data_7DQQ # _entry.id 7DQQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7DQQ pdb_00007dqq 10.2210/pdb7dqq/pdb WWPDB D_1300019548 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7DQQ _pdbx_database_status.recvd_initial_deposition_date 2020-12-24 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kikuchi, M.' 1 0000-0001-8809-7262 'Yamauchi, T.' 2 0000-0001-6013-6346 'Iizuka, Y.' 3 0000-0003-2456-1147 'Tsunoda, M.' 4 0000-0002-3128-7695 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acta Crystallogr.,Sect.F' _citation.journal_id_ASTM ACSFEN _citation.journal_id_CSD ? _citation.journal_id_ISSN 2053-230X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 77 _citation.language ? _citation.page_first 444 _citation.page_last 451 _citation.title 'Roles of the hydroxy group of tyrosine in crystal structures of Sulfurisphaera tokodaii O6-methylguanine-DNA methyltransferase.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1107/S2053230X21011055 _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kikuchi, M.' 1 0000-0001-8809-7262 primary 'Yamauchi, T.' 2 0000-0001-6013-6346 primary 'Iizuka, Y.' 3 0000-0003-2456-1147 primary 'Tsunoda, M.' 4 0000-0002-3128-7695 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7DQQ _cell.details ? _cell.formula_units_Z ? _cell.length_a 48.473 _cell.length_a_esd ? _cell.length_b 53.166 _cell.length_b_esd ? _cell.length_c 62.085 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7DQQ _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Methylated-DNA--protein-cysteine methyltransferase' 17944.887 1 2.1.1.63 'Y91F, C120S' ? ? 2 non-polymer syn '(2~{R},3~{S},5~{R})-5-(2-azanyl-6-methoxy-purin-9-yl)-2-(hydroxymethyl)oxolan-3-ol' 281.268 1 ? ? ? ? 3 water nat water 18.015 41 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name '6-O-methylguanine-DNA methyltransferase,MGMT,O-6-methylguanine-DNA-alkyltransferase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MIVYGLYKSPFGPITVAKNEKGFVMLDFCDCAERSSLDNDYFTDFFYKLDLYFEGKKVDLTEPVDFKPFNEFRIRVFKEV MRIKWGEVRTFKQVADAVKTSPRAVGTALSKNNVLLIIPSHRVIGEKSLGGYSRGVELKRKLLELEGIDVAKFIEK ; _entity_poly.pdbx_seq_one_letter_code_can ;MIVYGLYKSPFGPITVAKNEKGFVMLDFCDCAERSSLDNDYFTDFFYKLDLYFEGKKVDLTEPVDFKPFNEFRIRVFKEV MRIKWGEVRTFKQVADAVKTSPRAVGTALSKNNVLLIIPSHRVIGEKSLGGYSRGVELKRKLLELEGIDVAKFIEK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ILE n 1 3 VAL n 1 4 TYR n 1 5 GLY n 1 6 LEU n 1 7 TYR n 1 8 LYS n 1 9 SER n 1 10 PRO n 1 11 PHE n 1 12 GLY n 1 13 PRO n 1 14 ILE n 1 15 THR n 1 16 VAL n 1 17 ALA n 1 18 LYS n 1 19 ASN n 1 20 GLU n 1 21 LYS n 1 22 GLY n 1 23 PHE n 1 24 VAL n 1 25 MET n 1 26 LEU n 1 27 ASP n 1 28 PHE n 1 29 CYS n 1 30 ASP n 1 31 CYS n 1 32 ALA n 1 33 GLU n 1 34 ARG n 1 35 SER n 1 36 SER n 1 37 LEU n 1 38 ASP n 1 39 ASN n 1 40 ASP n 1 41 TYR n 1 42 PHE n 1 43 THR n 1 44 ASP n 1 45 PHE n 1 46 PHE n 1 47 TYR n 1 48 LYS n 1 49 LEU n 1 50 ASP n 1 51 LEU n 1 52 TYR n 1 53 PHE n 1 54 GLU n 1 55 GLY n 1 56 LYS n 1 57 LYS n 1 58 VAL n 1 59 ASP n 1 60 LEU n 1 61 THR n 1 62 GLU n 1 63 PRO n 1 64 VAL n 1 65 ASP n 1 66 PHE n 1 67 LYS n 1 68 PRO n 1 69 PHE n 1 70 ASN n 1 71 GLU n 1 72 PHE n 1 73 ARG n 1 74 ILE n 1 75 ARG n 1 76 VAL n 1 77 PHE n 1 78 LYS n 1 79 GLU n 1 80 VAL n 1 81 MET n 1 82 ARG n 1 83 ILE n 1 84 LYS n 1 85 TRP n 1 86 GLY n 1 87 GLU n 1 88 VAL n 1 89 ARG n 1 90 THR n 1 91 PHE n 1 92 LYS n 1 93 GLN n 1 94 VAL n 1 95 ALA n 1 96 ASP n 1 97 ALA n 1 98 VAL n 1 99 LYS n 1 100 THR n 1 101 SER n 1 102 PRO n 1 103 ARG n 1 104 ALA n 1 105 VAL n 1 106 GLY n 1 107 THR n 1 108 ALA n 1 109 LEU n 1 110 SER n 1 111 LYS n 1 112 ASN n 1 113 ASN n 1 114 VAL n 1 115 LEU n 1 116 LEU n 1 117 ILE n 1 118 ILE n 1 119 PRO n 1 120 SER n 1 121 HIS n 1 122 ARG n 1 123 VAL n 1 124 ILE n 1 125 GLY n 1 126 GLU n 1 127 LYS n 1 128 SER n 1 129 LEU n 1 130 GLY n 1 131 GLY n 1 132 TYR n 1 133 SER n 1 134 ARG n 1 135 GLY n 1 136 VAL n 1 137 GLU n 1 138 LEU n 1 139 LYS n 1 140 ARG n 1 141 LYS n 1 142 LEU n 1 143 LEU n 1 144 GLU n 1 145 LEU n 1 146 GLU n 1 147 GLY n 1 148 ILE n 1 149 ASP n 1 150 VAL n 1 151 ALA n 1 152 LYS n 1 153 PHE n 1 154 ILE n 1 155 GLU n 1 156 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 156 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ogt, STK_09670' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'DSM 16993 / JCM 10545 / NBRC 100140 / 7' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 273063 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code OGT_SULTO _struct_ref.pdbx_db_accession Q973C7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MIVYGLYKSPFGPITVAKNEKGFVMLDFCDCAERSSLDNDYFTDFFYKLDLYFEGKKVDLTEPVDFKPFNEFRIRVFKEV MRIKWGEVRTYKQVADAVKTSPRAVGTALSKNNVLLIIPCHRVIGEKSLGGYSRGVELKRKLLELEGIDVAKFIEK ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7DQQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 156 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q973C7 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 156 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 156 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7DQQ PHE A 91 ? UNP Q973C7 TYR 91 'engineered mutation' 91 1 1 7DQQ SER A 120 ? UNP Q973C7 CYS 120 'engineered mutation' 120 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 J03 non-polymer . '(2~{R},3~{S},5~{R})-5-(2-azanyl-6-methoxy-purin-9-yl)-2-(hydroxymethyl)oxolan-3-ol' ? 'C11 H15 N5 O4' 281.268 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7DQQ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.23 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 44.82 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '5% v/v TacsimateTM pH 7.0, 0.1 M HEPES pH 7.0, 10% w/v Polyethylene glycol monomethyl ether 5,000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 S 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-06-03 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PHOTON FACTORY BEAMLINE BL-5A' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.00 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL-5A _diffrn_source.pdbx_synchrotron_site 'Photon Factory' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7DQQ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.600 _reflns.d_resolution_low 48.470 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 5304 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.300 _reflns.pdbx_Rmerge_I_obs 0.040 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 32.300 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.044 _reflns.pdbx_Rpim_I_all 0.017 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 33206 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 2.600 2.720 ? ? 4225 ? ? ? 642 100.000 ? ? ? ? 0.139 ? ? ? ? ? ? ? ? 6.600 ? ? ? 12.900 0.151 0.059 ? 1 1 0.990 ? ? 9.010 48.470 ? ? 808 ? ? ? 155 99.300 ? ? ? ? 0.019 ? ? ? ? ? ? ? ? 5.200 ? ? ? 53.900 0.021 0.009 ? 2 1 1.000 ? ? # _refine.aniso_B[1][1] -0.003 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][2] 0.042 _refine.aniso_B[2][3] -0.000 _refine.aniso_B[3][3] -0.039 _refine.B_iso_max ? _refine.B_iso_mean 27.542 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.935 _refine.correlation_coeff_Fo_to_Fc_free 0.836 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7DQQ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.600 _refine.ls_d_res_low 38.236 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 5274 _refine.ls_number_reflns_R_free 265 _refine.ls_number_reflns_R_work 5009 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.943 _refine.ls_percent_reflns_R_free 5.025 _refine.ls_R_factor_all 0.196 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2841 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1911 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free 0.263 _refine.ls_wR_factor_R_work 0.179 _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1wrj _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.379 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 11.548 _refine.overall_SU_ML 0.247 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work 0.9365 _refine.pdbx_average_fsc_free 0.9099 # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.600 _refine_hist.d_res_low 38.236 _refine_hist.number_atoms_solvent 41 _refine_hist.number_atoms_total 1256 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1195 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 20 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 0.013 1270 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 1214 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.571 1.671 1722 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.213 1.601 2803 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.684 5.000 158 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 29.008 21.515 66 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 18.216 15.000 226 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 20.534 15.000 9 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.071 0.200 160 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 0.020 1408 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 301 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.201 0.200 247 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.189 0.200 1088 ? r_symmetry_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.170 0.200 611 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.080 0.200 573 ? r_symmetry_nbtor_other ? ? 'X-RAY DIFFRACTION' ? 0.141 0.200 40 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.159 0.200 12 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.211 0.200 62 ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.172 0.200 13 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 2.007 2.734 605 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 2.003 2.729 604 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 3.354 4.087 757 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 3.353 4.094 758 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 2.262 3.089 665 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 2.260 3.093 666 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? 3.779 4.512 960 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 3.777 4.517 961 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 6.339 31.646 1417 ? r_lrange_it ? ? 'X-RAY DIFFRACTION' ? 6.333 31.693 1417 ? r_lrange_other ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.600 2.667 . . 10 382 100.0000 . . . 0.389 . 0.240 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.667 2.740 . . 14 344 100.0000 . . . 0.363 . 0.235 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.740 2.819 . . 15 356 100.0000 . . . 0.415 . 0.214 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.819 2.906 . . 17 318 100.0000 . . . 0.287 . 0.202 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.906 3.000 . . 12 332 100.0000 . . . 0.311 . 0.224 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.000 3.105 . . 18 309 100.0000 . . . 0.353 . 0.200 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.105 3.222 . . 17 304 100.0000 . . . 0.295 . 0.193 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.222 3.352 . . 23 278 100.0000 . . . 0.332 . 0.191 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.352 3.500 . . 16 284 100.0000 . . . 0.355 . 0.183 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.500 3.670 . . 6 276 100.0000 . . . 0.214 . 0.200 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.670 3.866 . . 16 253 99.6296 . . . 0.218 . 0.183 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.866 4.099 . . 13 251 100.0000 . . . 0.253 . 0.178 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.099 4.378 . . 13 232 100.0000 . . . 0.217 . 0.153 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.378 4.724 . . 14 209 100.0000 . . . 0.138 . 0.134 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.724 5.168 . . 14 200 100.0000 . . . 0.294 . 0.180 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.168 5.767 . . 9 186 100.0000 . . . 0.231 . 0.194 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.767 6.636 . . 7 169 100.0000 . . . 0.299 . 0.166 . . . . . . . . . . . 'X-RAY DIFFRACTION' 6.636 8.073 . . 13 140 100.0000 . . . 0.269 . 0.183 . . . . . . . . . . . 'X-RAY DIFFRACTION' 8.073 11.196 . . 10 112 99.1870 . . . 0.193 . 0.163 . . . . . . . . . . . 'X-RAY DIFFRACTION' 11.196 38.236 . . 8 74 98.7952 . . . 0.558 . 0.334 . . . . . . . . . . . # _struct.entry_id 7DQQ _struct.title ;Crystal structure of Sulfurisphaera tokodaii O6-methylguanine methyltransferase Y91F/C120S variant in complex with O6-methyldeoxyguanosine ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7DQQ _struct_keywords.text 'methyltramsferase, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 33 ? LEU A 37 ? GLU A 33 LEU A 37 5 ? 5 HELX_P HELX_P2 AA2 ASP A 38 ? TYR A 41 ? ASP A 38 TYR A 41 5 ? 4 HELX_P HELX_P3 AA3 PHE A 42 ? GLY A 55 ? PHE A 42 GLY A 55 1 ? 14 HELX_P HELX_P4 AA4 ASN A 70 ? MET A 81 ? ASN A 70 MET A 81 1 ? 12 HELX_P HELX_P5 AA5 PHE A 91 ? LYS A 99 ? PHE A 91 LYS A 99 1 ? 9 HELX_P HELX_P6 AA6 SER A 101 ? LYS A 111 ? SER A 101 LYS A 111 1 ? 11 HELX_P HELX_P7 AA7 PRO A 119 ? HIS A 121 ? PRO A 119 HIS A 121 5 ? 3 HELX_P HELX_P8 AA8 GLY A 135 ? GLU A 146 ? GLY A 135 GLU A 146 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 29 SG A ? ? 1_555 A CYS 31 SG A ? A CYS 29 A CYS 31 1_555 ? ? ? ? ? ? ? 2.076 ? ? disulf2 disulf ? ? A CYS 29 SG B ? ? 1_555 A CYS 31 SG B ? A CYS 29 A CYS 31 1_555 ? ? ? ? ? ? ? 2.077 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 3 ? SER A 9 ? VAL A 3 SER A 9 AA1 2 GLY A 12 ? LYS A 18 ? GLY A 12 LYS A 18 AA1 3 PHE A 23 ? ASP A 27 ? PHE A 23 ASP A 27 AA2 1 ARG A 89 ? THR A 90 ? ARG A 89 THR A 90 AA2 2 VAL A 123 ? ILE A 124 ? VAL A 123 ILE A 124 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 3 ? N VAL A 3 O LYS A 18 ? O LYS A 18 AA1 2 3 N THR A 15 ? N THR A 15 O ASP A 27 ? O ASP A 27 AA2 1 2 N ARG A 89 ? N ARG A 89 O ILE A 124 ? O ILE A 124 # _atom_sites.entry_id 7DQQ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.020630 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018809 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016107 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.310 20.844 1.020 10.208 1.589 0.569 0.865 51.651 0.216 H 1 1 0.493 10.511 0.323 26.126 0.140 3.142 0.041 57.800 0.003 N 7 7 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 -11.538 O 8 8 3.049 13.277 2.287 5.701 1.546 0.324 0.867 32.909 0.251 S 16 16 6.905 1.468 5.203 22.215 1.438 0.254 1.586 56.172 1.056 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 TYR 4 4 4 TYR TYR A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 MET 25 25 25 MET MET A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 ASN 39 39 39 ASN ASN A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 TYR 41 41 41 TYR TYR A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 TYR 52 52 52 TYR TYR A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 PHE 66 66 66 PHE PHE A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 PRO 68 68 68 PRO PRO A . n A 1 69 PHE 69 69 69 PHE PHE A . n A 1 70 ASN 70 70 70 ASN ASN A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 PHE 77 77 77 PHE PHE A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 MET 81 81 81 MET MET A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 TRP 85 85 85 TRP TRP A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 PHE 91 91 91 PHE PHE A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 GLN 93 93 93 GLN GLN A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 ARG 103 103 103 ARG ARG A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 THR 107 107 107 THR THR A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 ASN 112 112 112 ASN ASN A . n A 1 113 ASN 113 113 113 ASN ASN A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 ILE 117 117 117 ILE ILE A . n A 1 118 ILE 118 118 118 ILE ILE A . n A 1 119 PRO 119 119 119 PRO PRO A . n A 1 120 SER 120 120 120 SER SER A . n A 1 121 HIS 121 121 121 HIS HIS A . n A 1 122 ARG 122 122 122 ARG ARG A . n A 1 123 VAL 123 123 123 VAL VAL A . n A 1 124 ILE 124 124 124 ILE ILE A . n A 1 125 GLY 125 125 125 GLY GLY A . n A 1 126 GLU 126 126 126 GLU GLU A . n A 1 127 LYS 127 127 127 LYS LYS A . n A 1 128 SER 128 128 128 SER SER A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 GLY 131 131 131 GLY GLY A . n A 1 132 TYR 132 132 132 TYR TYR A . n A 1 133 SER 133 133 133 SER SER A . n A 1 134 ARG 134 134 134 ARG ARG A . n A 1 135 GLY 135 135 135 GLY GLY A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 GLU 137 137 137 GLU GLU A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 LYS 139 139 139 LYS LYS A . n A 1 140 ARG 140 140 140 ARG ARG A . n A 1 141 LYS 141 141 141 LYS LYS A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 GLU 144 144 144 GLU GLU A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 GLU 146 146 146 GLU GLU A . n A 1 147 GLY 147 147 147 GLY GLY A . n A 1 148 ILE 148 148 148 ILE ILE A . n A 1 149 ASP 149 149 149 ASP ASP A . n A 1 150 VAL 150 150 ? ? ? A . n A 1 151 ALA 151 151 ? ? ? A . n A 1 152 LYS 152 152 ? ? ? A . n A 1 153 PHE 153 153 ? ? ? A . n A 1 154 ILE 154 154 ? ? ? A . n A 1 155 GLU 155 155 ? ? ? A . n A 1 156 LYS 156 156 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 J03 1 201 1 J03 6OG A . C 3 HOH 1 301 25 HOH HOH A . C 3 HOH 2 302 45 HOH HOH A . C 3 HOH 3 303 3 HOH HOH A . C 3 HOH 4 304 24 HOH HOH A . C 3 HOH 5 305 32 HOH HOH A . C 3 HOH 6 306 42 HOH HOH A . C 3 HOH 7 307 46 HOH HOH A . C 3 HOH 8 308 6 HOH HOH A . C 3 HOH 9 309 12 HOH HOH A . C 3 HOH 10 310 34 HOH HOH A . C 3 HOH 11 311 50 HOH HOH A . C 3 HOH 12 312 55 HOH HOH A . C 3 HOH 13 313 53 HOH HOH A . C 3 HOH 14 314 41 HOH HOH A . C 3 HOH 15 315 28 HOH HOH A . C 3 HOH 16 316 52 HOH HOH A . C 3 HOH 17 317 57 HOH HOH A . C 3 HOH 18 318 38 HOH HOH A . C 3 HOH 19 319 10 HOH HOH A . C 3 HOH 20 320 48 HOH HOH A . C 3 HOH 21 321 35 HOH HOH A . C 3 HOH 22 322 14 HOH HOH A . C 3 HOH 23 323 33 HOH HOH A . C 3 HOH 24 324 11 HOH HOH A . C 3 HOH 25 325 47 HOH HOH A . C 3 HOH 26 326 23 HOH HOH A . C 3 HOH 27 327 21 HOH HOH A . C 3 HOH 28 328 8 HOH HOH A . C 3 HOH 29 329 56 HOH HOH A . C 3 HOH 30 330 31 HOH HOH A . C 3 HOH 31 331 16 HOH HOH A . C 3 HOH 32 332 4 HOH HOH A . C 3 HOH 33 333 60 HOH HOH A . C 3 HOH 34 334 18 HOH HOH A . C 3 HOH 35 335 30 HOH HOH A . C 3 HOH 36 336 7 HOH HOH A . C 3 HOH 37 337 29 HOH HOH A . C 3 HOH 38 338 27 HOH HOH A . C 3 HOH 39 339 51 HOH HOH A . C 3 HOH 40 340 49 HOH HOH A . C 3 HOH 41 341 26 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 520 ? 1 MORE 1 ? 1 'SSA (A^2)' 7910 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-12-15 2 'Structure model' 1 1 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Derived calculations' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' atom_type 2 2 'Structure model' chem_comp_atom 3 2 'Structure model' chem_comp_bond 4 2 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_atom_type.pdbx_N_electrons' 2 2 'Structure model' '_atom_type.pdbx_scat_Z' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.7.4 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 5 # _pdbx_entry_details.entry_id 7DQQ _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 19 ? ? -117.82 -164.17 2 1 LEU A 116 ? ? 67.87 -57.50 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 8 ? CE ? A LYS 8 CE 2 1 Y 1 A LYS 8 ? NZ ? A LYS 8 NZ 3 1 Y 1 A GLU 20 ? CD ? A GLU 20 CD 4 1 Y 1 A GLU 20 ? OE1 ? A GLU 20 OE1 5 1 Y 1 A GLU 20 ? OE2 ? A GLU 20 OE2 6 1 Y 1 A LYS 21 ? CD ? A LYS 21 CD 7 1 Y 1 A LYS 21 ? CE ? A LYS 21 CE 8 1 Y 1 A LYS 21 ? NZ ? A LYS 21 NZ 9 1 Y 1 A LYS 67 ? CD ? A LYS 67 CD 10 1 Y 1 A LYS 67 ? CE ? A LYS 67 CE 11 1 Y 1 A LYS 67 ? NZ ? A LYS 67 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A VAL 150 ? A VAL 150 2 1 Y 1 A ALA 151 ? A ALA 151 3 1 Y 1 A LYS 152 ? A LYS 152 4 1 Y 1 A PHE 153 ? A PHE 153 5 1 Y 1 A ILE 154 ? A ILE 154 6 1 Y 1 A GLU 155 ? A GLU 155 7 1 Y 1 A LYS 156 ? A LYS 156 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 J03 "O5'" O N N 183 J03 N9 N Y N 184 J03 C4 C Y N 185 J03 N3 N Y N 186 J03 C2 C Y N 187 J03 N2 N N N 188 J03 N1 N Y N 189 J03 C6 C Y N 190 J03 O6 O N N 191 J03 C5 C Y N 192 J03 N7 N Y N 193 J03 C8 C Y N 194 J03 "C2'" C N N 195 J03 "C5'" C N N 196 J03 "C4'" C N R 197 J03 "O4'" O N N 198 J03 "C1'" C N R 199 J03 "C3'" C N S 200 J03 "O3'" O N N 201 J03 C C N N 202 J03 H1 H N N 203 J03 H2 H N N 204 J03 H3 H N N 205 J03 H4 H N N 206 J03 H5 H N N 207 J03 H6 H N N 208 J03 H7 H N N 209 J03 H8 H N N 210 J03 H9 H N N 211 J03 H10 H N N 212 J03 H11 H N N 213 J03 H12 H N N 214 J03 H13 H N N 215 J03 H14 H N N 216 J03 H15 H N N 217 LEU N N N N 218 LEU CA C N S 219 LEU C C N N 220 LEU O O N N 221 LEU CB C N N 222 LEU CG C N N 223 LEU CD1 C N N 224 LEU CD2 C N N 225 LEU OXT O N N 226 LEU H H N N 227 LEU H2 H N N 228 LEU HA H N N 229 LEU HB2 H N N 230 LEU HB3 H N N 231 LEU HG H N N 232 LEU HD11 H N N 233 LEU HD12 H N N 234 LEU HD13 H N N 235 LEU HD21 H N N 236 LEU HD22 H N N 237 LEU HD23 H N N 238 LEU HXT H N N 239 LYS N N N N 240 LYS CA C N S 241 LYS C C N N 242 LYS O O N N 243 LYS CB C N N 244 LYS CG C N N 245 LYS CD C N N 246 LYS CE C N N 247 LYS NZ N N N 248 LYS OXT O N N 249 LYS H H N N 250 LYS H2 H N N 251 LYS HA H N N 252 LYS HB2 H N N 253 LYS HB3 H N N 254 LYS HG2 H N N 255 LYS HG3 H N N 256 LYS HD2 H N N 257 LYS HD3 H N N 258 LYS HE2 H N N 259 LYS HE3 H N N 260 LYS HZ1 H N N 261 LYS HZ2 H N N 262 LYS HZ3 H N N 263 LYS HXT H N N 264 MET N N N N 265 MET CA C N S 266 MET C C N N 267 MET O O N N 268 MET CB C N N 269 MET CG C N N 270 MET SD S N N 271 MET CE C N N 272 MET OXT O N N 273 MET H H N N 274 MET H2 H N N 275 MET HA H N N 276 MET HB2 H N N 277 MET HB3 H N N 278 MET HG2 H N N 279 MET HG3 H N N 280 MET HE1 H N N 281 MET HE2 H N N 282 MET HE3 H N N 283 MET HXT H N N 284 PHE N N N N 285 PHE CA C N S 286 PHE C C N N 287 PHE O O N N 288 PHE CB C N N 289 PHE CG C Y N 290 PHE CD1 C Y N 291 PHE CD2 C Y N 292 PHE CE1 C Y N 293 PHE CE2 C Y N 294 PHE CZ C Y N 295 PHE OXT O N N 296 PHE H H N N 297 PHE H2 H N N 298 PHE HA H N N 299 PHE HB2 H N N 300 PHE HB3 H N N 301 PHE HD1 H N N 302 PHE HD2 H N N 303 PHE HE1 H N N 304 PHE HE2 H N N 305 PHE HZ H N N 306 PHE HXT H N N 307 PRO N N N N 308 PRO CA C N S 309 PRO C C N N 310 PRO O O N N 311 PRO CB C N N 312 PRO CG C N N 313 PRO CD C N N 314 PRO OXT O N N 315 PRO H H N N 316 PRO HA H N N 317 PRO HB2 H N N 318 PRO HB3 H N N 319 PRO HG2 H N N 320 PRO HG3 H N N 321 PRO HD2 H N N 322 PRO HD3 H N N 323 PRO HXT H N N 324 SER N N N N 325 SER CA C N S 326 SER C C N N 327 SER O O N N 328 SER CB C N N 329 SER OG O N N 330 SER OXT O N N 331 SER H H N N 332 SER H2 H N N 333 SER HA H N N 334 SER HB2 H N N 335 SER HB3 H N N 336 SER HG H N N 337 SER HXT H N N 338 THR N N N N 339 THR CA C N S 340 THR C C N N 341 THR O O N N 342 THR CB C N R 343 THR OG1 O N N 344 THR CG2 C N N 345 THR OXT O N N 346 THR H H N N 347 THR H2 H N N 348 THR HA H N N 349 THR HB H N N 350 THR HG1 H N N 351 THR HG21 H N N 352 THR HG22 H N N 353 THR HG23 H N N 354 THR HXT H N N 355 TRP N N N N 356 TRP CA C N S 357 TRP C C N N 358 TRP O O N N 359 TRP CB C N N 360 TRP CG C Y N 361 TRP CD1 C Y N 362 TRP CD2 C Y N 363 TRP NE1 N Y N 364 TRP CE2 C Y N 365 TRP CE3 C Y N 366 TRP CZ2 C Y N 367 TRP CZ3 C Y N 368 TRP CH2 C Y N 369 TRP OXT O N N 370 TRP H H N N 371 TRP H2 H N N 372 TRP HA H N N 373 TRP HB2 H N N 374 TRP HB3 H N N 375 TRP HD1 H N N 376 TRP HE1 H N N 377 TRP HE3 H N N 378 TRP HZ2 H N N 379 TRP HZ3 H N N 380 TRP HH2 H N N 381 TRP HXT H N N 382 TYR N N N N 383 TYR CA C N S 384 TYR C C N N 385 TYR O O N N 386 TYR CB C N N 387 TYR CG C Y N 388 TYR CD1 C Y N 389 TYR CD2 C Y N 390 TYR CE1 C Y N 391 TYR CE2 C Y N 392 TYR CZ C Y N 393 TYR OH O N N 394 TYR OXT O N N 395 TYR H H N N 396 TYR H2 H N N 397 TYR HA H N N 398 TYR HB2 H N N 399 TYR HB3 H N N 400 TYR HD1 H N N 401 TYR HD2 H N N 402 TYR HE1 H N N 403 TYR HE2 H N N 404 TYR HH H N N 405 TYR HXT H N N 406 VAL N N N N 407 VAL CA C N S 408 VAL C C N N 409 VAL O O N N 410 VAL CB C N N 411 VAL CG1 C N N 412 VAL CG2 C N N 413 VAL OXT O N N 414 VAL H H N N 415 VAL H2 H N N 416 VAL HA H N N 417 VAL HB H N N 418 VAL HG11 H N N 419 VAL HG12 H N N 420 VAL HG13 H N N 421 VAL HG21 H N N 422 VAL HG22 H N N 423 VAL HG23 H N N 424 VAL HXT H N N 425 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 J03 C O6 sing N N 173 J03 O6 C6 sing N N 174 J03 N7 C5 sing Y N 175 J03 N7 C8 doub Y N 176 J03 C6 C5 doub Y N 177 J03 C6 N1 sing Y N 178 J03 C5 C4 sing Y N 179 J03 C8 N9 sing Y N 180 J03 N1 C2 doub Y N 181 J03 C4 N9 sing Y N 182 J03 C4 N3 doub Y N 183 J03 N9 "C1'" sing N N 184 J03 "C2'" "C1'" sing N N 185 J03 "C2'" "C3'" sing N N 186 J03 C2 N3 sing Y N 187 J03 C2 N2 sing N N 188 J03 "C1'" "O4'" sing N N 189 J03 "C3'" "O3'" sing N N 190 J03 "C3'" "C4'" sing N N 191 J03 "O4'" "C4'" sing N N 192 J03 "C4'" "C5'" sing N N 193 J03 "C5'" "O5'" sing N N 194 J03 "O5'" H1 sing N N 195 J03 N2 H2 sing N N 196 J03 N2 H3 sing N N 197 J03 C8 H4 sing N N 198 J03 "C2'" H5 sing N N 199 J03 "C2'" H6 sing N N 200 J03 "C5'" H7 sing N N 201 J03 "C5'" H8 sing N N 202 J03 "C4'" H9 sing N N 203 J03 "C1'" H10 sing N N 204 J03 "C3'" H11 sing N N 205 J03 "O3'" H12 sing N N 206 J03 C H13 sing N N 207 J03 C H14 sing N N 208 J03 C H15 sing N N 209 LEU N CA sing N N 210 LEU N H sing N N 211 LEU N H2 sing N N 212 LEU CA C sing N N 213 LEU CA CB sing N N 214 LEU CA HA sing N N 215 LEU C O doub N N 216 LEU C OXT sing N N 217 LEU CB CG sing N N 218 LEU CB HB2 sing N N 219 LEU CB HB3 sing N N 220 LEU CG CD1 sing N N 221 LEU CG CD2 sing N N 222 LEU CG HG sing N N 223 LEU CD1 HD11 sing N N 224 LEU CD1 HD12 sing N N 225 LEU CD1 HD13 sing N N 226 LEU CD2 HD21 sing N N 227 LEU CD2 HD22 sing N N 228 LEU CD2 HD23 sing N N 229 LEU OXT HXT sing N N 230 LYS N CA sing N N 231 LYS N H sing N N 232 LYS N H2 sing N N 233 LYS CA C sing N N 234 LYS CA CB sing N N 235 LYS CA HA sing N N 236 LYS C O doub N N 237 LYS C OXT sing N N 238 LYS CB CG sing N N 239 LYS CB HB2 sing N N 240 LYS CB HB3 sing N N 241 LYS CG CD sing N N 242 LYS CG HG2 sing N N 243 LYS CG HG3 sing N N 244 LYS CD CE sing N N 245 LYS CD HD2 sing N N 246 LYS CD HD3 sing N N 247 LYS CE NZ sing N N 248 LYS CE HE2 sing N N 249 LYS CE HE3 sing N N 250 LYS NZ HZ1 sing N N 251 LYS NZ HZ2 sing N N 252 LYS NZ HZ3 sing N N 253 LYS OXT HXT sing N N 254 MET N CA sing N N 255 MET N H sing N N 256 MET N H2 sing N N 257 MET CA C sing N N 258 MET CA CB sing N N 259 MET CA HA sing N N 260 MET C O doub N N 261 MET C OXT sing N N 262 MET CB CG sing N N 263 MET CB HB2 sing N N 264 MET CB HB3 sing N N 265 MET CG SD sing N N 266 MET CG HG2 sing N N 267 MET CG HG3 sing N N 268 MET SD CE sing N N 269 MET CE HE1 sing N N 270 MET CE HE2 sing N N 271 MET CE HE3 sing N N 272 MET OXT HXT sing N N 273 PHE N CA sing N N 274 PHE N H sing N N 275 PHE N H2 sing N N 276 PHE CA C sing N N 277 PHE CA CB sing N N 278 PHE CA HA sing N N 279 PHE C O doub N N 280 PHE C OXT sing N N 281 PHE CB CG sing N N 282 PHE CB HB2 sing N N 283 PHE CB HB3 sing N N 284 PHE CG CD1 doub Y N 285 PHE CG CD2 sing Y N 286 PHE CD1 CE1 sing Y N 287 PHE CD1 HD1 sing N N 288 PHE CD2 CE2 doub Y N 289 PHE CD2 HD2 sing N N 290 PHE CE1 CZ doub Y N 291 PHE CE1 HE1 sing N N 292 PHE CE2 CZ sing Y N 293 PHE CE2 HE2 sing N N 294 PHE CZ HZ sing N N 295 PHE OXT HXT sing N N 296 PRO N CA sing N N 297 PRO N CD sing N N 298 PRO N H sing N N 299 PRO CA C sing N N 300 PRO CA CB sing N N 301 PRO CA HA sing N N 302 PRO C O doub N N 303 PRO C OXT sing N N 304 PRO CB CG sing N N 305 PRO CB HB2 sing N N 306 PRO CB HB3 sing N N 307 PRO CG CD sing N N 308 PRO CG HG2 sing N N 309 PRO CG HG3 sing N N 310 PRO CD HD2 sing N N 311 PRO CD HD3 sing N N 312 PRO OXT HXT sing N N 313 SER N CA sing N N 314 SER N H sing N N 315 SER N H2 sing N N 316 SER CA C sing N N 317 SER CA CB sing N N 318 SER CA HA sing N N 319 SER C O doub N N 320 SER C OXT sing N N 321 SER CB OG sing N N 322 SER CB HB2 sing N N 323 SER CB HB3 sing N N 324 SER OG HG sing N N 325 SER OXT HXT sing N N 326 THR N CA sing N N 327 THR N H sing N N 328 THR N H2 sing N N 329 THR CA C sing N N 330 THR CA CB sing N N 331 THR CA HA sing N N 332 THR C O doub N N 333 THR C OXT sing N N 334 THR CB OG1 sing N N 335 THR CB CG2 sing N N 336 THR CB HB sing N N 337 THR OG1 HG1 sing N N 338 THR CG2 HG21 sing N N 339 THR CG2 HG22 sing N N 340 THR CG2 HG23 sing N N 341 THR OXT HXT sing N N 342 TRP N CA sing N N 343 TRP N H sing N N 344 TRP N H2 sing N N 345 TRP CA C sing N N 346 TRP CA CB sing N N 347 TRP CA HA sing N N 348 TRP C O doub N N 349 TRP C OXT sing N N 350 TRP CB CG sing N N 351 TRP CB HB2 sing N N 352 TRP CB HB3 sing N N 353 TRP CG CD1 doub Y N 354 TRP CG CD2 sing Y N 355 TRP CD1 NE1 sing Y N 356 TRP CD1 HD1 sing N N 357 TRP CD2 CE2 doub Y N 358 TRP CD2 CE3 sing Y N 359 TRP NE1 CE2 sing Y N 360 TRP NE1 HE1 sing N N 361 TRP CE2 CZ2 sing Y N 362 TRP CE3 CZ3 doub Y N 363 TRP CE3 HE3 sing N N 364 TRP CZ2 CH2 doub Y N 365 TRP CZ2 HZ2 sing N N 366 TRP CZ3 CH2 sing Y N 367 TRP CZ3 HZ3 sing N N 368 TRP CH2 HH2 sing N N 369 TRP OXT HXT sing N N 370 TYR N CA sing N N 371 TYR N H sing N N 372 TYR N H2 sing N N 373 TYR CA C sing N N 374 TYR CA CB sing N N 375 TYR CA HA sing N N 376 TYR C O doub N N 377 TYR C OXT sing N N 378 TYR CB CG sing N N 379 TYR CB HB2 sing N N 380 TYR CB HB3 sing N N 381 TYR CG CD1 doub Y N 382 TYR CG CD2 sing Y N 383 TYR CD1 CE1 sing Y N 384 TYR CD1 HD1 sing N N 385 TYR CD2 CE2 doub Y N 386 TYR CD2 HD2 sing N N 387 TYR CE1 CZ doub Y N 388 TYR CE1 HE1 sing N N 389 TYR CE2 CZ sing Y N 390 TYR CE2 HE2 sing N N 391 TYR CZ OH sing N N 392 TYR OH HH sing N N 393 TYR OXT HXT sing N N 394 VAL N CA sing N N 395 VAL N H sing N N 396 VAL N H2 sing N N 397 VAL CA C sing N N 398 VAL CA CB sing N N 399 VAL CA HA sing N N 400 VAL C O doub N N 401 VAL C OXT sing N N 402 VAL CB CG1 sing N N 403 VAL CB CG2 sing N N 404 VAL CB HB sing N N 405 VAL CG1 HG11 sing N N 406 VAL CG1 HG12 sing N N 407 VAL CG1 HG13 sing N N 408 VAL CG2 HG21 sing N N 409 VAL CG2 HG22 sing N N 410 VAL CG2 HG23 sing N N 411 VAL OXT HXT sing N N 412 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id J03 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id J03 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '(2~{R},3~{S},5~{R})-5-(2-azanyl-6-methoxy-purin-9-yl)-2-(hydroxymethyl)oxolan-3-ol' J03 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1WRJ _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #