y 1 A THR 210 ? A THR 164 26 1 Y 1 A LYS 211 ? A LYS 165 27 1 Y 1 A GLU 212 ? A GLU 166 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CAF N N N N 74 CAF CA C N R 75 CAF CB C N N 76 CAF C C N N 77 CAF O O N N 78 CAF OXT O N N 79 CAF SG S N N 80 CAF AS AS N N 81 CAF CE1 C N N 82 CAF CE2 C N N 83 CAF O1 O N N 84 CAF H H N N 85 CAF H2 H N N 86 CAF HA H N N 87 CAF HB2 H N N 88 CAF HB3 H N N 89 CAF HXT H N N 90 CAF HE11 H N N 91 CAF HE12 H N N 92 CAF HE13 H N N 93 CAF HE21 H N N 94 CAF HE22 H N N 95 CAF HE23 H N N 96 CYS N N N N 97 CYS CA C N R 98 CYS C C N N 99 CYS O O N N 100 CYS CB C N N 101 CYS SG S N N 102 CYS OXT O N N 103 CYS H H N N 104 CYS H2 H N N 105 CYS HA H N N 106 CYS HB2 H N N 107 CYS HB3 H N N 108 CYS HG H N N 109 CYS HXT H N N 110 GLN N N N N 111 GLN CA C N S 112 GLN C C N N 113 GLN O O N N 114 GLN CB C N N 115 GLN CG C N N 116 GLN CD C N N 117 GLN OE1 O N N 118 GLN NE2 N N N 119 GLN OXT O N N 120 GLN H H N N 121 GLN H2 H N N 122 GLN HA H N N 123 GLN HB2 H N N 124 GLN HB3 H N N 125 GLN HG2 H N N 126 GLN HG3 H N N 127 GLN HE21 H N N 128 GLN HE22 H N N 129 GLN HXT H N N 130 GLU N N N N 131 GLU CA C N S 132 GLU C C N N 133 GLU O O N N 134 GLU CB C N N 135 GLU CG C N N 136 GLU CD C N N 137 GLU OE1 O N N 138 GLU OE2 O N N 139 GLU OXT O N N 140 GLU H H N N 141 GLU H2 H N N 142 GLU HA H N N 143 GLU HB2 H N N 144 GLU HB3 H N N 145 GLU HG2 H N N 146 GLU HG3 H N N 147 GLU HE2 H N N 148 GLU HXT H N N 149 GLY N N N N 150 GLY CA C N N 151 GLY C C N N 152 GLY O O N N 153 GLY OXT O N N 154 GLY H H N N 155 GLY H2 H N N 156 GLY HA2 H N N 157 GLY HA3 H N N 158 GLY HXT H N N 159 GZ9 C1 C N N 160 GZ9 C2 C Y N 161 GZ9 C3 C Y N 162 GZ9 C4 C N N 163 GZ9 C5 C N N 164 GZ9 C6 C N N 165 GZ9 N1 N Y N 166 GZ9 N2 N N N 167 GZ9 N3 N N N 168 GZ9 O1 O N N 169 GZ9 C7 C N N 170 GZ9 C8 C N N 171 GZ9 C9 C N N 172 GZ9 C10 C N N 173 GZ9 C11 C Y N 174 GZ9 C12 C N N 175 GZ9 C13 C Y N 176 GZ9 C14 C N S 177 GZ9 C15 C N N 178 GZ9 O2 O N N 179 GZ9 C16 C N N 180 GZ9 C17 C N N 181 GZ9 C18 C N N 182 GZ9 C19 C N N 183 GZ9 O3 O N N 184 GZ9 O4 O N N 185 GZ9 C20 C Y N 186 GZ9 C21 C Y N 187 GZ9 C22 C Y N 188 GZ9 C23 C Y N 189 GZ9 C24 C Y N 190 GZ9 C28 C Y N 191 GZ9 C29 C Y N 192 GZ9 C30 C N N 193 GZ9 O5 O N N 194 GZ9 C25 C N N 195 GZ9 C26 C N N 196 GZ9 C27 C N N 197 GZ9 H1 H N N 198 GZ9 H2 H N N 199 GZ9 H3 H N N 200 GZ9 H4 H N N 201 GZ9 H5 H N N 202 GZ9 H6 H N N 203 GZ9 H7 H N N 204 GZ9 H8 H N N 205 GZ9 H9 H N N 206 GZ9 H10 H N N 207 GZ9 H11 H N N 208 GZ9 H12 H N N 209 GZ9 H13 H N N 210 GZ9 H14 H N N 211 GZ9 H15 H N N 212 GZ9 H16 H N N 213 GZ9 H17 H N N 214 GZ9 H18 H N N 215 GZ9 H19 H N N 216 GZ9 H20 H N N 217 GZ9 H21 H N N 218 GZ9 H22 H N N 219 GZ9 H23 H N N 220 GZ9 H24 H N N 221 GZ9 H25 H N N 222 GZ9 H26 H N N 223 GZ9 H27 H N N 224 GZ9 H28 H N N 225 GZ9 H29 H N N 226 GZ9 H30 H N N 227 GZ9 H31 H N N 228 GZ9 H32 H N N 229 GZ9 H33 H N N 230 GZ9 H34 H N N 231 GZ9 H35 H N N 232 GZ9 H36 H N N 233 GZ9 H37 H N N 234 GZ9 H38 H N N 235 GZ9 H39 H N N 236 GZ9 H40 H N N 237 GZ9 H41 H N N 238 HIS N N N N 239 HIS CA C N S 240 HIS C C N N 241 HIS O O N N 242 HIS CB C N N 243 HIS CG C Y N 244 HIS ND1 N Y N 245 HIS CD2 C Y N 246 HIS CE1 C Y N 247 HIS NE2 N Y N 248 HIS OXT O N N 249 HIS H H N N 250 HIS H2 H N N 251 HIS HA H N N 252 HIS HB2 H N N 253 HIS HB3 H N N 254 HIS HD1 H N N 255 HIS HD2 H N N 256 HIS HE1 H N N 257 HIS HE2 H N N 258 HIS HXT H N N 259 HOH O O N N 260 HOH H1 H N N 261 HOH H2 H N N 262 ILE N N N N 263 ILE CA C N S 264 ILE C C N N 265 ILE O O N N 266 ILE CB C N S 267 ILE CG1 C N N 268 ILE CG2 C N N 269 ILE CD1 C N N 270 ILE OXT O N N 271 ILE H H N N 272 ILE H2 H N N 273 ILE HA H N N 274 ILE HB H N N 275 ILE HG12 H N N 276 ILE HG13 H N N 277 ILE HG21 H N N 278 ILE HG22 H N N 279 ILE HG23 H N N 280 ILE HD11 H N N 281 ILE HD12 H N N 282 ILE HD13 H N N 283 ILE HXT H N N 284 LEU N N N N 285 LEU CA C N S 286 LEU C C N N 287 LEU O O N N 288 LEU CB C N N 289 LEU CG C N N 290 LEU CD1 C N N 291 LEU CD2 C N N 292 LEU OXT O N N 293 LEU H H N N 294 LEU H2 H N N 295 LEU HA H N N 296 LEU HB2 H N N 297 LEU HB3 H N N 298 LEU HG H N N 299 LEU HD11 H N N 300 LEU HD12 H N N 301 LEU HD13 H N N 302 LEU HD21 H N N 303 LEU HD22 H N N 304 LEU HD23 H N N 305 LEU HXT H N N 306 LYS N N N N 307 LYS CA C N S 308 LYS C C N N 309 LYS O O N N 310 LYS CB C N N 311 LYS CG C N N 312 LYS CD C N N 313 LYS CE C N N 314 LYS NZ N N N 315 LYS OXT O N N 316 LYS H H N N 317 LYS H2 H N N 318 LYS HA H N N 319 LYS HB2 H N N 320 LYS HB3 H N N 321 LYS HG2 H N N 322 LYS HG3 H N N 323 LYS HD2 H N N 324 LYS HD3 H N N 325 LYS HE2 H N N 326 LYS HE3 H N N 327 LYS HZ1 H N N 328 LYS HZ2 H N N 329 LYS HZ3 H N N 330 LYS HXT H N N 331 MET N N N N 332 MET CA C N S 333 MET C C N N 334 MET O O N N 335 MET CB C N N 336 MET CG C N N 337 MET SD S N N 338 MET CE C N N 339 MET OXT O N N 340 MET H H N N 341 MET H2 H N N 342 MET HA H N N 343 MET HB2 H N N 344 MET HB3 H N N 345 MET HG2 H N N 346 MET HG3 H N N 347 MET HE1 H N N 348 MET HE2 H N N 349 MET HE3 H N N 350 MET HXT H N N 351 PHE N N N N 352 PHE CA C N S 353 PHE C C N N 354 PHE O O N N 355 PHE CB C N N 356 PHE CG C Y N 357 PHE CD1 C Y N 358 PHE CD2 C Y N 359 PHE CE1 C Y N 360 PHE CE2 C Y N 361 PHE CZ C Y N 362 PHE OXT O N N 363 PHE H H N N 364 PHE H2 H N N 365 PHE HA H N N 366 PHE HB2 H N N 367 PHE HB3 H N N 368 PHE HD1 H N N 369 PHE HD2 H N N 370 PHE HE1 H N N 371 PHE HE2 H N N 372 PHE HZ H N N 373 PHE HXT H N N 374 PRO N N N N 375 PRO CA C N S 376 PRO C C N N 377 PRO O O N N 378 PRO CB C N N 379 PRO CG C N N 380 PRO CD C N N 381 PRO OXT O N N 382 PRO H H N N 383 PRO HA H N N 384 PRO HB2 H N N 385 PRO HB3 H N N 386 PRO HG2 H N N 387 PRO HG3 H N N 388 PRO HD2 H N N 389 PRO HD3 H N N 390 PRO HXT H N N 391 SER N N N N 392 SER CA C N S 393 SER C C N N 394 SER O O N N 395 SER CB C N N 396 SER OG O N N 397 SER OXT O N N 398 SER H H N N 399 SER H2 H N N 400 SER HA H N N 401 SER HB2 H N N 402 SER HB3 H N N 403 SER HG H N N 404 SER HXT H N N 405 SO4 S S N N 406 SO4 O1 O N N 407 SO4 O2 O N N 408 SO4 O3 O N N 409 SO4 O4 O N N 410 THR N N N N 411 THR CA C N S 412 THR C C N N 413 THR O O N N 414 THR CB C N R 415 THR OG1 O N N 416 THR CG2 C N N 417 THR OXT O N N 418 THR H H N N 419 THR H2 H N N 420 THR HA H N N 421 THR HB H N N 422 THR HG1 H N N 423 THR HG21 H N N 424 THR HG22 H N N 425 THR HG23 H N N 426 THR HXT H N N 427 TRP N N N N 428 TRP CA C N S 429 TRP C C N N 430 TRP O O N N 431 TRP CB C N N 432 TRP CG C Y N 433 TRP CD1 C Y N 434 TRP CD2 C Y N 435 TRP NE1 N Y N 436 TRP CE2 C Y N 437 TRP CE3 C Y N 438 TRP CZ2 C Y N 439 TRP CZ3 C Y N 440 TRP CH2 C Y N 441 TRP OXT O N N 442 TRP H H N N 443 TRP H2 H N N 444 TRP HA H N N 445 TRP HB2 H N N 446 TRP HB3 H N N 447 TRP HD1 H N N 448 TRP HE1 H N N 449 TRP HE3 H N N 450 TRP HZ2 H N N 451 TRP HZ3 H N N 452 TRP HH2 H N N 453 TRP HXT H N N 454 TYR N N N N 455 TYR CA C N S 456 TYR C C N N 457 TYR O O N N 458 TYR CB C N N 459 TYR CG C Y N 460 TYR CD1 C Y N 461 TYR CD2 C Y N 462 TYR CE1 C Y N 463 TYR CE2 C Y N 464 TYR CZ C Y N 465 TYR OH O N N 466 TYR OXT O N N 467 TYR H H N N 468 TYR H2 H N N 469 TYR HA H N N 470 TYR HB2 H N N 471 TYR HB3 H N N 472 TYR HD1 H N N 473 TYR HD2 H N N 474 TYR HE1 H N N 475 TYR HE2 H N N 476 TYR HH H N N 477 TYR HXT H N N 478 VAL N N N N 479 VAL CA C N S 480 VAL C C N N 481 VAL O O N N 482 VAL CB C N N 483 VAL CG1 C N N 484 VAL CG2 C N N 485 VAL OXT O N N 486 VAL H H N N 487 VAL H2 H N N 488 VAL HA H N N 489 VAL HB H N N 490 VAL HG11 H N N 491 VAL HG12 H N N 492 VAL HG13 H N N 493 VAL HG21 H N N 494 VAL HG22 H N N 495 VAL HG23 H N N 496 VAL HXT H N N 497 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CAF N CA sing N N 70 CAF N H sing N N 71 CAF N H2 sing N N 72 CAF CA CB sing N N 73 CAF CA C sing N N 74 CAF CA HA sing N N 75 CAF CB SG sing N N 76 CAF CB HB2 sing N N 77 CAF CB HB3 sing N N 78 CAF C O doub N N 79 CAF C OXT sing N N 80 CAF OXT HXT sing N N 81 CAF SG AS sing N N 82 CAF AS CE1 sing N N 83 CAF AS CE2 sing N N 84 CAF AS O1 doub N N 85 CAF CE1 HE11 sing N N 86 CAF CE1 HE12 sing N N 87 CAF CE1 HE13 sing N N 88 CAF CE2 HE21 sing N N 89 CAF CE2 HE22 sing N N 90 CAF CE2 HE23 sing N N 91 CYS N CA sing N N 92 CYS N H sing N N 93 CYS N H2 sing N N 94 CYS CA C sing N N 95 CYS CA CB sing N N 96 CYS CA HA sing N N 97 CYS C O doub N N 98 CYS C OXT sing N N 99 CYS CB SG sing N N 100 CYS CB HB2 sing N N 101 CYS CB HB3 sing N N 102 CYS SG HG sing N N 103 CYS OXT HXT sing N N 104 GLN N CA sing N N 105 GLN N H sing N N 106 GLN N H2 sing N N 107 GLN CA C sing N N 108 GLN CA CB sing N N 109 GLN CA HA sing N N 110 GLN C O doub N N 111 GLN C OXT sing N N 112 GLN CB CG sing N N 113 GLN CB HB2 sing N N 114 GLN CB HB3 sing N N 115 GLN CG CD sing N N 116 GLN CG HG2 sing N N 117 GLN CG HG3 sing N N 118 GLN CD OE1 doub N N 119 GLN CD NE2 sing N N 120 GLN NE2 HE21 sing N N 121 GLN NE2 HE22 sing N N 122 GLN OXT HXT sing N N 123 GLU N CA sing N N 124 GLU N H sing N N 125 GLU N H2 sing N N 126 GLU CA C sing N N 127 GLU CA CB sing N N 128 GLU CA HA sing N N 129 GLU C O doub N N 130 GLU C OXT sing N N 131 GLU CB CG sing N N 132 GLU CB HB2 sing N N 133 GLU CB HB3 sing N N 134 GLU CG CD sing N N 135 GLU CG HG2 sing N N 136 GLU CG HG3 sing N N 137 GLU CD OE1 doub N N 138 GLU CD OE2 sing N N 139 GLU OE2 HE2 sing N N 140 GLU OXT HXT sing N N 141 GLY N CA sing N N 142 GLY N H sing N N 143 GLY N H2 sing N N 144 GLY CA C sing N N 145 GLY CA HA2 sing N N 146 GLY CA HA3 sing N N 147 GLY C O doub N N 148 GLY C OXT sing N N 149 GLY OXT HXT sing N N 150 GZ9 C7 C6 sing N N 151 GZ9 C7 C8 sing N N 152 GZ9 C16 C15 sing N N 153 GZ9 C6 C5 sing N N 154 GZ9 C17 C15 sing N N 155 GZ9 C15 C18 sing N N 156 GZ9 C15 O2 sing N N 157 GZ9 C8 C9 sing N N 158 GZ9 C5 N3 sing N N 159 GZ9 C5 C10 sing N N 160 GZ9 N3 C4 sing N N 161 GZ9 C4 O1 doub N N 162 GZ9 C4 N2 sing N N 163 GZ9 C22 C23 doub Y N 164 GZ9 C22 C21 sing Y N 165 GZ9 C23 C24 sing Y N 166 GZ9 N2 C3 sing N N 167 GZ9 O2 C14 sing N N 168 GZ9 C9 C10 sing N N 169 GZ9 N1 C3 doub Y N 170 GZ9 N1 C2 sing Y N 171 GZ9 C3 C11 sing Y N 172 GZ9 C1 C2 sing N N 173 GZ9 C2 C20 doub Y N 174 GZ9 C11 C12 sing N N 175 GZ9 C11 C13 doub Y N 176 GZ9 C13 C20 sing Y N 177 GZ9 C13 C14 sing N N 178 GZ9 C20 C21 sing N N 179 GZ9 C21 C29 doub Y N 180 GZ9 C14 C19 sing N N 181 GZ9 C24 O5 sing N N 182 GZ9 C24 C28 doub Y N 183 GZ9 O5 C25 sing N N 184 GZ9 C29 C28 sing Y N 185 GZ9 C29 C30 sing N N 186 GZ9 C28 C27 sing N N 187 GZ9 C25 C26 sing N N 188 GZ9 C19 O4 doub N N 189 GZ9 C19 O3 sing N N 190 GZ9 C26 C27 sing N N 191 GZ9 C1 H1 sing N N 192 GZ9 C1 H2 sing N N 193 GZ9 C1 H3 sing N N 194 GZ9 C5 H4 sing N N 195 GZ9 C6 H5 sing N N 196 GZ9 C6 H6 sing N N 197 GZ9 N2 H7 sing N N 198 GZ9 N3 H8 sing N N 199 GZ9 C7 H9 sing N N 200 GZ9 C7 H10 sing N N 201 GZ9 C8 H11 sing N N 202 GZ9 C8 H12 sing N N 203 GZ9 C9 H13 sing N N 204 GZ9 C9 H14 sing N N 205 GZ9 C10 H15 sing N N 206 GZ9 C10 H16 sing N N 207 GZ9 C12 H17 sing N N 208 GZ9 C12 H18 sing N N 209 GZ9 C12 H19 sing N N 210 GZ9 C14 H20 sing N N 211 GZ9 C16 H21 sing N N 212 GZ9 C16 H22 sing N N 213 GZ9 C16 H23 sing N N 214 GZ9 C17 H24 sing N N 215 GZ9 C17 H25 sing N N 216 GZ9 C17 H26 sing N N 217 GZ9 C18 H27 sing N N 218 GZ9 C18 H28 sing N N 219 GZ9 C18 H29 sing N N 220 GZ9 O3 H30 sing N N 221 GZ9 C22 H31 sing N N 222 GZ9 C23 H32 sing N N 223 GZ9 C30 H33 sing N N 224 GZ9 C30 H34 sing N N 225 GZ9 C30 H35 sing N N 226 GZ9 C25 H36 sing N N 227 GZ9 C25 H37 sing N N 228 GZ9 C26 H38 sing N N 229 GZ9 C26 H39 sing N N 230 GZ9 C27 H40 sing N N 231 GZ9 C27 H41 sing N N 232 HIS N CA sing N N 233 HIS N H sing N N 234 HIS N H2 sing N N 235 HIS CA C sing N N 236 HIS CA CB sing N N 237 HIS CA HA sing N N 238 HIS C O doub N N 239 HIS C OXT sing N N 240 HIS CB CG sing N N 241 HIS CB HB2 sing N N 242 HIS CB HB3 sing N N 243 HIS CG ND1 sing Y N 244 HIS CG CD2 doub Y N 245 HIS ND1 CE1 doub Y N 246 HIS ND1 HD1 sing N N 247 HIS CD2 NE2 sing Y N 248 HIS CD2 HD2 sing N N 249 HIS CE1 NE2 sing Y N 250 HIS CE1 HE1 sing N N 251 HIS NE2 HE2 sing N N 252 HIS OXT HXT sing N N 253 HOH O H1 sing N N 254 HOH O H2 sing N N 255 ILE N CA sing N N 256 ILE N H sing N N 257 ILE N H2 sing N N 258 ILE CA C sing N N 259 ILE CA CB sing N N 260 ILE CA HA sing N N 261 ILE C O doub N N 262 ILE C OXT sing N N 263 ILE CB CG1 sing N N 264 ILE CB CG2 sing N N 265 ILE CB HB sing N N 266 ILE CG1 CD1 sing N N 267 ILE CG1 HG12 sing N N 268 ILE CG1 HG13 sing N N 269 ILE CG2 HG21 sing N N 270 ILE CG2 HG22 sing N N 271 ILE CG2 HG23 sing N N 272 ILE CD1 HD11 sing N N 273 ILE CD1 HD12 sing N N 274 ILE CD1 HD13 sing N N 275 ILE OXT HXT sing N N 276 LEU N CA sing N N 277 LEU N H sing N N 278 LEU N H2 sing N N 279 LEU CA C sing N N 280 LEU CA CB sing N N 281 LEU CA HA sing N N 282 LEU C O doub N N 283 LEU C OXT sing N N 284 LEU CB CG sing N N 285 LEU CB HB2 sing N N 286 LEU CB HB3 sing N N 287 LEU CG CD1 sing N N 288 LEU CG CD2 sing N N 289 LEU CG HG sing N N 290 LEU CD1 HD11 sing N N 291 LEU CD1 HD12 sing N N 292 LEU CD1 HD13 sing N N 293 LEU CD2 HD21 sing N N 294 LEU CD2 HD22 sing N N 295 LEU CD2 HD23 sing N N 296 LEU OXT HXT sing N N 297 LYS N CA sing N N 298 LYS N H sing N N 299 LYS N H2 sing N N 300 LYS CA C sing N N 301 LYS CA CB sing N N 302 LYS CA HA sing N N 303 LYS C O doub N N 304 LYS C OXT sing N N 305 LYS CB CG sing N N 306 LYS CB HB2 sing N N 307 LYS CB HB3 sing N N 308 LYS CG CD sing N N 309 LYS CG HG2 sing N N 310 LYS CG HG3 sing N N 311 LYS CD CE sing N N 312 LYS CD HD2 sing N N 313 LYS CD HD3 sing N N 314 LYS CE NZ sing N N 315 LYS CE HE2 sing N N 316 LYS CE HE3 sing N N 317 LYS NZ HZ1 sing N N 318 LYS NZ HZ2 sing N N 319 LYS NZ HZ3 sing N N 320 LYS OXT HXT sing N N 321 MET N CA sing N N 322 MET N H sing N N 323 MET N H2 sing N N 324 MET CA C sing N N 325 MET CA CB sing N N 326 MET CA HA sing N N 327 MET C O doub N N 328 MET C OXT sing N N 329 MET CB CG sing N N 330 MET CB HB2 sing N N 331 MET CB HB3 sing N N 332 MET CG SD sing N N 333 MET CG HG2 sing N N 334 MET CG HG3 sing N N 335 MET SD CE sing N N 336 MET CE HE1 sing N N 337 MET CE HE2 sing N N 338 MET CE HE3 sing N N 339 MET OXT HXT sing N N 340 PHE N CA sing N N 341 PHE N H sing N N 342 PHE N H2 sing N N 343 PHE CA C sing N N 344 PHE CA CB sing N N 345 PHE CA HA sing N N 346 PHE C O doub N N 347 PHE C OXT sing N N 348 PHE CB CG sing N N 349 PHE CB HB2 sing N N 350 PHE CB HB3 sing N N 351 PHE CG CD1 doub Y N 352 PHE CG CD2 sing Y N 353 PHE CD1 CE1 sing Y N 354 PHE CD1 HD1 sing N N 355 PHE CD2 CE2 doub Y N 356 PHE CD2 HD2 sing N N 357 PHE CE1 CZ doub Y N 358 PHE CE1 HE1 sing N N 359 PHE CE2 CZ sing Y N 360 PHE CE2 HE2 sing N N 361 PHE CZ HZ sing N N 362 PHE OXT HXT sing N N 363 PRO N CA sing N N 364 PRO N CD sing N N 365 PRO N H sing N N 366 PRO CA C sing N N 367 PRO CA CB sing N N 368 PRO CA HA sing N N 369 PRO C O doub N N 370 PRO C OXT sing N N 371 PRO CB CG sing N N 372 PRO CB HB2 sing N N 373 PRO CB HB3 sing N N 374 PRO CG CD sing N N 375 PRO CG HG2 sing N N 376 PRO CG HG3 sing N N 377 PRO CD HD2 sing N N 378 PRO CD HD3 sing N N 379 PRO OXT HXT sing N N 380 SER N CA sing N N 381 SER N H sing N N 382 SER N H2 sing N N 383 SER CA C sing N N 384 SER CA CB sing N N 385 SER CA HA sing N N 386 SER C O doub N N 387 SER C OXT sing N N 388 SER CB OG sing N N 389 SER CB HB2 sing N N 390 SER CB HB3 sing N N 391 SER OG HG sing N N 392 SER OXT HXT sing N N 393 SO4 S O1 doub N N 394 SO4 S O2 doub N N 395 SO4 S O3 sing N N 396 SO4 S O4 sing N N 397 THR N CA sing N N 398 THR N H sing N N 399 THR N H2 sing N N 400 THR CA C sing N N 401 THR CA CB sing N N 402 THR CA HA sing N N 403 THR C O doub N N 404 THR C OXT sing N N 405 THR CB OG1 sing N N 406 THR CB CG2 sing N N 407 THR CB HB sing N N 408 THR OG1 HG1 sing N N 409 THR CG2 HG21 sing N N 410 THR CG2 HG22 sing N N 411 THR CG2 HG23 sing N N 412 THR OXT HXT sing N N 413 TRP N CA sing N N 414 TRP N H sing N N 415 TRP N H2 sing N N 416 TRP CA C sing N N 417 TRP CA CB sing N N 418 TRP CA HA sing N N 419 TRP C O doub N N 420 TRP C OXT sing N N 421 TRP CB CG sing N N 422 TRP CB HB2 sing N N 423 TRP CB HB3 sing N N 424 TRP CG CD1 doub Y N 425 TRP CG CD2 sing Y N 426 TRP CD1 NE1 sing Y N 427 TRP CD1 HD1 sing N N 428 TRP CD2 CE2 doub Y N 429 TRP CD2 CE3 sing Y N 430 TRP NE1 CE2 sing Y N 431 TRP NE1 HE1 sing N N 432 TRP CE2 CZ2 sing Y N 433 TRP CE3 CZ3 doub Y N 434 TRP CE3 HE3 sing N N 435 TRP CZ2 CH2 doub Y N 436 TRP CZ2 HZ2 sing N N 437 TRP CZ3 CH2 sing Y N 438 TRP CZ3 HZ3 sing N N 439 TRP CH2 HH2 sing N N 440 TRP OXT HXT sing N N 441 TYR N CA sing N N 442 TYR N H sing N N 443 TYR N H2 sing N N 444 TYR CA C sing N N 445 TYR CA CB sing N N 446 TYR CA HA sing N N 447 TYR C O doub N N 448 TYR C OXT sing N N 449 TYR CB CG sing N N 450 TYR CB HB2 sing N N 451 TYR CB HB3 sing N N 452 TYR CG CD1 doub Y N 453 TYR CG CD2 sing Y N 454 TYR CD1 CE1 sing Y N 455 TYR CD1 HD1 sing N N 456 TYR CD2 CE2 doub Y N 457 TYR CD2 HD2 sing N N 458 TYR CE1 CZ doub Y N 459 TYR CE1 HE1 sing N N 460 TYR CE2 CZ sing Y N 461 TYR CE2 HE2 sing N N 462 TYR CZ OH sing N N 463 TYR OH HH sing N N 464 TYR OXT HXT sing N N 465 VAL N CA sing N N 466 VAL N H sing N N 467 VAL N H2 sing N N 468 VAL CA C sing N N 469 VAL CA CB sing N N 470 VAL CA HA sing N N 471 VAL C O doub N N 472 VAL C OXT sing N N 473 VAL CB CG1 sing N N 474 VAL CB CG2 sing N N 475 VAL CB HB sing N N 476 VAL CG1 HG11 sing N N 477 VAL CG1 HG12 sing N N 478 VAL CG1 HG13 sing N N 479 VAL CG2 HG21 sing N N 480 VAL CG2 HG22 sing N N 481 VAL CG2 HG23 sing N N 482 VAL OXT HXT sing N N 483 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 ;(2S)-2-[2-(cyclohexylcarbamoylamino)-3,6-dimethyl-5-(5-methyl-3,4-dihydro-2H-chromen-6-yl)pyridin-4-yl]-2-[(2-methylpropan-2-yl)oxy]ethanoic acid ; GZ9 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6LMQ _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'assay for oligomerization' _pdbx_struct_assembly_auth_evidence.details ? #