data_7E55 # _entry.id 7E55 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.341 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 7E55 WWPDB D_1300020771 EMDB EMD-30990 # _pdbx_database_related.db_name EMDB _pdbx_database_related.details 'Cryo-EM structure of alpha 7 homo-tetradecamer' _pdbx_database_related.db_id EMD-30990 _pdbx_database_related.content_type 'associated EM volume' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7E55 _pdbx_database_status.recvd_initial_deposition_date 2021-02-17 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Song, C.' 1 0000-0001-8628-4267 'Murata, K.' 2 0000-0001-9446-3652 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country CH _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Int J Mol Sci' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1422-0067 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 22 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Structural Fluctuations of the Human Proteasome alpha 7 Homo-Tetradecamer Double Ring Imply the Proteasomal alpha-Ring Assembly Mechanism. ; _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.3390/ijms22094519 _citation.pdbx_database_id_PubMed 33926037 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Song, C.' 1 ? primary 'Satoh, T.' 2 ? primary 'Sekiguchi, T.' 3 ? primary 'Kato, K.' 4 ? primary 'Murata, K.' 5 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 7E55 _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.00 _cell.length_a_esd ? _cell.length_b 1.00 _cell.length_b_esd ? _cell.length_c 1.00 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7E55 _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Proteasome subunit alpha type-3' _entity.formula_weight 28469.252 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Macropain subunit C8,Multicatalytic endopeptidase complex subunit C8,Proteasome component C8' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAG LLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYG YWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYA KESLKEEDESDDDNM ; _entity_poly.pdbx_seq_one_letter_code_can ;MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAG LLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYG YWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYA KESLKEEDESDDDNM ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 SER n 1 4 ILE n 1 5 GLY n 1 6 THR n 1 7 GLY n 1 8 TYR n 1 9 ASP n 1 10 LEU n 1 11 SER n 1 12 ALA n 1 13 SER n 1 14 THR n 1 15 PHE n 1 16 SER n 1 17 PRO n 1 18 ASP n 1 19 GLY n 1 20 ARG n 1 21 VAL n 1 22 PHE n 1 23 GLN n 1 24 VAL n 1 25 GLU n 1 26 TYR n 1 27 ALA n 1 28 MET n 1 29 LYS n 1 30 ALA n 1 31 VAL n 1 32 GLU n 1 33 ASN n 1 34 SER n 1 35 SER n 1 36 THR n 1 37 ALA n 1 38 ILE n 1 39 GLY n 1 40 ILE n 1 41 ARG n 1 42 CYS n 1 43 LYS n 1 44 ASP n 1 45 GLY n 1 46 VAL n 1 47 VAL n 1 48 PHE n 1 49 GLY n 1 50 VAL n 1 51 GLU n 1 52 LYS n 1 53 LEU n 1 54 VAL n 1 55 LEU n 1 56 SER n 1 57 LYS n 1 58 LEU n 1 59 TYR n 1 60 GLU n 1 61 GLU n 1 62 GLY n 1 63 SER n 1 64 ASN n 1 65 LYS n 1 66 ARG n 1 67 LEU n 1 68 PHE n 1 69 ASN n 1 70 VAL n 1 71 ASP n 1 72 ARG n 1 73 HIS n 1 74 VAL n 1 75 GLY n 1 76 MET n 1 77 ALA n 1 78 VAL n 1 79 ALA n 1 80 GLY n 1 81 LEU n 1 82 LEU n 1 83 ALA n 1 84 ASP n 1 85 ALA n 1 86 ARG n 1 87 SER n 1 88 LEU n 1 89 ALA n 1 90 ASP n 1 91 ILE n 1 92 ALA n 1 93 ARG n 1 94 GLU n 1 95 GLU n 1 96 ALA n 1 97 SER n 1 98 ASN n 1 99 PHE n 1 100 ARG n 1 101 SER n 1 102 ASN n 1 103 PHE n 1 104 GLY n 1 105 TYR n 1 106 ASN n 1 107 ILE n 1 108 PRO n 1 109 LEU n 1 110 LYS n 1 111 HIS n 1 112 LEU n 1 113 ALA n 1 114 ASP n 1 115 ARG n 1 116 VAL n 1 117 ALA n 1 118 MET n 1 119 TYR n 1 120 VAL n 1 121 HIS n 1 122 ALA n 1 123 TYR n 1 124 THR n 1 125 LEU n 1 126 TYR n 1 127 SER n 1 128 ALA n 1 129 VAL n 1 130 ARG n 1 131 PRO n 1 132 PHE n 1 133 GLY n 1 134 CYS n 1 135 SER n 1 136 PHE n 1 137 MET n 1 138 LEU n 1 139 GLY n 1 140 SER n 1 141 TYR n 1 142 SER n 1 143 VAL n 1 144 ASN n 1 145 ASP n 1 146 GLY n 1 147 ALA n 1 148 GLN n 1 149 LEU n 1 150 TYR n 1 151 MET n 1 152 ILE n 1 153 ASP n 1 154 PRO n 1 155 SER n 1 156 GLY n 1 157 VAL n 1 158 SER n 1 159 TYR n 1 160 GLY n 1 161 TYR n 1 162 TRP n 1 163 GLY n 1 164 CYS n 1 165 ALA n 1 166 ILE n 1 167 GLY n 1 168 LYS n 1 169 ALA n 1 170 ARG n 1 171 GLN n 1 172 ALA n 1 173 ALA n 1 174 LYS n 1 175 THR n 1 176 GLU n 1 177 ILE n 1 178 GLU n 1 179 LYS n 1 180 LEU n 1 181 GLN n 1 182 MET n 1 183 LYS n 1 184 GLU n 1 185 MET n 1 186 THR n 1 187 CYS n 1 188 ARG n 1 189 ASP n 1 190 ILE n 1 191 VAL n 1 192 LYS n 1 193 GLU n 1 194 VAL n 1 195 ALA n 1 196 LYS n 1 197 ILE n 1 198 ILE n 1 199 TYR n 1 200 ILE n 1 201 VAL n 1 202 HIS n 1 203 ASP n 1 204 GLU n 1 205 VAL n 1 206 LYS n 1 207 ASP n 1 208 LYS n 1 209 ALA n 1 210 PHE n 1 211 GLU n 1 212 LEU n 1 213 GLU n 1 214 LEU n 1 215 SER n 1 216 TRP n 1 217 VAL n 1 218 GLY n 1 219 GLU n 1 220 LEU n 1 221 THR n 1 222 ASN n 1 223 GLY n 1 224 ARG n 1 225 HIS n 1 226 GLU n 1 227 ILE n 1 228 VAL n 1 229 PRO n 1 230 LYS n 1 231 ASP n 1 232 ILE n 1 233 ARG n 1 234 GLU n 1 235 GLU n 1 236 ALA n 1 237 GLU n 1 238 LYS n 1 239 TYR n 1 240 ALA n 1 241 LYS n 1 242 GLU n 1 243 SER n 1 244 LEU n 1 245 LYS n 1 246 GLU n 1 247 GLU n 1 248 ASP n 1 249 GLU n 1 250 SER n 1 251 ASP n 1 252 ASP n 1 253 ASP n 1 254 ASN n 1 255 MET n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 255 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'PSMA3, HC8, PSC8' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PSA3_HUMAN _struct_ref.pdbx_db_accession P25788 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAG LLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYG YWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYA KESLKEEDESDDDNM ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7E55 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 255 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P25788 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 255 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 0 _struct_ref_seq.pdbx_auth_seq_align_end 254 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7E55 _exptl.crystals_number ? _exptl.details ? _exptl.method 'ELECTRON MICROSCOPY' _exptl.method_details ? # _struct.entry_id 7E55 _struct.title 'Cryo-EM structure of alpha 7 homo-tetradecamer' _struct.pdbx_descriptor 'Proteasome subunit alpha type-3' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7E55 _struct_keywords.text 'Conformational fluctuation, double-ring, proteasome, D7 symmetry, CHAPERONE, LYASE' _struct_keywords.pdbx_keywords LYASE # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PHE A 22 ? ASN A 33 ? PHE A 21 ASN A 32 1 ? 12 HELX_P HELX_P2 2 LEU A 82 ? PHE A 103 ? LEU A 81 PHE A 102 1 ? 22 HELX_P HELX_P3 3 LEU A 109 ? THR A 124 ? LEU A 108 THR A 123 1 ? 16 HELX_P HELX_P4 4 ARG A 170 ? LYS A 179 ? ARG A 169 LYS A 178 1 ? 10 HELX_P HELX_P5 5 CYS A 187 ? VAL A 201 ? CYS A 186 VAL A 200 1 ? 15 HELX_P HELX_P6 6 GLU A 219 ? THR A 221 ? GLU A 218 THR A 220 1 ? 3 HELX_P HELX_P7 7 LYS A 230 ? LYS A 245 ? LYS A 229 LYS A 244 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 42 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 187 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 41 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 186 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.017 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details 1 ? 1 ? 2 ? 1 ? 3 ? 1 ? 4 ? 1 ? 5 ? 1 ? 6 ? 1 ? 7 ? 1 ? 8 ? 1 ? 9 ? 1 ? # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id 1 1 ALA A 37 ? ILE A 40 ? ALA A 36 ILE A 39 2 1 GLY A 45 ? VAL A 50 ? GLY A 44 VAL A 49 3 1 LEU A 67 ? ASN A 69 ? LEU A 66 ASN A 68 4 1 VAL A 74 ? GLY A 80 ? VAL A 73 GLY A 79 5 1 CYS A 134 ? SER A 142 ? CYS A 133 SER A 141 6 1 GLY A 146 ? ILE A 152 ? GLY A 145 ILE A 151 7 1 SER A 158 ? GLY A 160 ? SER A 157 GLY A 159 8 1 GLY A 163 ? ILE A 166 ? GLY A 162 ILE A 165 9 1 GLU A 213 ? GLY A 218 ? GLU A 212 GLY A 217 # _atom_sites.entry_id 7E55 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 ? ? ? A . n A 1 2 SER 2 1 ? ? ? A . n A 1 3 SER 3 2 2 SER SER A . n A 1 4 ILE 4 3 3 ILE ILE A . n A 1 5 GLY 5 4 4 GLY GLY A . n A 1 6 THR 6 5 5 THR THR A . n A 1 7 GLY 7 6 6 GLY GLY A . n A 1 8 TYR 8 7 7 TYR TYR A . n A 1 9 ASP 9 8 8 ASP ASP A . n A 1 10 LEU 10 9 9 LEU LEU A . n A 1 11 SER 11 10 10 SER SER A . n A 1 12 ALA 12 11 11 ALA ALA A . n A 1 13 SER 13 12 12 SER SER A . n A 1 14 THR 14 13 13 THR THR A . n A 1 15 PHE 15 14 14 PHE PHE A . n A 1 16 SER 16 15 15 SER SER A . n A 1 17 PRO 17 16 16 PRO PRO A . n A 1 18 ASP 18 17 17 ASP ASP A . n A 1 19 GLY 19 18 18 GLY GLY A . n A 1 20 ARG 20 19 19 ARG ARG A . n A 1 21 VAL 21 20 20 VAL VAL A . n A 1 22 PHE 22 21 21 PHE PHE A . n A 1 23 GLN 23 22 22 GLN GLN A . n A 1 24 VAL 24 23 23 VAL VAL A . n A 1 25 GLU 25 24 24 GLU GLU A . n A 1 26 TYR 26 25 25 TYR TYR A . n A 1 27 ALA 27 26 26 ALA ALA A . n A 1 28 MET 28 27 27 MET MET A . n A 1 29 LYS 29 28 28 LYS LYS A . n A 1 30 ALA 30 29 29 ALA ALA A . n A 1 31 VAL 31 30 30 VAL VAL A . n A 1 32 GLU 32 31 31 GLU GLU A . n A 1 33 ASN 33 32 32 ASN ASN A . n A 1 34 SER 34 33 33 SER SER A . n A 1 35 SER 35 34 34 SER SER A . n A 1 36 THR 36 35 35 THR THR A . n A 1 37 ALA 37 36 36 ALA ALA A . n A 1 38 ILE 38 37 37 ILE ILE A . n A 1 39 GLY 39 38 38 GLY GLY A . n A 1 40 ILE 40 39 39 ILE ILE A . n A 1 41 ARG 41 40 40 ARG ARG A . n A 1 42 CYS 42 41 41 CYS CYS A . n A 1 43 LYS 43 42 42 LYS LYS A . n A 1 44 ASP 44 43 43 ASP ASP A . n A 1 45 GLY 45 44 44 GLY GLY A . n A 1 46 VAL 46 45 45 VAL VAL A . n A 1 47 VAL 47 46 46 VAL VAL A . n A 1 48 PHE 48 47 47 PHE PHE A . n A 1 49 GLY 49 48 48 GLY GLY A . n A 1 50 VAL 50 49 49 VAL VAL A . n A 1 51 GLU 51 50 50 GLU GLU A . n A 1 52 LYS 52 51 51 LYS LYS A . n A 1 53 LEU 53 52 52 LEU LEU A . n A 1 54 VAL 54 53 53 VAL VAL A . n A 1 55 LEU 55 54 54 LEU LEU A . n A 1 56 SER 56 55 55 SER SER A . n A 1 57 LYS 57 56 56 LYS LYS A . n A 1 58 LEU 58 57 57 LEU LEU A . n A 1 59 TYR 59 58 58 TYR TYR A . n A 1 60 GLU 60 59 59 GLU GLU A . n A 1 61 GLU 61 60 60 GLU GLU A . n A 1 62 GLY 62 61 61 GLY GLY A . n A 1 63 SER 63 62 62 SER SER A . n A 1 64 ASN 64 63 63 ASN ASN A . n A 1 65 LYS 65 64 64 LYS LYS A . n A 1 66 ARG 66 65 65 ARG ARG A . n A 1 67 LEU 67 66 66 LEU LEU A . n A 1 68 PHE 68 67 67 PHE PHE A . n A 1 69 ASN 69 68 68 ASN ASN A . n A 1 70 VAL 70 69 69 VAL VAL A . n A 1 71 ASP 71 70 70 ASP ASP A . n A 1 72 ARG 72 71 71 ARG ARG A . n A 1 73 HIS 73 72 72 HIS HIS A . n A 1 74 VAL 74 73 73 VAL VAL A . n A 1 75 GLY 75 74 74 GLY GLY A . n A 1 76 MET 76 75 75 MET MET A . n A 1 77 ALA 77 76 76 ALA ALA A . n A 1 78 VAL 78 77 77 VAL VAL A . n A 1 79 ALA 79 78 78 ALA ALA A . n A 1 80 GLY 80 79 79 GLY GLY A . n A 1 81 LEU 81 80 80 LEU LEU A . n A 1 82 LEU 82 81 81 LEU LEU A . n A 1 83 ALA 83 82 82 ALA ALA A . n A 1 84 ASP 84 83 83 ASP ASP A . n A 1 85 ALA 85 84 84 ALA ALA A . n A 1 86 ARG 86 85 85 ARG ARG A . n A 1 87 SER 87 86 86 SER SER A . n A 1 88 LEU 88 87 87 LEU LEU A . n A 1 89 ALA 89 88 88 ALA ALA A . n A 1 90 ASP 90 89 89 ASP ASP A . n A 1 91 ILE 91 90 90 ILE ILE A . n A 1 92 ALA 92 91 91 ALA ALA A . n A 1 93 ARG 93 92 92 ARG ARG A . n A 1 94 GLU 94 93 93 GLU GLU A . n A 1 95 GLU 95 94 94 GLU GLU A . n A 1 96 ALA 96 95 95 ALA ALA A . n A 1 97 SER 97 96 96 SER SER A . n A 1 98 ASN 98 97 97 ASN ASN A . n A 1 99 PHE 99 98 98 PHE PHE A . n A 1 100 ARG 100 99 99 ARG ARG A . n A 1 101 SER 101 100 100 SER SER A . n A 1 102 ASN 102 101 101 ASN ASN A . n A 1 103 PHE 103 102 102 PHE PHE A . n A 1 104 GLY 104 103 103 GLY GLY A . n A 1 105 TYR 105 104 104 TYR TYR A . n A 1 106 ASN 106 105 105 ASN ASN A . n A 1 107 ILE 107 106 106 ILE ILE A . n A 1 108 PRO 108 107 107 PRO PRO A . n A 1 109 LEU 109 108 108 LEU LEU A . n A 1 110 LYS 110 109 109 LYS LYS A . n A 1 111 HIS 111 110 110 HIS HIS A . n A 1 112 LEU 112 111 111 LEU LEU A . n A 1 113 ALA 113 112 112 ALA ALA A . n A 1 114 ASP 114 113 113 ASP ASP A . n A 1 115 ARG 115 114 114 ARG ARG A . n A 1 116 VAL 116 115 115 VAL VAL A . n A 1 117 ALA 117 116 116 ALA ALA A . n A 1 118 MET 118 117 117 MET MET A . n A 1 119 TYR 119 118 118 TYR TYR A . n A 1 120 VAL 120 119 119 VAL VAL A . n A 1 121 HIS 121 120 120 HIS HIS A . n A 1 122 ALA 122 121 121 ALA ALA A . n A 1 123 TYR 123 122 122 TYR TYR A . n A 1 124 THR 124 123 123 THR THR A . n A 1 125 LEU 125 124 124 LEU LEU A . n A 1 126 TYR 126 125 125 TYR TYR A . n A 1 127 SER 127 126 126 SER SER A . n A 1 128 ALA 128 127 127 ALA ALA A . n A 1 129 VAL 129 128 128 VAL VAL A . n A 1 130 ARG 130 129 129 ARG ARG A . n A 1 131 PRO 131 130 130 PRO PRO A . n A 1 132 PHE 132 131 131 PHE PHE A . n A 1 133 GLY 133 132 132 GLY GLY A . n A 1 134 CYS 134 133 133 CYS CYS A . n A 1 135 SER 135 134 134 SER SER A . n A 1 136 PHE 136 135 135 PHE PHE A . n A 1 137 MET 137 136 136 MET MET A . n A 1 138 LEU 138 137 137 LEU LEU A . n A 1 139 GLY 139 138 138 GLY GLY A . n A 1 140 SER 140 139 139 SER SER A . n A 1 141 TYR 141 140 140 TYR TYR A . n A 1 142 SER 142 141 141 SER SER A . n A 1 143 VAL 143 142 142 VAL VAL A . n A 1 144 ASN 144 143 143 ASN ASN A . n A 1 145 ASP 145 144 144 ASP ASP A . n A 1 146 GLY 146 145 145 GLY GLY A . n A 1 147 ALA 147 146 146 ALA ALA A . n A 1 148 GLN 148 147 147 GLN GLN A . n A 1 149 LEU 149 148 148 LEU LEU A . n A 1 150 TYR 150 149 149 TYR TYR A . n A 1 151 MET 151 150 150 MET MET A . n A 1 152 ILE 152 151 151 ILE ILE A . n A 1 153 ASP 153 152 152 ASP ASP A . n A 1 154 PRO 154 153 153 PRO PRO A . n A 1 155 SER 155 154 154 SER SER A . n A 1 156 GLY 156 155 155 GLY GLY A . n A 1 157 VAL 157 156 156 VAL VAL A . n A 1 158 SER 158 157 157 SER SER A . n A 1 159 TYR 159 158 158 TYR TYR A . n A 1 160 GLY 160 159 159 GLY GLY A . n A 1 161 TYR 161 160 160 TYR TYR A . n A 1 162 TRP 162 161 161 TRP TRP A . n A 1 163 GLY 163 162 162 GLY GLY A . n A 1 164 CYS 164 163 163 CYS CYS A . n A 1 165 ALA 165 164 164 ALA ALA A . n A 1 166 ILE 166 165 165 ILE ILE A . n A 1 167 GLY 167 166 166 GLY GLY A . n A 1 168 LYS 168 167 167 LYS LYS A . n A 1 169 ALA 169 168 168 ALA ALA A . n A 1 170 ARG 170 169 169 ARG ARG A . n A 1 171 GLN 171 170 170 GLN GLN A . n A 1 172 ALA 172 171 171 ALA ALA A . n A 1 173 ALA 173 172 172 ALA ALA A . n A 1 174 LYS 174 173 173 LYS LYS A . n A 1 175 THR 175 174 174 THR THR A . n A 1 176 GLU 176 175 175 GLU GLU A . n A 1 177 ILE 177 176 176 ILE ILE A . n A 1 178 GLU 178 177 177 GLU GLU A . n A 1 179 LYS 179 178 178 LYS LYS A . n A 1 180 LEU 180 179 179 LEU LEU A . n A 1 181 GLN 181 180 180 GLN GLN A . n A 1 182 MET 182 181 181 MET MET A . n A 1 183 LYS 183 182 182 LYS LYS A . n A 1 184 GLU 184 183 183 GLU GLU A . n A 1 185 MET 185 184 184 MET MET A . n A 1 186 THR 186 185 185 THR THR A . n A 1 187 CYS 187 186 186 CYS CYS A . n A 1 188 ARG 188 187 187 ARG ARG A . n A 1 189 ASP 189 188 188 ASP ASP A . n A 1 190 ILE 190 189 189 ILE ILE A . n A 1 191 VAL 191 190 190 VAL VAL A . n A 1 192 LYS 192 191 191 LYS LYS A . n A 1 193 GLU 193 192 192 GLU GLU A . n A 1 194 VAL 194 193 193 VAL VAL A . n A 1 195 ALA 195 194 194 ALA ALA A . n A 1 196 LYS 196 195 195 LYS LYS A . n A 1 197 ILE 197 196 196 ILE ILE A . n A 1 198 ILE 198 197 197 ILE ILE A . n A 1 199 TYR 199 198 198 TYR TYR A . n A 1 200 ILE 200 199 199 ILE ILE A . n A 1 201 VAL 201 200 200 VAL VAL A . n A 1 202 HIS 202 201 201 HIS HIS A . n A 1 203 ASP 203 202 202 ASP ASP A . n A 1 204 GLU 204 203 203 GLU GLU A . n A 1 205 VAL 205 204 204 VAL VAL A . n A 1 206 LYS 206 205 205 LYS LYS A . n A 1 207 ASP 207 206 206 ASP ASP A . n A 1 208 LYS 208 207 207 LYS LYS A . n A 1 209 ALA 209 208 208 ALA ALA A . n A 1 210 PHE 210 209 209 PHE PHE A . n A 1 211 GLU 211 210 210 GLU GLU A . n A 1 212 LEU 212 211 211 LEU LEU A . n A 1 213 GLU 213 212 212 GLU GLU A . n A 1 214 LEU 214 213 213 LEU LEU A . n A 1 215 SER 215 214 214 SER SER A . n A 1 216 TRP 216 215 215 TRP TRP A . n A 1 217 VAL 217 216 216 VAL VAL A . n A 1 218 GLY 218 217 217 GLY GLY A . n A 1 219 GLU 219 218 218 GLU GLU A . n A 1 220 LEU 220 219 219 LEU LEU A . n A 1 221 THR 221 220 220 THR THR A . n A 1 222 ASN 222 221 221 ASN ASN A . n A 1 223 GLY 223 222 222 GLY GLY A . n A 1 224 ARG 224 223 223 ARG ARG A . n A 1 225 HIS 225 224 224 HIS HIS A . n A 1 226 GLU 226 225 225 GLU GLU A . n A 1 227 ILE 227 226 226 ILE ILE A . n A 1 228 VAL 228 227 227 VAL VAL A . n A 1 229 PRO 229 228 228 PRO PRO A . n A 1 230 LYS 230 229 229 LYS LYS A . n A 1 231 ASP 231 230 230 ASP ASP A . n A 1 232 ILE 232 231 231 ILE ILE A . n A 1 233 ARG 233 232 232 ARG ARG A . n A 1 234 GLU 234 233 233 GLU GLU A . n A 1 235 GLU 235 234 234 GLU GLU A . n A 1 236 ALA 236 235 235 ALA ALA A . n A 1 237 GLU 237 236 236 GLU GLU A . n A 1 238 LYS 238 237 237 LYS LYS A . n A 1 239 TYR 239 238 238 TYR TYR A . n A 1 240 ALA 240 239 239 ALA ALA A . n A 1 241 LYS 241 240 240 LYS LYS A . n A 1 242 GLU 242 241 241 GLU GLU A . n A 1 243 SER 243 242 242 SER SER A . n A 1 244 LEU 244 243 243 LEU LEU A . n A 1 245 LYS 245 244 244 LYS LYS A . n A 1 246 GLU 246 245 245 GLU GLU A . n A 1 247 GLU 247 246 ? ? ? A . n A 1 248 ASP 248 247 ? ? ? A . n A 1 249 GLU 249 248 ? ? ? A . n A 1 250 SER 250 249 ? ? ? A . n A 1 251 ASP 251 250 ? ? ? A . n A 1 252 ASP 252 251 ? ? ? A . n A 1 253 ASP 253 252 ? ? ? A . n A 1 254 ASN 254 253 ? ? ? A . n A 1 255 MET 255 254 ? ? ? A . n # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 'complete point assembly' ? tetradecameric 14 2 'point asymmetric unit' ? monomeric 1 3 'point asymmetric unit, std point frame' ? monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 '(1-14)' A 2 1 A 3 P A # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] P 'transform to point frame' ? ? -1.00000000 -0.00000075 -0.00000056 142.00018 -0.00000075 1.00000000 -0.00000032 -141.99984 0.00000056 -0.00000032 -1.00000000 141.99999 1 'point symmetry operation' ? ? 1.00000000 0.00000000 0.00000000 0.00000 0.00000000 1.00000000 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 0.00000 2 'point symmetry operation' ? ? 0.62348980 0.78183148 -0.00000046 -57.55555 -0.78183148 0.62348980 -0.00000032 164.48456 0.00000004 0.00000056 1.00000000 -0.00008 3 'point symmetry operation' ? ? -0.22252093 0.97492791 -0.00000100 35.15835 -0.97492791 -0.22252093 -0.00000015 312.03774 -0.00000037 0.00000094 1.00000000 -0.00008 4 'point symmetry operation' ? ? -0.90096887 0.43388374 -0.00000120 208.32625 -0.43388374 -0.90096887 0.00000037 331.54900 -0.00000093 0.00000085 1.00000000 0.00001 5 'point symmetry operation' ? ? -0.90096887 -0.43388374 -0.00000093 331.54919 0.43388374 -0.90096887 0.00000085 208.32595 -0.00000120 0.00000037 1.00000000 0.00012 6 'point symmetry operation' ? ? -0.22252093 -0.97492791 -0.00000037 312.03777 0.97492791 -0.22252093 0.00000094 35.15807 -0.00000100 -0.00000015 1.00000000 0.00016 7 'point symmetry operation' ? ? 0.62348980 -0.78183148 0.00000004 164.48450 0.78183148 0.62348980 0.00000056 -57.55570 -0.00000046 -0.00000032 1.00000000 0.00011 8 'point symmetry operation' ? ? 1.00000000 0.00000150 0.00000112 -0.00037 0.00000150 -1.00000000 0.00000000 283.99977 0.00000112 0.00000000 -1.00000000 283.99989 9 'point symmetry operation' ? ? 0.62348863 0.78183242 0.00000066 -57.55568 0.78183242 -0.62348863 0.00000032 119.51513 0.00000066 0.00000032 -1.00000000 283.99991 10 'point symmetry operation' ? ? -0.22252240 0.97492758 0.00000012 35.15845 0.97492758 0.22252240 0.00000015 -28.03792 0.00000012 0.00000015 -1.00000000 284.00001 11 'point symmetry operation' ? ? -0.90096952 0.43388239 -0.00000008 208.32638 0.43388239 0.90096952 -0.00000037 -47.54892 -0.00000008 -0.00000037 -1.00000000 284.00011 12 'point symmetry operation' ? ? -0.90096822 -0.43388509 0.00000019 331.54913 -0.43388509 0.90096822 -0.00000085 75.67431 0.00000019 -0.00000085 -1.00000000 284.00014 13 'point symmetry operation' ? ? -0.22251947 -0.97492825 0.00000075 312.03745 -0.97492825 0.22251947 -0.00000094 248.84217 0.00000075 -0.00000094 -1.00000000 284.00008 14 'point symmetry operation' ? ? 0.62349097 -0.78183055 0.00000116 164.48405 -0.78183055 -0.62349097 -0.00000056 341.55572 0.00000116 -0.00000056 -1.00000000 283.99996 # _pdbx_point_symmetry.entry_id 7E55 _pdbx_point_symmetry.Schoenflies_symbol D _pdbx_point_symmetry.circular_symmetry 7 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-05-05 2 'Structure model' 1 1 2021-05-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.pdbx_database_id_PubMed' 2 2 'Structure model' '_citation.title' 3 2 'Structure model' '_citation_author.identifier_ORCID' # _em_3d_fitting.entry_id 7E55 _em_3d_fitting.id 1 _em_3d_fitting.details ? _em_3d_fitting.overall_b_value 531 _em_3d_fitting.ref_protocol 'FLEXIBLE FIT' _em_3d_fitting.ref_space REAL _em_3d_fitting.target_criteria ? _em_3d_fitting.method ? # _em_3d_fitting_list.3d_fitting_id 1 _em_3d_fitting_list.id 1 _em_3d_fitting_list.details ? _em_3d_fitting_list.pdb_chain_id ? _em_3d_fitting_list.pdb_chain_residue_range 2-245 _em_3d_fitting_list.pdb_entry_id 5DSV # _em_3d_reconstruction.entry_id 7E55 _em_3d_reconstruction.id 1 _em_3d_reconstruction.algorithm 'BACK PROJECTION' _em_3d_reconstruction.details ? _em_3d_reconstruction.refinement_type ? _em_3d_reconstruction.image_processing_id 1 _em_3d_reconstruction.num_class_averages ? _em_3d_reconstruction.num_particles 18388 _em_3d_reconstruction.resolution 5.9 _em_3d_reconstruction.resolution_method 'FSC 0.143 CUT-OFF' _em_3d_reconstruction.symmetry_type POINT _em_3d_reconstruction.method ? _em_3d_reconstruction.nominal_pixel_size ? _em_3d_reconstruction.actual_pixel_size ? _em_3d_reconstruction.magnification_calibration ? _em_3d_reconstruction.citation_id ? _em_3d_reconstruction.euler_angles_details ? # _em_buffer.id 1 _em_buffer.details ? _em_buffer.pH 7.5 _em_buffer.specimen_id 1 _em_buffer.name ? # _em_entity_assembly.id 1 _em_entity_assembly.parent_id 0 _em_entity_assembly.details ? _em_entity_assembly.name 'Proteasome subunit alpha type-7' _em_entity_assembly.source RECOMBINANT _em_entity_assembly.type COMPLEX _em_entity_assembly.entity_id_list 1 _em_entity_assembly.synonym ? _em_entity_assembly.oligomeric_details ? # _em_image_scans.entry_id 7E55 _em_image_scans.id 1 _em_image_scans.dimension_height 3840 _em_image_scans.dimension_width 5120 _em_image_scans.frames_per_image 25 _em_image_scans.image_recording_id 1 _em_image_scans.sampling_size 6.4 _em_image_scans.scanner_model ? _em_image_scans.used_frames_per_image ? _em_image_scans.citation_id ? _em_image_scans.number_digital_images ? _em_image_scans.od_range ? _em_image_scans.quant_bit_size ? _em_image_scans.details ? # _em_imaging.id 1 _em_imaging.entry_id 7E55 _em_imaging.accelerating_voltage 200 _em_imaging.alignment_procedure BASIC _em_imaging.c2_aperture_diameter 40 _em_imaging.calibrated_defocus_max ? _em_imaging.calibrated_defocus_min ? _em_imaging.calibrated_magnification 45065 _em_imaging.cryogen NITROGEN _em_imaging.details ? _em_imaging.electron_source 'FIELD EMISSION GUN' _em_imaging.illumination_mode 'FLOOD BEAM' _em_imaging.microscope_model 'JEOL 2200FS' _em_imaging.mode 'BRIGHT FIELD' _em_imaging.nominal_cs 4.2 _em_imaging.nominal_defocus_max 3000 _em_imaging.nominal_defocus_min 1000 _em_imaging.nominal_magnification 40000 _em_imaging.recording_temperature_maximum 77 _em_imaging.recording_temperature_minimum 76 _em_imaging.residual_tilt ? _em_imaging.specimen_holder_model 'GATAN 626 SINGLE TILT LIQUID NITROGEN CRYO TRANSFER HOLDER' _em_imaging.specimen_id 1 _em_imaging.citation_id ? _em_imaging.date ? _em_imaging.temperature ? _em_imaging.tilt_angle_min ? _em_imaging.tilt_angle_max ? _em_imaging.astigmatism ? _em_imaging.detector_distance ? _em_imaging.electron_beam_tilt_params ? _em_imaging.specimen_holder_type ? # _em_sample_support.id 1 _em_sample_support.specimen_id 1 _em_sample_support.details ? _em_sample_support.grid_material MOLYBDENUM _em_sample_support.grid_mesh_size 200 _em_sample_support.grid_type 'Quantifoil R1.2/1.3' _em_sample_support.method ? _em_sample_support.film_material ? _em_sample_support.citation_id ? # _em_vitrification.id 1 _em_vitrification.specimen_id 1 _em_vitrification.chamber_temperature 277 _em_vitrification.cryogen_name ETHANE _em_vitrification.details ? _em_vitrification.humidity 95 _em_vitrification.instrument ? _em_vitrification.entry_id 7E55 _em_vitrification.citation_id ? _em_vitrification.method ? _em_vitrification.temp ? _em_vitrification.time_resolved_state ? # _em_experiment.entry_id 7E55 _em_experiment.id 1 _em_experiment.aggregation_state PARTICLE _em_experiment.reconstruction_method 'SINGLE PARTICLE' _em_experiment.entity_assembly_id 1 # _em_single_particle_entity.entry_id 7E55 _em_single_particle_entity.id 1 _em_single_particle_entity.image_processing_id 1 _em_single_particle_entity.point_symmetry D7 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CA _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 LEU _pdbx_validate_rmsd_angle.auth_seq_id_1 213 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CB _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 LEU _pdbx_validate_rmsd_angle.auth_seq_id_2 213 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CG _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 LEU _pdbx_validate_rmsd_angle.auth_seq_id_3 213 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 130.59 _pdbx_validate_rmsd_angle.angle_target_value 115.30 _pdbx_validate_rmsd_angle.angle_deviation 15.29 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.30 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 70 ? ? -129.95 -169.49 2 1 TYR A 122 ? ? -95.50 31.64 3 1 TYR A 125 ? ? -117.47 -169.09 4 1 SER A 126 ? ? -140.13 17.30 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 TRP _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 215 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 VAL _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 216 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 139.51 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 0 ? A MET 1 2 1 Y 1 A SER 1 ? A SER 2 3 1 Y 1 A GLU 246 ? A GLU 247 4 1 Y 1 A ASP 247 ? A ASP 248 5 1 Y 1 A GLU 248 ? A GLU 249 6 1 Y 1 A SER 249 ? A SER 250 7 1 Y 1 A ASP 250 ? A ASP 251 8 1 Y 1 A ASP 251 ? A ASP 252 9 1 Y 1 A ASP 252 ? A ASP 253 10 1 Y 1 A ASN 253 ? A ASN 254 11 1 Y 1 A MET 254 ? A MET 255 # _em_ctf_correction.id 1 _em_ctf_correction.em_image_processing_id 1 _em_ctf_correction.type 'PHASE FLIPPING ONLY' _em_ctf_correction.details ? # _em_embedding.id 1 _em_embedding.details ? _em_embedding.specimen_id 1 _em_embedding.material Ice # _em_entity_assembly_naturalsource.id 2 _em_entity_assembly_naturalsource.entity_assembly_id 1 _em_entity_assembly_naturalsource.cell ? _em_entity_assembly_naturalsource.cellular_location ? _em_entity_assembly_naturalsource.ncbi_tax_id 9606 _em_entity_assembly_naturalsource.organ ? _em_entity_assembly_naturalsource.organelle ? _em_entity_assembly_naturalsource.organism 'Homo sapiens' _em_entity_assembly_naturalsource.strain ? _em_entity_assembly_naturalsource.tissue ? # _em_entity_assembly_recombinant.id 2 _em_entity_assembly_recombinant.entity_assembly_id 1 _em_entity_assembly_recombinant.cell ? _em_entity_assembly_recombinant.ncbi_tax_id 562 _em_entity_assembly_recombinant.organism 'Escherichia coli' _em_entity_assembly_recombinant.plasmid ? _em_entity_assembly_recombinant.strain ? # _em_image_processing.id 1 _em_image_processing.image_recording_id 1 _em_image_processing.details ? # _em_image_recording.id 1 _em_image_recording.imaging_id 1 _em_image_recording.avg_electron_dose_per_image 40 _em_image_recording.average_exposure_time 5 _em_image_recording.details ? _em_image_recording.detector_mode ? _em_image_recording.film_or_detector_model 'DIRECT ELECTRON DE-20 (5k x 3k)' _em_image_recording.num_diffraction_images ? _em_image_recording.num_grids_imaged ? _em_image_recording.num_real_images ? # _em_imaging_optics.id 1 _em_imaging_optics.imaging_id 1 _em_imaging_optics.chr_aberration_corrector ? _em_imaging_optics.energyfilter_lower ? _em_imaging_optics.energyfilter_name 'In-column Omega Filter' _em_imaging_optics.energyfilter_upper ? _em_imaging_optics.energyfilter_slit_width 20 _em_imaging_optics.phase_plate ? _em_imaging_optics.sph_aberration_corrector ? # loop_ _em_software.id _em_software.category _em_software.details _em_software.name _em_software.version _em_software.image_processing_id _em_software.fitting_id _em_software.imaging_id 1 'PARTICLE SELECTION' ? RELION 3.1 1 ? ? 2 'IMAGE ACQUISITION' ? RELION 3.1 ? ? 1 3 MASKING ? ? ? ? ? ? 4 'CTF CORRECTION' ? CTFFIND 4 1 ? ? 5 'LAYERLINE INDEXING' ? ? ? ? ? ? 6 'DIFFRACTION INDEXING' ? ? ? ? ? ? 7 'MODEL FITTING' ? PHENIX ? ? 1 ? 8 OTHER ? ? ? ? ? ? 9 'INITIAL EULER ASSIGNMENT' ? RELION 3.1 1 ? ? 10 'FINAL EULER ASSIGNMENT' ? RELION 3.1 1 ? ? 11 CLASSIFICATION ? ? ? 1 ? ? 12 RECONSTRUCTION ? RELION 3.1 1 ? ? 13 'MODEL REFINEMENT' ? ? ? ? 1 ? # _em_specimen.id 1 _em_specimen.experiment_id 1 _em_specimen.concentration 1.0 _em_specimen.details ? _em_specimen.embedding_applied YES _em_specimen.shadowing_applied NO _em_specimen.staining_applied NO _em_specimen.vitrification_applied YES # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Japan Society for the Promotion of Science (JSPS)' Japan JP19K16088 1 'Japan Society for the Promotion of Science (JSPS)' Japan JP18H05229 2 'Japan Society for the Promotion of Science (JSPS)' Japan JP18H05534 3 'Japan Society for the Promotion of Science (JSPS)' Japan JP18H03681 4 'Ministry of Education, Culture, Sports, Science and Technology (Japan)' Japan JP16H06280 5 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support SAXS _pdbx_struct_assembly_auth_evidence.details ? #