data_7DMF # _entry.id 7DMF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7DMF pdb_00007dmf 10.2210/pdb7dmf/pdb WWPDB D_1300019705 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7DMF _pdbx_database_status.recvd_initial_deposition_date 2020-12-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _audit_author.name 'Xu, Y.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID 0000-0003-3335-3278 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Nature _citation.journal_id_ASTM NATUAS _citation.journal_id_CSD 0006 _citation.journal_id_ISSN 1476-4687 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 602 _citation.language ? _citation.page_first 523 _citation.page_last 528 _citation.title 'A backbone-centred energy function of neural networks for protein design.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41586-021-04383-5 _citation.pdbx_database_id_PubMed 35140398 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Huang, B.' 1 ? primary 'Xu, Y.' 2 ? primary 'Hu, X.' 3 ? primary 'Liu, Y.' 4 ? primary 'Liao, S.' 5 ? primary 'Zhang, J.' 6 ? primary 'Huang, C.' 7 ? primary 'Hong, J.' 8 ? primary 'Chen, Q.' 9 ? primary 'Liu, H.' 10 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7DMF _cell.details ? _cell.formula_units_Z ? _cell.length_a 69.727 _cell.length_a_esd ? _cell.length_b 69.727 _cell.length_b_esd ? _cell.length_c 79.291 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7DMF _symmetry.cell_setting ? _symmetry.Int_Tables_number 170 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Designed protein EXTD-3' 21189.744 1 ? ? ? ? 2 water nat water 18.015 5 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;DCQQELSLVQTVTRGSRAFLSREEAQHFVKECGLLNCEAVLELLICHLRLGMEIMKLGRQLREAVRANDVDAMLKIAKEI IKVIGETGLDEVYRQLLKAAKEFLERRAENFSHEEAVAFAQQIIQLIKQVECVQMRALGAVASLGCTDLLPQEHILLLTR PRLQELSAGSPGPVTNKATKILRHFEASC ; _entity_poly.pdbx_seq_one_letter_code_can ;DCQQELSLVQTVTRGSRAFLSREEAQHFVKECGLLNCEAVLELLICHLRLGMEIMKLGRQLREAVRANDVDAMLKIAKEI IKVIGETGLDEVYRQLLKAAKEFLERRAENFSHEEAVAFAQQIIQLIKQVECVQMRALGAVASLGCTDLLPQEHILLLTR PRLQELSAGSPGPVTNKATKILRHFEASC ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 CYS n 1 3 GLN n 1 4 GLN n 1 5 GLU n 1 6 LEU n 1 7 SER n 1 8 LEU n 1 9 VAL n 1 10 GLN n 1 11 THR n 1 12 VAL n 1 13 THR n 1 14 ARG n 1 15 GLY n 1 16 SER n 1 17 ARG n 1 18 ALA n 1 19 PHE n 1 20 LEU n 1 21 SER n 1 22 ARG n 1 23 GLU n 1 24 GLU n 1 25 ALA n 1 26 GLN n 1 27 HIS n 1 28 PHE n 1 29 VAL n 1 30 LYS n 1 31 GLU n 1 32 CYS n 1 33 GLY n 1 34 LEU n 1 35 LEU n 1 36 ASN n 1 37 CYS n 1 38 GLU n 1 39 ALA n 1 40 VAL n 1 41 LEU n 1 42 GLU n 1 43 LEU n 1 44 LEU n 1 45 ILE n 1 46 CYS n 1 47 HIS n 1 48 LEU n 1 49 ARG n 1 50 LEU n 1 51 GLY n 1 52 MET n 1 53 GLU n 1 54 ILE n 1 55 MET n 1 56 LYS n 1 57 LEU n 1 58 GLY n 1 59 ARG n 1 60 GLN n 1 61 LEU n 1 62 ARG n 1 63 GLU n 1 64 ALA n 1 65 VAL n 1 66 ARG n 1 67 ALA n 1 68 ASN n 1 69 ASP n 1 70 VAL n 1 71 ASP n 1 72 ALA n 1 73 MET n 1 74 LEU n 1 75 LYS n 1 76 ILE n 1 77 ALA n 1 78 LYS n 1 79 GLU n 1 80 ILE n 1 81 ILE n 1 82 LYS n 1 83 VAL n 1 84 ILE n 1 85 GLY n 1 86 GLU n 1 87 THR n 1 88 GLY n 1 89 LEU n 1 90 ASP n 1 91 GLU n 1 92 VAL n 1 93 TYR n 1 94 ARG n 1 95 GLN n 1 96 LEU n 1 97 LEU n 1 98 LYS n 1 99 ALA n 1 100 ALA n 1 101 LYS n 1 102 GLU n 1 103 PHE n 1 104 LEU n 1 105 GLU n 1 106 ARG n 1 107 ARG n 1 108 ALA n 1 109 GLU n 1 110 ASN n 1 111 PHE n 1 112 SER n 1 113 HIS n 1 114 GLU n 1 115 GLU n 1 116 ALA n 1 117 VAL n 1 118 ALA n 1 119 PHE n 1 120 ALA n 1 121 GLN n 1 122 GLN n 1 123 ILE n 1 124 ILE n 1 125 GLN n 1 126 LEU n 1 127 ILE n 1 128 LYS n 1 129 GLN n 1 130 VAL n 1 131 GLU n 1 132 CYS n 1 133 VAL n 1 134 GLN n 1 135 MET n 1 136 ARG n 1 137 ALA n 1 138 LEU n 1 139 GLY n 1 140 ALA n 1 141 VAL n 1 142 ALA n 1 143 SER n 1 144 LEU n 1 145 GLY n 1 146 CYS n 1 147 THR n 1 148 ASP n 1 149 LEU n 1 150 LEU n 1 151 PRO n 1 152 GLN n 1 153 GLU n 1 154 HIS n 1 155 ILE n 1 156 LEU n 1 157 LEU n 1 158 LEU n 1 159 THR n 1 160 ARG n 1 161 PRO n 1 162 ARG n 1 163 LEU n 1 164 GLN n 1 165 GLU n 1 166 LEU n 1 167 SER n 1 168 ALA n 1 169 GLY n 1 170 SER n 1 171 PRO n 1 172 GLY n 1 173 PRO n 1 174 VAL n 1 175 THR n 1 176 ASN n 1 177 LYS n 1 178 ALA n 1 179 THR n 1 180 LYS n 1 181 ILE n 1 182 LEU n 1 183 ARG n 1 184 HIS n 1 185 PHE n 1 186 GLU n 1 187 ALA n 1 188 SER n 1 189 CYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 189 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli K-12' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 83333 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 7DMF _struct_ref.pdbx_db_accession 7DMF _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7DMF _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 189 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 7DMF _struct_ref_seq.db_align_beg 6 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 194 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 6 _struct_ref_seq.pdbx_auth_seq_align_end 194 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7DMF _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.63 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 53.16 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '20% w/v Polyethylene glycol 3350, pH 7.0, 0.2M Potassium Chloride' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-10-17 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97892 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL19U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97892 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL19U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7DMF _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.200 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11185 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 19.600 _reflns.pdbx_Rmerge_I_obs 0.136 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 4.100 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.985 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.140 _reflns.pdbx_Rpim_I_all 0.031 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 218738 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 2.200 2.240 ? ? ? ? ? ? 545 100.000 ? ? ? ? 0.566 ? ? ? ? ? ? ? ? 17.200 ? 0.991 ? ? 0.584 0.140 ? 1 1 0.943 ? ? 2.240 2.280 ? ? ? ? ? ? 548 100.000 ? ? ? ? 0.565 ? ? ? ? ? ? ? ? 17.500 ? 1.121 ? ? 0.582 0.139 ? 2 1 0.943 ? ? 2.280 2.320 ? ? ? ? ? ? 566 100.000 ? ? ? ? 0.429 ? ? ? ? ? ? ? ? 18.200 ? 0.976 ? ? 0.442 0.103 ? 3 1 0.954 ? ? 2.320 2.370 ? ? ? ? ? ? 554 100.000 ? ? ? ? 0.411 ? ? ? ? ? ? ? ? 18.600 ? 1.014 ? ? 0.422 0.097 ? 4 1 0.967 ? ? 2.370 2.420 ? ? ? ? ? ? 549 100.000 ? ? ? ? 0.385 ? ? ? ? ? ? ? ? 18.600 ? 0.948 ? ? 0.396 0.092 ? 5 1 0.976 ? ? 2.420 2.480 ? ? ? ? ? ? 568 100.000 ? ? ? ? 0.342 ? ? ? ? ? ? ? ? 18.200 ? 0.983 ? ? 0.352 0.082 ? 6 1 0.975 ? ? 2.480 2.540 ? ? ? ? ? ? 546 100.000 ? ? ? ? 0.325 ? ? ? ? ? ? ? ? 19.000 ? 0.957 ? ? 0.334 0.076 ? 7 1 0.978 ? ? 2.540 2.610 ? ? ? ? ? ? 554 100.000 ? ? ? ? 0.320 ? ? ? ? ? ? ? ? 20.800 ? 0.970 ? ? 0.328 0.072 ? 8 1 0.979 ? ? 2.610 2.690 ? ? ? ? ? ? 567 100.000 ? ? ? ? 0.294 ? ? ? ? ? ? ? ? 20.800 ? 1.078 ? ? 0.302 0.066 ? 9 1 0.987 ? ? 2.690 2.770 ? ? ? ? ? ? 554 100.000 ? ? ? ? 0.245 ? ? ? ? ? ? ? ? 20.900 ? 0.982 ? ? 0.251 0.055 ? 10 1 0.990 ? ? 2.770 2.870 ? ? ? ? ? ? 549 100.000 ? ? ? ? 0.237 ? ? ? ? ? ? ? ? 20.700 ? 0.991 ? ? 0.243 0.053 ? 11 1 0.987 ? ? 2.870 2.990 ? ? ? ? ? ? 559 100.000 ? ? ? ? 0.196 ? ? ? ? ? ? ? ? 20.500 ? 0.972 ? ? 0.201 0.045 ? 12 1 0.993 ? ? 2.990 3.120 ? ? ? ? ? ? 556 100.000 ? ? ? ? 0.168 ? ? ? ? ? ? ? ? 20.000 ? 1.006 ? ? 0.172 0.038 ? 13 1 0.994 ? ? 3.120 3.290 ? ? ? ? ? ? 572 100.000 ? ? ? ? 0.145 ? ? ? ? ? ? ? ? 18.600 ? 1.009 ? ? 0.149 0.034 ? 14 1 0.996 ? ? 3.290 3.490 ? ? ? ? ? ? 571 100.000 ? ? ? ? 0.123 ? ? ? ? ? ? ? ? 21.000 ? 1.070 ? ? 0.126 0.027 ? 15 1 0.997 ? ? 3.490 3.760 ? ? ? ? ? ? 548 100.000 ? ? ? ? 0.109 ? ? ? ? ? ? ? ? 21.300 ? 1.055 ? ? 0.112 0.024 ? 16 1 0.997 ? ? 3.760 4.140 ? ? ? ? ? ? 560 100.000 ? ? ? ? 0.094 ? ? ? ? ? ? ? ? 20.700 ? 1.038 ? ? 0.096 0.021 ? 17 1 0.998 ? ? 4.140 4.740 ? ? ? ? ? ? 560 100.000 ? ? ? ? 0.078 ? ? ? ? ? ? ? ? 18.800 ? 0.914 ? ? 0.080 0.018 ? 18 1 0.998 ? ? 4.740 5.970 ? ? ? ? ? ? 569 100.000 ? ? ? ? 0.084 ? ? ? ? ? ? ? ? 20.500 ? 0.868 ? ? 0.086 0.019 ? 19 1 0.996 ? ? 5.970 50.000 ? ? ? ? ? ? 590 99.800 ? ? ? ? 0.058 ? ? ? ? ? ? ? ? 19.100 ? 0.761 ? ? 0.059 0.014 ? 20 1 0.998 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 110.090 _refine.B_iso_mean 44.7049 _refine.B_iso_min 13.850 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7DMF _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.2010 _refine.ls_d_res_low 26.1810 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8396 _refine.ls_number_reflns_R_free 823 _refine.ls_number_reflns_R_work 7573 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 75.2900 _refine.ls_percent_reflns_R_free 9.8000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2357 _refine.ls_R_factor_R_free 0.2686 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2319 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.430 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5wf2 _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 27.1400 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3000 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.2010 _refine_hist.d_res_low 26.1810 _refine_hist.number_atoms_solvent 5 _refine_hist.number_atoms_total 1483 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 189 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent 17.72 _refine_hist.pdbx_number_atoms_protein 1478 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.2010 2.3385 . . 97 1081 64.0000 . . . 0.2986 0.0000 0.2398 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3385 2.5190 . . 126 1092 66.0000 . . . 0.3286 0.0000 0.2403 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5190 2.7722 . . 115 1178 70.0000 . . . 0.2754 0.0000 0.2350 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7722 3.1728 . . 150 1293 78.0000 . . . 0.2637 0.0000 0.2443 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1728 3.9951 . . 140 1530 90.0000 . . . 0.3046 0.0000 0.2429 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.9951 26.1810 . . 195 1399 84.0000 . . . 0.2348 0.0000 0.2118 . . . . . . . . . . . # _struct.entry_id 7DMF _struct.title 'A de novo protein that rigidly extends the structure of tVHS-like domain in tepsin with a new designed domain' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7DMF _struct_keywords.text 'all helix, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 1 ? THR A 13 ? ASP A 6 THR A 18 1 ? 13 HELX_P HELX_P2 AA2 SER A 21 ? LEU A 35 ? SER A 26 LEU A 40 1 ? 15 HELX_P HELX_P3 AA3 ASN A 36 ? ASN A 68 ? ASN A 41 ASN A 73 1 ? 33 HELX_P HELX_P4 AA4 ASP A 69 ? THR A 87 ? ASP A 74 THR A 92 1 ? 19 HELX_P HELX_P5 AA5 TYR A 93 ? ARG A 106 ? TYR A 98 ARG A 111 1 ? 14 HELX_P HELX_P6 AA6 ARG A 107 ? GLU A 109 ? ARG A 112 GLU A 114 5 ? 3 HELX_P HELX_P7 AA7 SER A 112 ? CYS A 146 ? SER A 117 CYS A 151 1 ? 35 HELX_P HELX_P8 AA8 PRO A 151 ? ALA A 168 ? PRO A 156 ALA A 173 1 ? 18 HELX_P HELX_P9 AA9 GLY A 172 ? CYS A 189 ? GLY A 177 CYS A 194 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 7DMF _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.014342 _atom_sites.fract_transf_matrix[1][2] 0.008280 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016560 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012612 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 6 6 ASP ASP A . n A 1 2 CYS 2 7 7 CYS CYS A . n A 1 3 GLN 3 8 8 GLN GLN A . n A 1 4 GLN 4 9 9 GLN GLN A . n A 1 5 GLU 5 10 10 GLU GLU A . n A 1 6 LEU 6 11 11 LEU LEU A . n A 1 7 SER 7 12 12 SER SER A . n A 1 8 LEU 8 13 13 LEU LEU A . n A 1 9 VAL 9 14 14 VAL VAL A . n A 1 10 GLN 10 15 15 GLN GLN A . n A 1 11 THR 11 16 16 THR THR A . n A 1 12 VAL 12 17 17 VAL VAL A . n A 1 13 THR 13 18 18 THR THR A . n A 1 14 ARG 14 19 19 ARG ARG A . n A 1 15 GLY 15 20 20 GLY GLY A . n A 1 16 SER 16 21 21 SER SER A . n A 1 17 ARG 17 22 22 ARG ARG A . n A 1 18 ALA 18 23 23 ALA ALA A . n A 1 19 PHE 19 24 24 PHE PHE A . n A 1 20 LEU 20 25 25 LEU LEU A . n A 1 21 SER 21 26 26 SER SER A . n A 1 22 ARG 22 27 27 ARG ARG A . n A 1 23 GLU 23 28 28 GLU GLU A . n A 1 24 GLU 24 29 29 GLU GLU A . n A 1 25 ALA 25 30 30 ALA ALA A . n A 1 26 GLN 26 31 31 GLN GLN A . n A 1 27 HIS 27 32 32 HIS HIS A . n A 1 28 PHE 28 33 33 PHE PHE A . n A 1 29 VAL 29 34 34 VAL VAL A . n A 1 30 LYS 30 35 35 LYS LYS A . n A 1 31 GLU 31 36 36 GLU GLU A . n A 1 32 CYS 32 37 37 CYS CYS A . n A 1 33 GLY 33 38 38 GLY GLY A . n A 1 34 LEU 34 39 39 LEU LEU A . n A 1 35 LEU 35 40 40 LEU LEU A . n A 1 36 ASN 36 41 41 ASN ASN A . n A 1 37 CYS 37 42 42 CYS CYS A . n A 1 38 GLU 38 43 43 GLU GLU A . n A 1 39 ALA 39 44 44 ALA ALA A . n A 1 40 VAL 40 45 45 VAL VAL A . n A 1 41 LEU 41 46 46 LEU LEU A . n A 1 42 GLU 42 47 47 GLU GLU A . n A 1 43 LEU 43 48 48 LEU LEU A . n A 1 44 LEU 44 49 49 LEU LEU A . n A 1 45 ILE 45 50 50 ILE ILE A . n A 1 46 CYS 46 51 51 CYS CYS A . n A 1 47 HIS 47 52 52 HIS HIS A . n A 1 48 LEU 48 53 53 LEU LEU A . n A 1 49 ARG 49 54 54 ARG ARG A . n A 1 50 LEU 50 55 55 LEU LEU A . n A 1 51 GLY 51 56 56 GLY GLY A . n A 1 52 MET 52 57 57 MET MET A . n A 1 53 GLU 53 58 58 GLU GLU A . n A 1 54 ILE 54 59 59 ILE ILE A . n A 1 55 MET 55 60 60 MET MET A . n A 1 56 LYS 56 61 61 LYS LYS A . n A 1 57 LEU 57 62 62 LEU LEU A . n A 1 58 GLY 58 63 63 GLY GLY A . n A 1 59 ARG 59 64 64 ARG ARG A . n A 1 60 GLN 60 65 65 GLN GLN A . n A 1 61 LEU 61 66 66 LEU LEU A . n A 1 62 ARG 62 67 67 ARG ARG A . n A 1 63 GLU 63 68 68 GLU GLU A . n A 1 64 ALA 64 69 69 ALA ALA A . n A 1 65 VAL 65 70 70 VAL VAL A . n A 1 66 ARG 66 71 71 ARG ARG A . n A 1 67 ALA 67 72 72 ALA ALA A . n A 1 68 ASN 68 73 73 ASN ASN A . n A 1 69 ASP 69 74 74 ASP ASP A . n A 1 70 VAL 70 75 75 VAL VAL A . n A 1 71 ASP 71 76 76 ASP ASP A . n A 1 72 ALA 72 77 77 ALA ALA A . n A 1 73 MET 73 78 78 MET MET A . n A 1 74 LEU 74 79 79 LEU LEU A . n A 1 75 LYS 75 80 80 LYS LYS A . n A 1 76 ILE 76 81 81 ILE ILE A . n A 1 77 ALA 77 82 82 ALA ALA A . n A 1 78 LYS 78 83 83 LYS LYS A . n A 1 79 GLU 79 84 84 GLU GLU A . n A 1 80 ILE 80 85 85 ILE ILE A . n A 1 81 ILE 81 86 86 ILE ILE A . n A 1 82 LYS 82 87 87 LYS LYS A . n A 1 83 VAL 83 88 88 VAL VAL A . n A 1 84 ILE 84 89 89 ILE ILE A . n A 1 85 GLY 85 90 90 GLY GLY A . n A 1 86 GLU 86 91 91 GLU GLU A . n A 1 87 THR 87 92 92 THR THR A . n A 1 88 GLY 88 93 93 GLY GLY A . n A 1 89 LEU 89 94 94 LEU LEU A . n A 1 90 ASP 90 95 95 ASP ASP A . n A 1 91 GLU 91 96 96 GLU GLU A . n A 1 92 VAL 92 97 97 VAL VAL A . n A 1 93 TYR 93 98 98 TYR TYR A . n A 1 94 ARG 94 99 99 ARG ARG A . n A 1 95 GLN 95 100 100 GLN GLN A . n A 1 96 LEU 96 101 101 LEU LEU A . n A 1 97 LEU 97 102 102 LEU LEU A . n A 1 98 LYS 98 103 103 LYS LYS A . n A 1 99 ALA 99 104 104 ALA ALA A . n A 1 100 ALA 100 105 105 ALA ALA A . n A 1 101 LYS 101 106 106 LYS LYS A . n A 1 102 GLU 102 107 107 GLU GLU A . n A 1 103 PHE 103 108 108 PHE PHE A . n A 1 104 LEU 104 109 109 LEU LEU A . n A 1 105 GLU 105 110 110 GLU GLU A . n A 1 106 ARG 106 111 111 ARG ARG A . n A 1 107 ARG 107 112 112 ARG ARG A . n A 1 108 ALA 108 113 113 ALA ALA A . n A 1 109 GLU 109 114 114 GLU GLU A . n A 1 110 ASN 110 115 115 ASN ASN A . n A 1 111 PHE 111 116 116 PHE PHE A . n A 1 112 SER 112 117 117 SER SER A . n A 1 113 HIS 113 118 118 HIS HIS A . n A 1 114 GLU 114 119 119 GLU GLU A . n A 1 115 GLU 115 120 120 GLU GLU A . n A 1 116 ALA 116 121 121 ALA ALA A . n A 1 117 VAL 117 122 122 VAL VAL A . n A 1 118 ALA 118 123 123 ALA ALA A . n A 1 119 PHE 119 124 124 PHE PHE A . n A 1 120 ALA 120 125 125 ALA ALA A . n A 1 121 GLN 121 126 126 GLN GLN A . n A 1 122 GLN 122 127 127 GLN GLN A . n A 1 123 ILE 123 128 128 ILE ILE A . n A 1 124 ILE 124 129 129 ILE ILE A . n A 1 125 GLN 125 130 130 GLN GLN A . n A 1 126 LEU 126 131 131 LEU LEU A . n A 1 127 ILE 127 132 132 ILE ILE A . n A 1 128 LYS 128 133 133 LYS LYS A . n A 1 129 GLN 129 134 134 GLN GLN A . n A 1 130 VAL 130 135 135 VAL VAL A . n A 1 131 GLU 131 136 136 GLU GLU A . n A 1 132 CYS 132 137 137 CYS CYS A . n A 1 133 VAL 133 138 138 VAL VAL A . n A 1 134 GLN 134 139 139 GLN GLN A . n A 1 135 MET 135 140 140 MET MET A . n A 1 136 ARG 136 141 141 ARG ARG A . n A 1 137 ALA 137 142 142 ALA ALA A . n A 1 138 LEU 138 143 143 LEU LEU A . n A 1 139 GLY 139 144 144 GLY GLY A . n A 1 140 ALA 140 145 145 ALA ALA A . n A 1 141 VAL 141 146 146 VAL VAL A . n A 1 142 ALA 142 147 147 ALA ALA A . n A 1 143 SER 143 148 148 SER SER A . n A 1 144 LEU 144 149 149 LEU LEU A . n A 1 145 GLY 145 150 150 GLY GLY A . n A 1 146 CYS 146 151 151 CYS CYS A . n A 1 147 THR 147 152 152 THR THR A . n A 1 148 ASP 148 153 153 ASP ASP A . n A 1 149 LEU 149 154 154 LEU LEU A . n A 1 150 LEU 150 155 155 LEU LEU A . n A 1 151 PRO 151 156 156 PRO PRO A . n A 1 152 GLN 152 157 157 GLN GLN A . n A 1 153 GLU 153 158 158 GLU GLU A . n A 1 154 HIS 154 159 159 HIS HIS A . n A 1 155 ILE 155 160 160 ILE ILE A . n A 1 156 LEU 156 161 161 LEU LEU A . n A 1 157 LEU 157 162 162 LEU LEU A . n A 1 158 LEU 158 163 163 LEU LEU A . n A 1 159 THR 159 164 164 THR THR A . n A 1 160 ARG 160 165 165 ARG ARG A . n A 1 161 PRO 161 166 166 PRO PRO A . n A 1 162 ARG 162 167 167 ARG ARG A . n A 1 163 LEU 163 168 168 LEU LEU A . n A 1 164 GLN 164 169 169 GLN GLN A . n A 1 165 GLU 165 170 170 GLU GLU A . n A 1 166 LEU 166 171 171 LEU LEU A . n A 1 167 SER 167 172 172 SER SER A . n A 1 168 ALA 168 173 173 ALA ALA A . n A 1 169 GLY 169 174 174 GLY GLY A . n A 1 170 SER 170 175 175 SER SER A . n A 1 171 PRO 171 176 176 PRO PRO A . n A 1 172 GLY 172 177 177 GLY GLY A . n A 1 173 PRO 173 178 178 PRO PRO A . n A 1 174 VAL 174 179 179 VAL VAL A . n A 1 175 THR 175 180 180 THR THR A . n A 1 176 ASN 176 181 181 ASN ASN A . n A 1 177 LYS 177 182 182 LYS LYS A . n A 1 178 ALA 178 183 183 ALA ALA A . n A 1 179 THR 179 184 184 THR THR A . n A 1 180 LYS 180 185 185 LYS LYS A . n A 1 181 ILE 181 186 186 ILE ILE A . n A 1 182 LEU 182 187 187 LEU LEU A . n A 1 183 ARG 183 188 188 ARG ARG A . n A 1 184 HIS 184 189 189 HIS HIS A . n A 1 185 PHE 185 190 190 PHE PHE A . n A 1 186 GLU 186 191 191 GLU GLU A . n A 1 187 ALA 187 192 192 ALA ALA A . n A 1 188 SER 188 193 193 SER SER A . n A 1 189 CYS 189 194 194 CYS CYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 201 6 HOH HOH A . B 2 HOH 2 202 5 HOH HOH A . B 2 HOH 3 203 4 HOH HOH A . B 2 HOH 4 204 1 HOH HOH A . B 2 HOH 5 205 2 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-12-08 2 'Structure model' 1 1 2022-02-16 3 'Structure model' 1 2 2022-02-23 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2022-03-09 6 'Structure model' 1 5 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Structure summary' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Structure summary' 5 4 'Structure model' 'Database references' 6 5 'Structure model' 'Refinement description' 7 6 'Structure model' 'Data collection' 8 6 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' audit_author 2 2 'Structure model' citation 3 2 'Structure model' citation_author 4 3 'Structure model' citation 5 3 'Structure model' citation_author 6 3 'Structure model' entity 7 4 'Structure model' citation 8 4 'Structure model' citation_author 9 5 'Structure model' software 10 6 'Structure model' chem_comp_atom 11 6 'Structure model' chem_comp_bond 12 6 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_audit_author.name' 2 2 'Structure model' '_citation.country' 3 2 'Structure model' '_citation.journal_abbrev' 4 2 'Structure model' '_citation.journal_id_ASTM' 5 2 'Structure model' '_citation.journal_id_CSD' 6 2 'Structure model' '_citation.journal_id_ISSN' 7 2 'Structure model' '_citation.pdbx_database_id_DOI' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 3 'Structure model' '_citation.pdbx_database_id_PubMed' 11 3 'Structure model' '_citation.title' 12 3 'Structure model' '_citation_author.identifier_ORCID' 13 3 'Structure model' '_entity.pdbx_description' 14 4 'Structure model' '_citation.journal_volume' 15 4 'Structure model' '_citation.page_first' 16 4 'Structure model' '_citation.page_last' 17 4 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 14.4114 _pdbx_refine_tls.origin_y -25.9500 _pdbx_refine_tls.origin_z 3.0185 _pdbx_refine_tls.T[1][1] 0.2657 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] -0.0332 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] 0.0082 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.2198 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.0117 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.2218 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 1.8771 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -0.4956 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 0.6413 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 0.6128 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] -0.3737 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 0.8363 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.1169 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.0478 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] -0.1763 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] 0.0396 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.0374 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] -0.0162 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] 0.0968 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] 0.0691 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] -0.0864 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 6 _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 194 _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details ;(chain 'A' and resid 6 through 194) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.16_3549 2 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 40 ? ? -116.65 -163.77 2 1 LEU A 94 ? ? -78.99 -163.30 3 1 ASP A 95 ? ? -166.24 39.29 4 1 TYR A 98 ? ? 81.08 16.30 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TYR N N N N 321 TYR CA C N S 322 TYR C C N N 323 TYR O O N N 324 TYR CB C N N 325 TYR CG C Y N 326 TYR CD1 C Y N 327 TYR CD2 C Y N 328 TYR CE1 C Y N 329 TYR CE2 C Y N 330 TYR CZ C Y N 331 TYR OH O N N 332 TYR OXT O N N 333 TYR H H N N 334 TYR H2 H N N 335 TYR HA H N N 336 TYR HB2 H N N 337 TYR HB3 H N N 338 TYR HD1 H N N 339 TYR HD2 H N N 340 TYR HE1 H N N 341 TYR HE2 H N N 342 TYR HH H N N 343 TYR HXT H N N 344 VAL N N N N 345 VAL CA C N S 346 VAL C C N N 347 VAL O O N N 348 VAL CB C N N 349 VAL CG1 C N N 350 VAL CG2 C N N 351 VAL OXT O N N 352 VAL H H N N 353 VAL H2 H N N 354 VAL HA H N N 355 VAL HB H N N 356 VAL HG11 H N N 357 VAL HG12 H N N 358 VAL HG13 H N N 359 VAL HG21 H N N 360 VAL HG22 H N N 361 VAL HG23 H N N 362 VAL HXT H N N 363 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TYR N CA sing N N 306 TYR N H sing N N 307 TYR N H2 sing N N 308 TYR CA C sing N N 309 TYR CA CB sing N N 310 TYR CA HA sing N N 311 TYR C O doub N N 312 TYR C OXT sing N N 313 TYR CB CG sing N N 314 TYR CB HB2 sing N N 315 TYR CB HB3 sing N N 316 TYR CG CD1 doub Y N 317 TYR CG CD2 sing Y N 318 TYR CD1 CE1 sing Y N 319 TYR CD1 HD1 sing N N 320 TYR CD2 CE2 doub Y N 321 TYR CD2 HD2 sing N N 322 TYR CE1 CZ doub Y N 323 TYR CE1 HE1 sing N N 324 TYR CE2 CZ sing Y N 325 TYR CE2 HE2 sing N N 326 TYR CZ OH sing N N 327 TYR OH HH sing N N 328 TYR OXT HXT sing N N 329 VAL N CA sing N N 330 VAL N H sing N N 331 VAL N H2 sing N N 332 VAL CA C sing N N 333 VAL CA CB sing N N 334 VAL CA HA sing N N 335 VAL C O doub N N 336 VAL C OXT sing N N 337 VAL CB CG1 sing N N 338 VAL CB CG2 sing N N 339 VAL CB HB sing N N 340 VAL CG1 HG11 sing N N 341 VAL CG1 HG12 sing N N 342 VAL CG1 HG13 sing N N 343 VAL CG2 HG21 sing N N 344 VAL CG2 HG22 sing N N 345 VAL CG2 HG23 sing N N 346 VAL OXT HXT sing N N 347 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5WF2 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #