data_7E66 # _entry.id 7E66 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7E66 pdb_00007e66 10.2210/pdb7e66/pdb WWPDB D_1300020834 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 7E60 unspecified PDB . 7E61 unspecified PDB . 7E63 unspecified PDB . 7E64 unspecified PDB . 7E65 unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7E66 _pdbx_database_status.recvd_initial_deposition_date 2021-02-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Choi, Y.' 1 0000-0002-9188-3747 'Min, K.J.' 2 0000-0002-9864-2022 'Yoon, H.J.' 3 ? 'Lee, H.H.' 4 0000-0003-1168-2484 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Commun Biol' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2399-3642 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 5 _citation.language ? _citation.page_first 395 _citation.page_last ? _citation.title 'Structure-based inhibitor design for reshaping bacterial morphology' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s42003-022-03355-3 _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Choi, Y.' 1 ? primary 'Park, J.S.' 2 ? primary 'Kim, J.' 3 ? primary 'Min, K.' 4 ? primary 'Mahasenan, K.' 5 ? primary 'Kim, C.' 6 ? primary 'Yoon, H.J.' 7 ? primary 'Lim, S.' 8 ? primary 'Cheon, D.H.' 9 ? primary 'Lee, Y.' 10 ? primary 'Ryu, S.' 11 ? primary 'Mobashery, S.' 12 ? primary 'Kim, B.M.' 13 ? primary 'Lee, H.H.' 14 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7E66 _cell.details ? _cell.formula_units_Z ? _cell.length_a 115.410 _cell.length_a_esd ? _cell.length_b 115.410 _cell.length_b_esd ? _cell.length_c 56.990 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7E66 _symmetry.cell_setting ? _symmetry.Int_Tables_number 169 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 61' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Peptidase M23' 28463.752 1 ? H247A ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 non-polymer syn 'N-[2-(oxidanylamino)-2-oxidanylidene-ethyl]-2-(4-sulfamoylphenyl)ethanamide' 287.292 1 ? ? ? ? 4 water nat water 18.015 7 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MELIKGQALFLELDKKDFLSLKNNDKNIPTFAHPKNQEKILAIFSLPYKNPPQNTKLIAFYKDKKEEIFIKTLEGNYKSE KLQVENKKIFPPKTIQERIAKELKEANAIYSSYTPKALFNGAFNIPLNSFITSDFGKARTFNEKVASYHSGTDFRAATGT PIYAANSGVVKIAKDRYFAGNSVVIDHGFGIYSQYYHLSKIDVKVGQKIKKGELIGLSGASGRVSGPALHFGILAGGKQV DPLDFVSKFNAIFQL ; _entity_poly.pdbx_seq_one_letter_code_can ;MELIKGQALFLELDKKDFLSLKNNDKNIPTFAHPKNQEKILAIFSLPYKNPPQNTKLIAFYKDKKEEIFIKTLEGNYKSE KLQVENKKIFPPKTIQERIAKELKEANAIYSSYTPKALFNGAFNIPLNSFITSDFGKARTFNEKVASYHSGTDFRAATGT PIYAANSGVVKIAKDRYFAGNSVVIDHGFGIYSQYYHLSKIDVKVGQKIKKGELIGLSGASGRVSGPALHFGILAGGKQV DPLDFVSKFNAIFQL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 LEU n 1 4 ILE n 1 5 LYS n 1 6 GLY n 1 7 GLN n 1 8 ALA n 1 9 LEU n 1 10 PHE n 1 11 LEU n 1 12 GLU n 1 13 LEU n 1 14 ASP n 1 15 LYS n 1 16 LYS n 1 17 ASP n 1 18 PHE n 1 19 LEU n 1 20 SER n 1 21 LEU n 1 22 LYS n 1 23 ASN n 1 24 ASN n 1 25 ASP n 1 26 LYS n 1 27 ASN n 1 28 ILE n 1 29 PRO n 1 30 THR n 1 31 PHE n 1 32 ALA n 1 33 HIS n 1 34 PRO n 1 35 LYS n 1 36 ASN n 1 37 GLN n 1 38 GLU n 1 39 LYS n 1 40 ILE n 1 41 LEU n 1 42 ALA n 1 43 ILE n 1 44 PHE n 1 45 SER n 1 46 LEU n 1 47 PRO n 1 48 TYR n 1 49 LYS n 1 50 ASN n 1 51 PRO n 1 52 PRO n 1 53 GLN n 1 54 ASN n 1 55 THR n 1 56 LYS n 1 57 LEU n 1 58 ILE n 1 59 ALA n 1 60 PHE n 1 61 TYR n 1 62 LYS n 1 63 ASP n 1 64 LYS n 1 65 LYS n 1 66 GLU n 1 67 GLU n 1 68 ILE n 1 69 PHE n 1 70 ILE n 1 71 LYS n 1 72 THR n 1 73 LEU n 1 74 GLU n 1 75 GLY n 1 76 ASN n 1 77 TYR n 1 78 LYS n 1 79 SER n 1 80 GLU n 1 81 LYS n 1 82 LEU n 1 83 GLN n 1 84 VAL n 1 85 GLU n 1 86 ASN n 1 87 LYS n 1 88 LYS n 1 89 ILE n 1 90 PHE n 1 91 PRO n 1 92 PRO n 1 93 LYS n 1 94 THR n 1 95 ILE n 1 96 GLN n 1 97 GLU n 1 98 ARG n 1 99 ILE n 1 100 ALA n 1 101 LYS n 1 102 GLU n 1 103 LEU n 1 104 LYS n 1 105 GLU n 1 106 ALA n 1 107 ASN n 1 108 ALA n 1 109 ILE n 1 110 TYR n 1 111 SER n 1 112 SER n 1 113 TYR n 1 114 THR n 1 115 PRO n 1 116 LYS n 1 117 ALA n 1 118 LEU n 1 119 PHE n 1 120 ASN n 1 121 GLY n 1 122 ALA n 1 123 PHE n 1 124 ASN n 1 125 ILE n 1 126 PRO n 1 127 LEU n 1 128 ASN n 1 129 SER n 1 130 PHE n 1 131 ILE n 1 132 THR n 1 133 SER n 1 134 ASP n 1 135 PHE n 1 136 GLY n 1 137 LYS n 1 138 ALA n 1 139 ARG n 1 140 THR n 1 141 PHE n 1 142 ASN n 1 143 GLU n 1 144 LYS n 1 145 VAL n 1 146 ALA n 1 147 SER n 1 148 TYR n 1 149 HIS n 1 150 SER n 1 151 GLY n 1 152 THR n 1 153 ASP n 1 154 PHE n 1 155 ARG n 1 156 ALA n 1 157 ALA n 1 158 THR n 1 159 GLY n 1 160 THR n 1 161 PRO n 1 162 ILE n 1 163 TYR n 1 164 ALA n 1 165 ALA n 1 166 ASN n 1 167 SER n 1 168 GLY n 1 169 VAL n 1 170 VAL n 1 171 LYS n 1 172 ILE n 1 173 ALA n 1 174 LYS n 1 175 ASP n 1 176 ARG n 1 177 TYR n 1 178 PHE n 1 179 ALA n 1 180 GLY n 1 181 ASN n 1 182 SER n 1 183 VAL n 1 184 VAL n 1 185 ILE n 1 186 ASP n 1 187 HIS n 1 188 GLY n 1 189 PHE n 1 190 GLY n 1 191 ILE n 1 192 TYR n 1 193 SER n 1 194 GLN n 1 195 TYR n 1 196 TYR n 1 197 HIS n 1 198 LEU n 1 199 SER n 1 200 LYS n 1 201 ILE n 1 202 ASP n 1 203 VAL n 1 204 LYS n 1 205 VAL n 1 206 GLY n 1 207 GLN n 1 208 LYS n 1 209 ILE n 1 210 LYS n 1 211 LYS n 1 212 GLY n 1 213 GLU n 1 214 LEU n 1 215 ILE n 1 216 GLY n 1 217 LEU n 1 218 SER n 1 219 GLY n 1 220 ALA n 1 221 SER n 1 222 GLY n 1 223 ARG n 1 224 VAL n 1 225 SER n 1 226 GLY n 1 227 PRO n 1 228 ALA n 1 229 LEU n 1 230 HIS n 1 231 PHE n 1 232 GLY n 1 233 ILE n 1 234 LEU n 1 235 ALA n 1 236 GLY n 1 237 GLY n 1 238 LYS n 1 239 GLN n 1 240 VAL n 1 241 ASP n 1 242 PRO n 1 243 LEU n 1 244 ASP n 1 245 PHE n 1 246 VAL n 1 247 SER n 1 248 LYS n 1 249 PHE n 1 250 ASN n 1 251 ALA n 1 252 ILE n 1 253 PHE n 1 254 GLN n 1 255 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 255 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene A8118_01115 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Campylobacter jejuni' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 197 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A1J6PWI8_CAMJU _struct_ref.pdbx_db_accession A0A1J6PWI8 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ELIKGQALFLELDKKDFLSLKNNDKNIPTFAHPKNQEKILAIFSLPYKNPPQNTKLIAFYKDKKEEIFIKTLEGNYKSEK LQVENKKIFPPKTIQERIAKELKEANAIYSSYTPKALFNGAFNIPLNSFITSDFGKARTFNEKVASYHSGTDFRAATGTP IYAANSGVVKIAKDRYFAGNSVVIDHGFGIYSQYYHLSKIDVKVGQKIKKGELIGLSGASGRVSGPHLHFGILAGGKQVD PLDFVSKFNAIFQ ; _struct_ref.pdbx_align_begin 21 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7E66 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 254 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A1J6PWI8 _struct_ref_seq.db_align_beg 21 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 273 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 21 _struct_ref_seq.pdbx_auth_seq_align_end 273 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7E66 MET A 1 ? UNP A0A1J6PWI8 ? ? 'initiating methionine' 20 1 1 7E66 ALA A 228 ? UNP A0A1J6PWI8 HIS 247 'engineered mutation' 247 2 1 7E66 LEU A 255 ? UNP A0A1J6PWI8 ? ? 'expression tag' 274 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 HY6 non-polymer . 'N-[2-(oxidanylamino)-2-oxidanylidene-ethyl]-2-(4-sulfamoylphenyl)ethanamide' ? 'C10 H13 N3 O5 S' 287.292 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7E66 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.85 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 68.05 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 296 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M potassium sodium tartrate tetrahydrate, 0.1 M sodium citrate tribasic dihydrate pH 5.6 and 2 M ammonium sulfate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-07-22 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PAL/PLS BEAMLINE 5C (4A)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline '5C (4A)' _diffrn_source.pdbx_synchrotron_site PAL/PLS # _reflns.B_iso_Wilson_estimate 61.697 _reflns.entry_id 7E66 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.840 _reflns.d_resolution_low 28.850 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 19937 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.700 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.317 _reflns.pdbx_Rmerge_I_obs 0.143 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.550 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.824 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.159 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 106009 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.992 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.840 3.010 ? 1.390 ? 16983 3195 ? 3162 99.000 ? ? ? ? 0.897 ? ? ? ? ? ? ? ? 5.371 ? ? ? ? 0.994 ? ? 1 1 0.682 ? ? ? ? ? ? ? ? ? ? 3.010 3.220 ? 2.480 ? 16072 3026 ? 3020 99.800 ? ? ? ? 0.517 ? ? ? ? ? ? ? ? 5.322 ? ? ? ? 0.573 ? ? 2 1 0.861 ? ? ? ? ? ? ? ? ? ? 3.220 3.470 ? 4.450 ? 14057 2816 ? 2813 99.900 ? ? ? ? 0.289 ? ? ? ? ? ? ? ? 4.997 ? ? ? ? 0.324 ? ? 3 1 0.938 ? ? ? ? ? ? ? ? ? ? 3.470 3.800 ? 7.760 ? 14060 2585 ? 2582 99.900 ? ? ? ? 0.183 ? ? ? ? ? ? ? ? 5.445 ? ? ? ? 0.203 ? ? 4 1 0.978 ? ? ? ? ? ? ? ? ? ? 3.800 4.240 ? 11.390 ? 13018 2333 ? 2331 99.900 ? ? ? ? 0.134 ? ? ? ? ? ? ? ? 5.585 ? ? ? ? 0.148 ? ? 5 1 0.986 ? ? ? ? ? ? ? ? ? ? 4.240 4.870 ? 15.240 ? 11244 2077 ? 2075 99.900 ? ? ? ? 0.102 ? ? ? ? ? ? ? ? 5.419 ? ? ? ? 0.113 ? ? 6 1 0.989 ? ? ? ? ? ? ? ? ? ? 4.870 5.930 ? 14.900 ? 9172 1766 ? 1765 99.900 ? ? ? ? 0.102 ? ? ? ? ? ? ? ? 5.197 ? ? ? ? 0.113 ? ? 7 1 0.988 ? ? ? ? ? ? ? ? ? ? 5.930 8.210 ? 16.500 ? 6918 1380 ? 1380 100.000 ? ? ? ? 0.087 ? ? ? ? ? ? ? ? 5.013 ? ? ? ? 0.097 ? ? 8 1 0.989 ? ? ? ? ? ? ? ? ? ? 8.210 28.850 ? 23.120 ? 4485 825 ? 809 98.100 ? ? ? ? 0.071 ? ? ? ? ? ? ? ? 5.544 ? ? ? ? 0.078 ? ? 9 1 0.994 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] -0.5600 _refine.aniso_B[1][2] -0.2800 _refine.aniso_B[1][3] -0.0000 _refine.aniso_B[2][2] -0.5600 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 1.8200 _refine.B_iso_max 121.870 _refine.B_iso_mean 70.1650 _refine.B_iso_min 43.820 _refine.correlation_coeff_Fo_to_Fc 0.9420 _refine.correlation_coeff_Fo_to_Fc_free 0.9250 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7E66 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.8400 _refine.ls_d_res_low 28.8500 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9852 _refine.ls_number_reflns_R_free 519 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.8900 _refine.ls_percent_reflns_R_free 5.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2147 _refine.ls_R_factor_R_free 0.2412 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2133 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6JMZ _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.6780 _refine.pdbx_overall_ESU_R_Free 0.3170 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 14.1860 _refine.overall_SU_ML 0.2600 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.8400 _refine_hist.d_res_low 28.8500 _refine_hist.number_atoms_solvent 7 _refine_hist.number_atoms_total 2041 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 255 _refine_hist.pdbx_B_iso_mean_ligand 90.69 _refine_hist.pdbx_B_iso_mean_solvent 53.15 _refine_hist.pdbx_number_atoms_protein 2014 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 20 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.004 0.019 2079 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 2039 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 0.986 1.977 2798 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.621 3.000 4710 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.272 5.000 254 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 37.018 24.944 89 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 17.405 15.000 376 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 8.628 15.000 5 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.057 0.200 300 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 0.021 2330 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 477 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.8410 _refine_ls_shell.d_res_low 2.9140 _refine_ls_shell.number_reflns_all 736 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 37 _refine_ls_shell.number_reflns_R_work 699 _refine_ls_shell.percent_reflns_obs 100.0000 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.4000 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.3530 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7E66 _struct.title 'The crystal structure of peptidoglycan peptidase in complex with inhibitor 3-1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7E66 _struct_keywords.text 'HYDROLASE-INHIBITOR COMPLEX' _struct_keywords.pdbx_keywords HYDROLASE/INHIBITOR # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 92 ? SER A 111 ? PRO A 111 SER A 130 1 ? 20 HELX_P HELX_P2 AA2 ASP A 241 ? GLN A 254 ? ASP A 260 GLN A 273 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 149 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 168 A ZN 301 1_555 ? ? ? ? ? ? ? 2.116 ? ? metalc2 metalc ? ? A ASP 153 OD1 ? ? ? 1_555 B ZN . ZN ? ? A ASP 172 A ZN 301 1_555 ? ? ? ? ? ? ? 2.085 ? ? metalc3 metalc ? ? A ASP 153 OD2 ? ? ? 1_555 B ZN . ZN ? ? A ASP 172 A ZN 301 1_555 ? ? ? ? ? ? ? 2.601 ? ? metalc4 metalc ? ? A HIS 230 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 249 A ZN 301 1_555 ? ? ? ? ? ? ? 2.183 ? ? metalc5 metalc ? ? B ZN . ZN ? ? ? 1_555 C HY6 . O3 ? ? A ZN 301 A HY6 302 1_555 ? ? ? ? ? ? ? 1.893 ? ? metalc6 metalc ? ? B ZN . ZN ? ? ? 1_555 C HY6 . N2 ? ? A ZN 301 A HY6 302 1_555 ? ? ? ? ? ? ? 2.155 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 3 ? AA3 ? 3 ? AA4 ? 7 ? AA5 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? parallel AA3 2 3 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA4 3 4 ? anti-parallel AA4 4 5 ? anti-parallel AA4 5 6 ? anti-parallel AA4 6 7 ? anti-parallel AA5 1 2 ? anti-parallel AA5 2 3 ? anti-parallel AA5 3 4 ? anti-parallel AA5 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 2 ? ILE A 4 ? GLU A 21 ILE A 23 AA1 2 LYS A 65 ? LEU A 73 ? LYS A 84 LEU A 92 AA1 3 ASN A 54 ? TYR A 61 ? ASN A 73 TYR A 80 AA1 4 PHE A 18 ? ASN A 23 ? PHE A 37 ASN A 42 AA1 5 LYS A 26 ? ASN A 27 ? LYS A 45 ASN A 46 AA2 1 ALA A 8 ? ASP A 14 ? ALA A 27 ASP A 33 AA2 2 LYS A 39 ? SER A 45 ? LYS A 58 SER A 64 AA2 3 PHE A 31 ? ALA A 32 ? PHE A 50 ALA A 51 AA3 1 SER A 79 ? LYS A 81 ? SER A 98 LYS A 100 AA3 2 ALA A 138 ? PHE A 141 ? ALA A 157 PHE A 160 AA3 3 LYS A 144 ? TYR A 148 ? LYS A 163 TYR A 167 AA4 1 ILE A 131 ? SER A 133 ? ILE A 150 SER A 152 AA4 2 THR A 152 ? PHE A 154 ? THR A 171 PHE A 173 AA4 3 LEU A 229 ? ALA A 235 ? LEU A 248 ALA A 254 AA4 4 TYR A 192 ? ILE A 201 ? TYR A 211 ILE A 220 AA4 5 GLY A 180 ? ASP A 186 ? GLY A 199 ASP A 205 AA4 6 GLY A 168 ? ARG A 176 ? GLY A 187 ARG A 195 AA4 7 LYS A 208 ? ILE A 209 ? LYS A 227 ILE A 228 AA5 1 PRO A 161 ? TYR A 163 ? PRO A 180 TYR A 182 AA5 2 LEU A 214 ? SER A 218 ? LEU A 233 SER A 237 AA5 3 TYR A 192 ? ILE A 201 ? TYR A 211 ILE A 220 AA5 4 LEU A 229 ? ALA A 235 ? LEU A 248 ALA A 254 AA5 5 LYS A 238 ? VAL A 240 ? LYS A 257 VAL A 259 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 3 ? N LEU A 22 O LYS A 71 ? O LYS A 90 AA1 2 3 O GLU A 66 ? O GLU A 85 N ALA A 59 ? N ALA A 78 AA1 3 4 O PHE A 60 ? O PHE A 79 N LEU A 19 ? N LEU A 38 AA1 4 5 N ASN A 23 ? N ASN A 42 O LYS A 26 ? O LYS A 45 AA2 1 2 N LEU A 11 ? N LEU A 30 O ALA A 42 ? O ALA A 61 AA2 2 3 O LEU A 41 ? O LEU A 60 N PHE A 31 ? N PHE A 50 AA3 1 2 N GLU A 80 ? N GLU A 99 O THR A 140 ? O THR A 159 AA3 2 3 N ARG A 139 ? N ARG A 158 O SER A 147 ? O SER A 166 AA4 1 2 N THR A 132 ? N THR A 151 O ASP A 153 ? O ASP A 172 AA4 2 3 N THR A 152 ? N THR A 171 O PHE A 231 ? O PHE A 250 AA4 3 4 O LEU A 234 ? O LEU A 253 N TYR A 192 ? N TYR A 211 AA4 4 5 O TYR A 195 ? O TYR A 214 N VAL A 183 ? N VAL A 202 AA4 5 6 O ASP A 186 ? O ASP A 205 N VAL A 169 ? N VAL A 188 AA4 6 7 N GLY A 168 ? N GLY A 187 O ILE A 209 ? O ILE A 228 AA5 1 2 N ILE A 162 ? N ILE A 181 O GLY A 216 ? O GLY A 235 AA5 2 3 O LEU A 217 ? O LEU A 236 N SER A 199 ? N SER A 218 AA5 3 4 N TYR A 192 ? N TYR A 211 O LEU A 234 ? O LEU A 253 AA5 4 5 N ALA A 235 ? N ALA A 254 O LYS A 238 ? O LYS A 257 # _atom_sites.entry_id 7E66 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.008665 _atom_sites.fract_transf_matrix[1][2] 0.005003 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010005 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017547 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S ZN # loop_ # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 20 20 MET MET A . n A 1 2 GLU 2 21 21 GLU GLU A . n A 1 3 LEU 3 22 22 LEU LEU A . n A 1 4 ILE 4 23 23 ILE ILE A . n A 1 5 LYS 5 24 24 LYS LYS A . n A 1 6 GLY 6 25 25 GLY GLY A . n A 1 7 GLN 7 26 26 GLN GLN A . n A 1 8 ALA 8 27 27 ALA ALA A . n A 1 9 LEU 9 28 28 LEU LEU A . n A 1 10 PHE 10 29 29 PHE PHE A . n A 1 11 LEU 11 30 30 LEU LEU A . n A 1 12 GLU 12 31 31 GLU GLU A . n A 1 13 LEU 13 32 32 LEU LEU A . n A 1 14 ASP 14 33 33 ASP ASP A . n A 1 15 LYS 15 34 34 LYS LYS A . n A 1 16 LYS 16 35 35 LYS LYS A . n A 1 17 ASP 17 36 36 ASP ASP A . n A 1 18 PHE 18 37 37 PHE PHE A . n A 1 19 LEU 19 38 38 LEU LEU A . n A 1 20 SER 20 39 39 SER SER A . n A 1 21 LEU 21 40 40 LEU LEU A . n A 1 22 LYS 22 41 41 LYS LYS A . n A 1 23 ASN 23 42 42 ASN ASN A . n A 1 24 ASN 24 43 43 ASN ASN A . n A 1 25 ASP 25 44 44 ASP ASP A . n A 1 26 LYS 26 45 45 LYS LYS A . n A 1 27 ASN 27 46 46 ASN ASN A . n A 1 28 ILE 28 47 47 ILE ILE A . n A 1 29 PRO 29 48 48 PRO PRO A . n A 1 30 THR 30 49 49 THR THR A . n A 1 31 PHE 31 50 50 PHE PHE A . n A 1 32 ALA 32 51 51 ALA ALA A . n A 1 33 HIS 33 52 52 HIS HIS A . n A 1 34 PRO 34 53 53 PRO PRO A . n A 1 35 LYS 35 54 54 LYS LYS A . n A 1 36 ASN 36 55 55 ASN ASN A . n A 1 37 GLN 37 56 56 GLN GLN A . n A 1 38 GLU 38 57 57 GLU GLU A . n A 1 39 LYS 39 58 58 LYS LYS A . n A 1 40 ILE 40 59 59 ILE ILE A . n A 1 41 LEU 41 60 60 LEU LEU A . n A 1 42 ALA 42 61 61 ALA ALA A . n A 1 43 ILE 43 62 62 ILE ILE A . n A 1 44 PHE 44 63 63 PHE PHE A . n A 1 45 SER 45 64 64 SER SER A . n A 1 46 LEU 46 65 65 LEU LEU A . n A 1 47 PRO 47 66 66 PRO PRO A . n A 1 48 TYR 48 67 67 TYR TYR A . n A 1 49 LYS 49 68 68 LYS LYS A . n A 1 50 ASN 50 69 69 ASN ASN A . n A 1 51 PRO 51 70 70 PRO PRO A . n A 1 52 PRO 52 71 71 PRO PRO A . n A 1 53 GLN 53 72 72 GLN GLN A . n A 1 54 ASN 54 73 73 ASN ASN A . n A 1 55 THR 55 74 74 THR THR A . n A 1 56 LYS 56 75 75 LYS LYS A . n A 1 57 LEU 57 76 76 LEU LEU A . n A 1 58 ILE 58 77 77 ILE ILE A . n A 1 59 ALA 59 78 78 ALA ALA A . n A 1 60 PHE 60 79 79 PHE PHE A . n A 1 61 TYR 61 80 80 TYR TYR A . n A 1 62 LYS 62 81 81 LYS LYS A . n A 1 63 ASP 63 82 82 ASP ASP A . n A 1 64 LYS 64 83 83 LYS LYS A . n A 1 65 LYS 65 84 84 LYS LYS A . n A 1 66 GLU 66 85 85 GLU GLU A . n A 1 67 GLU 67 86 86 GLU GLU A . n A 1 68 ILE 68 87 87 ILE ILE A . n A 1 69 PHE 69 88 88 PHE PHE A . n A 1 70 ILE 70 89 89 ILE ILE A . n A 1 71 LYS 71 90 90 LYS LYS A . n A 1 72 THR 72 91 91 THR THR A . n A 1 73 LEU 73 92 92 LEU LEU A . n A 1 74 GLU 74 93 93 GLU GLU A . n A 1 75 GLY 75 94 94 GLY GLY A . n A 1 76 ASN 76 95 95 ASN ASN A . n A 1 77 TYR 77 96 96 TYR TYR A . n A 1 78 LYS 78 97 97 LYS LYS A . n A 1 79 SER 79 98 98 SER SER A . n A 1 80 GLU 80 99 99 GLU GLU A . n A 1 81 LYS 81 100 100 LYS LYS A . n A 1 82 LEU 82 101 101 LEU LEU A . n A 1 83 GLN 83 102 102 GLN GLN A . n A 1 84 VAL 84 103 103 VAL VAL A . n A 1 85 GLU 85 104 104 GLU GLU A . n A 1 86 ASN 86 105 105 ASN ASN A . n A 1 87 LYS 87 106 106 LYS LYS A . n A 1 88 LYS 88 107 107 LYS LYS A . n A 1 89 ILE 89 108 108 ILE ILE A . n A 1 90 PHE 90 109 109 PHE PHE A . n A 1 91 PRO 91 110 110 PRO PRO A . n A 1 92 PRO 92 111 111 PRO PRO A . n A 1 93 LYS 93 112 112 LYS LYS A . n A 1 94 THR 94 113 113 THR THR A . n A 1 95 ILE 95 114 114 ILE ILE A . n A 1 96 GLN 96 115 115 GLN GLN A . n A 1 97 GLU 97 116 116 GLU GLU A . n A 1 98 ARG 98 117 117 ARG ARG A . n A 1 99 ILE 99 118 118 ILE ILE A . n A 1 100 ALA 100 119 119 ALA ALA A . n A 1 101 LYS 101 120 120 LYS LYS A . n A 1 102 GLU 102 121 121 GLU GLU A . n A 1 103 LEU 103 122 122 LEU LEU A . n A 1 104 LYS 104 123 123 LYS LYS A . n A 1 105 GLU 105 124 124 GLU GLU A . n A 1 106 ALA 106 125 125 ALA ALA A . n A 1 107 ASN 107 126 126 ASN ASN A . n A 1 108 ALA 108 127 127 ALA ALA A . n A 1 109 ILE 109 128 128 ILE ILE A . n A 1 110 TYR 110 129 129 TYR TYR A . n A 1 111 SER 111 130 130 SER SER A . n A 1 112 SER 112 131 131 SER SER A . n A 1 113 TYR 113 132 132 TYR TYR A . n A 1 114 THR 114 133 133 THR THR A . n A 1 115 PRO 115 134 134 PRO PRO A . n A 1 116 LYS 116 135 135 LYS LYS A . n A 1 117 ALA 117 136 136 ALA ALA A . n A 1 118 LEU 118 137 137 LEU LEU A . n A 1 119 PHE 119 138 138 PHE PHE A . n A 1 120 ASN 120 139 139 ASN ASN A . n A 1 121 GLY 121 140 140 GLY GLY A . n A 1 122 ALA 122 141 141 ALA ALA A . n A 1 123 PHE 123 142 142 PHE PHE A . n A 1 124 ASN 124 143 143 ASN ASN A . n A 1 125 ILE 125 144 144 ILE ILE A . n A 1 126 PRO 126 145 145 PRO PRO A . n A 1 127 LEU 127 146 146 LEU LEU A . n A 1 128 ASN 128 147 147 ASN ASN A . n A 1 129 SER 129 148 148 SER SER A . n A 1 130 PHE 130 149 149 PHE PHE A . n A 1 131 ILE 131 150 150 ILE ILE A . n A 1 132 THR 132 151 151 THR THR A . n A 1 133 SER 133 152 152 SER SER A . n A 1 134 ASP 134 153 153 ASP ASP A . n A 1 135 PHE 135 154 154 PHE PHE A . n A 1 136 GLY 136 155 155 GLY GLY A . n A 1 137 LYS 137 156 156 LYS LYS A . n A 1 138 ALA 138 157 157 ALA ALA A . n A 1 139 ARG 139 158 158 ARG ARG A . n A 1 140 THR 140 159 159 THR THR A . n A 1 141 PHE 141 160 160 PHE PHE A . n A 1 142 ASN 142 161 161 ASN ASN A . n A 1 143 GLU 143 162 162 GLU GLU A . n A 1 144 LYS 144 163 163 LYS LYS A . n A 1 145 VAL 145 164 164 VAL VAL A . n A 1 146 ALA 146 165 165 ALA ALA A . n A 1 147 SER 147 166 166 SER SER A . n A 1 148 TYR 148 167 167 TYR TYR A . n A 1 149 HIS 149 168 168 HIS HIS A . n A 1 150 SER 150 169 169 SER SER A . n A 1 151 GLY 151 170 170 GLY GLY A . n A 1 152 THR 152 171 171 THR THR A . n A 1 153 ASP 153 172 172 ASP ASP A . n A 1 154 PHE 154 173 173 PHE PHE A . n A 1 155 ARG 155 174 174 ARG ARG A . n A 1 156 ALA 156 175 175 ALA ALA A . n A 1 157 ALA 157 176 176 ALA ALA A . n A 1 158 THR 158 177 177 THR THR A . n A 1 159 GLY 159 178 178 GLY GLY A . n A 1 160 THR 160 179 179 THR THR A . n A 1 161 PRO 161 180 180 PRO PRO A . n A 1 162 ILE 162 181 181 ILE ILE A . n A 1 163 TYR 163 182 182 TYR TYR A . n A 1 164 ALA 164 183 183 ALA ALA A . n A 1 165 ALA 165 184 184 ALA ALA A . n A 1 166 ASN 166 185 185 ASN ASN A . n A 1 167 SER 167 186 186 SER SER A . n A 1 168 GLY 168 187 187 GLY GLY A . n A 1 169 VAL 169 188 188 VAL VAL A . n A 1 170 VAL 170 189 189 VAL VAL A . n A 1 171 LYS 171 190 190 LYS LYS A . n A 1 172 ILE 172 191 191 ILE ILE A . n A 1 173 ALA 173 192 192 ALA ALA A . n A 1 174 LYS 174 193 193 LYS LYS A . n A 1 175 ASP 175 194 194 ASP ASP A . n A 1 176 ARG 176 195 195 ARG ARG A . n A 1 177 TYR 177 196 196 TYR TYR A . n A 1 178 PHE 178 197 197 PHE PHE A . n A 1 179 ALA 179 198 198 ALA ALA A . n A 1 180 GLY 180 199 199 GLY GLY A . n A 1 181 ASN 181 200 200 ASN ASN A . n A 1 182 SER 182 201 201 SER SER A . n A 1 183 VAL 183 202 202 VAL VAL A . n A 1 184 VAL 184 203 203 VAL VAL A . n A 1 185 ILE 185 204 204 ILE ILE A . n A 1 186 ASP 186 205 205 ASP ASP A . n A 1 187 HIS 187 206 206 HIS HIS A . n A 1 188 GLY 188 207 207 GLY GLY A . n A 1 189 PHE 189 208 208 PHE PHE A . n A 1 190 GLY 190 209 209 GLY GLY A . n A 1 191 ILE 191 210 210 ILE ILE A . n A 1 192 TYR 192 211 211 TYR TYR A . n A 1 193 SER 193 212 212 SER SER A . n A 1 194 GLN 194 213 213 GLN GLN A . n A 1 195 TYR 195 214 214 TYR TYR A . n A 1 196 TYR 196 215 215 TYR TYR A . n A 1 197 HIS 197 216 216 HIS HIS A . n A 1 198 LEU 198 217 217 LEU LEU A . n A 1 199 SER 199 218 218 SER SER A . n A 1 200 LYS 200 219 219 LYS LYS A . n A 1 201 ILE 201 220 220 ILE ILE A . n A 1 202 ASP 202 221 221 ASP ASP A . n A 1 203 VAL 203 222 222 VAL VAL A . n A 1 204 LYS 204 223 223 LYS LYS A . n A 1 205 VAL 205 224 224 VAL VAL A . n A 1 206 GLY 206 225 225 GLY GLY A . n A 1 207 GLN 207 226 226 GLN GLN A . n A 1 208 LYS 208 227 227 LYS LYS A . n A 1 209 ILE 209 228 228 ILE ILE A . n A 1 210 LYS 210 229 229 LYS LYS A . n A 1 211 LYS 211 230 230 LYS LYS A . n A 1 212 GLY 212 231 231 GLY GLY A . n A 1 213 GLU 213 232 232 GLU GLU A . n A 1 214 LEU 214 233 233 LEU LEU A . n A 1 215 ILE 215 234 234 ILE ILE A . n A 1 216 GLY 216 235 235 GLY GLY A . n A 1 217 LEU 217 236 236 LEU LEU A . n A 1 218 SER 218 237 237 SER SER A . n A 1 219 GLY 219 238 238 GLY GLY A . n A 1 220 ALA 220 239 239 ALA ALA A . n A 1 221 SER 221 240 240 SER SER A . n A 1 222 GLY 222 241 241 GLY GLY A . n A 1 223 ARG 223 242 242 ARG ARG A . n A 1 224 VAL 224 243 243 VAL VAL A . n A 1 225 SER 225 244 244 SER SER A . n A 1 226 GLY 226 245 245 GLY GLY A . n A 1 227 PRO 227 246 246 PRO PRO A . n A 1 228 ALA 228 247 247 ALA ALA A . n A 1 229 LEU 229 248 248 LEU LEU A . n A 1 230 HIS 230 249 249 HIS HIS A . n A 1 231 PHE 231 250 250 PHE PHE A . n A 1 232 GLY 232 251 251 GLY GLY A . n A 1 233 ILE 233 252 252 ILE ILE A . n A 1 234 LEU 234 253 253 LEU LEU A . n A 1 235 ALA 235 254 254 ALA ALA A . n A 1 236 GLY 236 255 255 GLY GLY A . n A 1 237 GLY 237 256 256 GLY GLY A . n A 1 238 LYS 238 257 257 LYS LYS A . n A 1 239 GLN 239 258 258 GLN GLN A . n A 1 240 VAL 240 259 259 VAL VAL A . n A 1 241 ASP 241 260 260 ASP ASP A . n A 1 242 PRO 242 261 261 PRO PRO A . n A 1 243 LEU 243 262 262 LEU LEU A . n A 1 244 ASP 244 263 263 ASP ASP A . n A 1 245 PHE 245 264 264 PHE PHE A . n A 1 246 VAL 246 265 265 VAL VAL A . n A 1 247 SER 247 266 266 SER SER A . n A 1 248 LYS 248 267 267 LYS LYS A . n A 1 249 PHE 249 268 268 PHE PHE A . n A 1 250 ASN 250 269 269 ASN ASN A . n A 1 251 ALA 251 270 270 ALA ALA A . n A 1 252 ILE 252 271 271 ILE ILE A . n A 1 253 PHE 253 272 272 PHE PHE A . n A 1 254 GLN 254 273 273 GLN GLN A . n A 1 255 LEU 255 274 274 LEU LEU A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email hyungholee@snu.ac.kr _pdbx_contact_author.name_first 'Hyung Ho' _pdbx_contact_author.name_last Lee _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-1168-2484 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 301 300 ZN ZN A . C 3 HY6 1 302 401 HY6 DRG A . D 4 HOH 1 401 5 HOH HOH A . D 4 HOH 2 402 4 HOH HOH A . D 4 HOH 3 403 6 HOH HOH A . D 4 HOH 4 404 2 HOH HOH A . D 4 HOH 5 405 7 HOH HOH A . D 4 HOH 6 406 1 HOH HOH A . D 4 HOH 7 407 3 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 13590 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 149 ? A HIS 168 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 OD1 ? A ASP 153 ? A ASP 172 ? 1_555 95.5 ? 2 NE2 ? A HIS 149 ? A HIS 168 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 OD2 ? A ASP 153 ? A ASP 172 ? 1_555 83.4 ? 3 OD1 ? A ASP 153 ? A ASP 172 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 OD2 ? A ASP 153 ? A ASP 172 ? 1_555 54.5 ? 4 NE2 ? A HIS 149 ? A HIS 168 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 ND1 ? A HIS 230 ? A HIS 249 ? 1_555 99.3 ? 5 OD1 ? A ASP 153 ? A ASP 172 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 ND1 ? A HIS 230 ? A HIS 249 ? 1_555 91.8 ? 6 OD2 ? A ASP 153 ? A ASP 172 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 ND1 ? A HIS 230 ? A HIS 249 ? 1_555 146.2 ? 7 NE2 ? A HIS 149 ? A HIS 168 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O3 ? C HY6 . ? A HY6 302 ? 1_555 128.9 ? 8 OD1 ? A ASP 153 ? A ASP 172 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O3 ? C HY6 . ? A HY6 302 ? 1_555 104.8 ? 9 OD2 ? A ASP 153 ? A ASP 172 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O3 ? C HY6 . ? A HY6 302 ? 1_555 72.3 ? 10 ND1 ? A HIS 230 ? A HIS 249 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O3 ? C HY6 . ? A HY6 302 ? 1_555 125.7 ? 11 NE2 ? A HIS 149 ? A HIS 168 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 N2 ? C HY6 . ? A HY6 302 ? 1_555 133.6 ? 12 OD1 ? A ASP 153 ? A ASP 172 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 N2 ? C HY6 . ? A HY6 302 ? 1_555 129.6 ? 13 OD2 ? A ASP 153 ? A ASP 172 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 N2 ? C HY6 . ? A HY6 302 ? 1_555 112.3 ? 14 ND1 ? A HIS 230 ? A HIS 249 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 N2 ? C HY6 . ? A HY6 302 ? 1_555 90.3 ? 15 O3 ? C HY6 . ? A HY6 302 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 N2 ? C HY6 . ? A HY6 302 ? 1_555 39.9 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-02-23 2 'Structure model' 1 1 2022-08-31 3 'Structure model' 1 2 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.pdbx_database_id_DOI' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0049 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 5 # _pdbx_entry_details.entry_id 7E66 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 43 ? ? 55.61 -126.63 2 1 LYS A 106 ? ? 55.52 -178.67 3 1 PHE A 109 ? ? -119.04 79.92 4 1 SER A 131 ? ? -115.93 71.36 5 1 PRO A 134 ? ? -86.35 30.54 6 1 SER A 148 ? ? -117.67 -151.56 7 1 LYS A 156 ? ? -56.80 108.88 8 1 GLU A 162 ? ? 54.66 6.83 9 1 ALA A 175 ? ? -161.66 116.55 10 1 ALA A 192 ? ? -158.29 67.34 11 1 ALA A 239 ? ? -145.48 23.74 12 1 SER A 244 ? ? -95.40 41.10 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 HY6 C5 C N N 147 HY6 C11 C Y N 148 HY6 N1 N N N 149 HY6 N2 N N N 150 HY6 C3 C N N 151 HY6 C1 C N N 152 HY6 O1 O N N 153 HY6 S1 S N N 154 HY6 C2 C N N 155 HY6 O2 O N N 156 HY6 O3 O N N 157 HY6 O5 O N N 158 HY6 N7 N N N 159 HY6 O7 O N N 160 HY6 C21 C Y N 161 HY6 C31 C Y N 162 HY6 C41 C Y N 163 HY6 C51 C Y N 164 HY6 C61 C Y N 165 HY6 H1 H N N 166 HY6 H2 H N N 167 HY6 H3 H N N 168 HY6 H4 H N N 169 HY6 H5 H N N 170 HY6 H6 H N N 171 HY6 H7 H N N 172 HY6 H8 H N N 173 HY6 H9 H N N 174 HY6 H10 H N N 175 HY6 H11 H N N 176 HY6 H12 H N N 177 HY6 H13 H N N 178 ILE N N N N 179 ILE CA C N S 180 ILE C C N N 181 ILE O O N N 182 ILE CB C N S 183 ILE CG1 C N N 184 ILE CG2 C N N 185 ILE CD1 C N N 186 ILE OXT O N N 187 ILE H H N N 188 ILE H2 H N N 189 ILE HA H N N 190 ILE HB H N N 191 ILE HG12 H N N 192 ILE HG13 H N N 193 ILE HG21 H N N 194 ILE HG22 H N N 195 ILE HG23 H N N 196 ILE HD11 H N N 197 ILE HD12 H N N 198 ILE HD13 H N N 199 ILE HXT H N N 200 LEU N N N N 201 LEU CA C N S 202 LEU C C N N 203 LEU O O N N 204 LEU CB C N N 205 LEU CG C N N 206 LEU CD1 C N N 207 LEU CD2 C N N 208 LEU OXT O N N 209 LEU H H N N 210 LEU H2 H N N 211 LEU HA H N N 212 LEU HB2 H N N 213 LEU HB3 H N N 214 LEU HG H N N 215 LEU HD11 H N N 216 LEU HD12 H N N 217 LEU HD13 H N N 218 LEU HD21 H N N 219 LEU HD22 H N N 220 LEU HD23 H N N 221 LEU HXT H N N 222 LYS N N N N 223 LYS CA C N S 224 LYS C C N N 225 LYS O O N N 226 LYS CB C N N 227 LYS CG C N N 228 LYS CD C N N 229 LYS CE C N N 230 LYS NZ N N N 231 LYS OXT O N N 232 LYS H H N N 233 LYS H2 H N N 234 LYS HA H N N 235 LYS HB2 H N N 236 LYS HB3 H N N 237 LYS HG2 H N N 238 LYS HG3 H N N 239 LYS HD2 H N N 240 LYS HD3 H N N 241 LYS HE2 H N N 242 LYS HE3 H N N 243 LYS HZ1 H N N 244 LYS HZ2 H N N 245 LYS HZ3 H N N 246 LYS HXT H N N 247 MET N N N N 248 MET CA C N S 249 MET C C N N 250 MET O O N N 251 MET CB C N N 252 MET CG C N N 253 MET SD S N N 254 MET CE C N N 255 MET OXT O N N 256 MET H H N N 257 MET H2 H N N 258 MET HA H N N 259 MET HB2 H N N 260 MET HB3 H N N 261 MET HG2 H N N 262 MET HG3 H N N 263 MET HE1 H N N 264 MET HE2 H N N 265 MET HE3 H N N 266 MET HXT H N N 267 PHE N N N N 268 PHE CA C N S 269 PHE C C N N 270 PHE O O N N 271 PHE CB C N N 272 PHE CG C Y N 273 PHE CD1 C Y N 274 PHE CD2 C Y N 275 PHE CE1 C Y N 276 PHE CE2 C Y N 277 PHE CZ C Y N 278 PHE OXT O N N 279 PHE H H N N 280 PHE H2 H N N 281 PHE HA H N N 282 PHE HB2 H N N 283 PHE HB3 H N N 284 PHE HD1 H N N 285 PHE HD2 H N N 286 PHE HE1 H N N 287 PHE HE2 H N N 288 PHE HZ H N N 289 PHE HXT H N N 290 PRO N N N N 291 PRO CA C N S 292 PRO C C N N 293 PRO O O N N 294 PRO CB C N N 295 PRO CG C N N 296 PRO CD C N N 297 PRO OXT O N N 298 PRO H H N N 299 PRO HA H N N 300 PRO HB2 H N N 301 PRO HB3 H N N 302 PRO HG2 H N N 303 PRO HG3 H N N 304 PRO HD2 H N N 305 PRO HD3 H N N 306 PRO HXT H N N 307 SER N N N N 308 SER CA C N S 309 SER C C N N 310 SER O O N N 311 SER CB C N N 312 SER OG O N N 313 SER OXT O N N 314 SER H H N N 315 SER H2 H N N 316 SER HA H N N 317 SER HB2 H N N 318 SER HB3 H N N 319 SER HG H N N 320 SER HXT H N N 321 THR N N N N 322 THR CA C N S 323 THR C C N N 324 THR O O N N 325 THR CB C N R 326 THR OG1 O N N 327 THR CG2 C N N 328 THR OXT O N N 329 THR H H N N 330 THR H2 H N N 331 THR HA H N N 332 THR HB H N N 333 THR HG1 H N N 334 THR HG21 H N N 335 THR HG22 H N N 336 THR HG23 H N N 337 THR HXT H N N 338 TYR N N N N 339 TYR CA C N S 340 TYR C C N N 341 TYR O O N N 342 TYR CB C N N 343 TYR CG C Y N 344 TYR CD1 C Y N 345 TYR CD2 C Y N 346 TYR CE1 C Y N 347 TYR CE2 C Y N 348 TYR CZ C Y N 349 TYR OH O N N 350 TYR OXT O N N 351 TYR H H N N 352 TYR H2 H N N 353 TYR HA H N N 354 TYR HB2 H N N 355 TYR HB3 H N N 356 TYR HD1 H N N 357 TYR HD2 H N N 358 TYR HE1 H N N 359 TYR HE2 H N N 360 TYR HH H N N 361 TYR HXT H N N 362 VAL N N N N 363 VAL CA C N S 364 VAL C C N N 365 VAL O O N N 366 VAL CB C N N 367 VAL CG1 C N N 368 VAL CG2 C N N 369 VAL OXT O N N 370 VAL H H N N 371 VAL H2 H N N 372 VAL HA H N N 373 VAL HB H N N 374 VAL HG11 H N N 375 VAL HG12 H N N 376 VAL HG13 H N N 377 VAL HG21 H N N 378 VAL HG22 H N N 379 VAL HG23 H N N 380 VAL HXT H N N 381 ZN ZN ZN N N 382 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 HY6 O3 N2 sing N N 139 HY6 O2 C5 doub N N 140 HY6 N2 C5 sing N N 141 HY6 C5 C3 sing N N 142 HY6 C3 N1 sing N N 143 HY6 N1 C2 sing N N 144 HY6 C2 O1 doub N N 145 HY6 C2 C1 sing N N 146 HY6 C1 C21 sing N N 147 HY6 C21 C31 doub Y N 148 HY6 C21 C11 sing Y N 149 HY6 C31 C41 sing Y N 150 HY6 C11 C61 doub Y N 151 HY6 C41 C51 doub Y N 152 HY6 C61 C51 sing Y N 153 HY6 C51 S1 sing N N 154 HY6 N7 S1 sing N N 155 HY6 S1 O7 doub N N 156 HY6 S1 O5 doub N N 157 HY6 C11 H1 sing N N 158 HY6 N2 H2 sing N N 159 HY6 C3 H3 sing N N 160 HY6 C1 H4 sing N N 161 HY6 C1 H5 sing N N 162 HY6 O3 H6 sing N N 163 HY6 N7 H7 sing N N 164 HY6 N7 H8 sing N N 165 HY6 C31 H9 sing N N 166 HY6 C41 H10 sing N N 167 HY6 C61 H11 sing N N 168 HY6 N1 H12 sing N N 169 HY6 C3 H13 sing N N 170 ILE N CA sing N N 171 ILE N H sing N N 172 ILE N H2 sing N N 173 ILE CA C sing N N 174 ILE CA CB sing N N 175 ILE CA HA sing N N 176 ILE C O doub N N 177 ILE C OXT sing N N 178 ILE CB CG1 sing N N 179 ILE CB CG2 sing N N 180 ILE CB HB sing N N 181 ILE CG1 CD1 sing N N 182 ILE CG1 HG12 sing N N 183 ILE CG1 HG13 sing N N 184 ILE CG2 HG21 sing N N 185 ILE CG2 HG22 sing N N 186 ILE CG2 HG23 sing N N 187 ILE CD1 HD11 sing N N 188 ILE CD1 HD12 sing N N 189 ILE CD1 HD13 sing N N 190 ILE OXT HXT sing N N 191 LEU N CA sing N N 192 LEU N H sing N N 193 LEU N H2 sing N N 194 LEU CA C sing N N 195 LEU CA CB sing N N 196 LEU CA HA sing N N 197 LEU C O doub N N 198 LEU C OXT sing N N 199 LEU CB CG sing N N 200 LEU CB HB2 sing N N 201 LEU CB HB3 sing N N 202 LEU CG CD1 sing N N 203 LEU CG CD2 sing N N 204 LEU CG HG sing N N 205 LEU CD1 HD11 sing N N 206 LEU CD1 HD12 sing N N 207 LEU CD1 HD13 sing N N 208 LEU CD2 HD21 sing N N 209 LEU CD2 HD22 sing N N 210 LEU CD2 HD23 sing N N 211 LEU OXT HXT sing N N 212 LYS N CA sing N N 213 LYS N H sing N N 214 LYS N H2 sing N N 215 LYS CA C sing N N 216 LYS CA CB sing N N 217 LYS CA HA sing N N 218 LYS C O doub N N 219 LYS C OXT sing N N 220 LYS CB CG sing N N 221 LYS CB HB2 sing N N 222 LYS CB HB3 sing N N 223 LYS CG CD sing N N 224 LYS CG HG2 sing N N 225 LYS CG HG3 sing N N 226 LYS CD CE sing N N 227 LYS CD HD2 sing N N 228 LYS CD HD3 sing N N 229 LYS CE NZ sing N N 230 LYS CE HE2 sing N N 231 LYS CE HE3 sing N N 232 LYS NZ HZ1 sing N N 233 LYS NZ HZ2 sing N N 234 LYS NZ HZ3 sing N N 235 LYS OXT HXT sing N N 236 MET N CA sing N N 237 MET N H sing N N 238 MET N H2 sing N N 239 MET CA C sing N N 240 MET CA CB sing N N 241 MET CA HA sing N N 242 MET C O doub N N 243 MET C OXT sing N N 244 MET CB CG sing N N 245 MET CB HB2 sing N N 246 MET CB HB3 sing N N 247 MET CG SD sing N N 248 MET CG HG2 sing N N 249 MET CG HG3 sing N N 250 MET SD CE sing N N 251 MET CE HE1 sing N N 252 MET CE HE2 sing N N 253 MET CE HE3 sing N N 254 MET OXT HXT sing N N 255 PHE N CA sing N N 256 PHE N H sing N N 257 PHE N H2 sing N N 258 PHE CA C sing N N 259 PHE CA CB sing N N 260 PHE CA HA sing N N 261 PHE C O doub N N 262 PHE C OXT sing N N 263 PHE CB CG sing N N 264 PHE CB HB2 sing N N 265 PHE CB HB3 sing N N 266 PHE CG CD1 doub Y N 267 PHE CG CD2 sing Y N 268 PHE CD1 CE1 sing Y N 269 PHE CD1 HD1 sing N N 270 PHE CD2 CE2 doub Y N 271 PHE CD2 HD2 sing N N 272 PHE CE1 CZ doub Y N 273 PHE CE1 HE1 sing N N 274 PHE CE2 CZ sing Y N 275 PHE CE2 HE2 sing N N 276 PHE CZ HZ sing N N 277 PHE OXT HXT sing N N 278 PRO N CA sing N N 279 PRO N CD sing N N 280 PRO N H sing N N 281 PRO CA C sing N N 282 PRO CA CB sing N N 283 PRO CA HA sing N N 284 PRO C O doub N N 285 PRO C OXT sing N N 286 PRO CB CG sing N N 287 PRO CB HB2 sing N N 288 PRO CB HB3 sing N N 289 PRO CG CD sing N N 290 PRO CG HG2 sing N N 291 PRO CG HG3 sing N N 292 PRO CD HD2 sing N N 293 PRO CD HD3 sing N N 294 PRO OXT HXT sing N N 295 SER N CA sing N N 296 SER N H sing N N 297 SER N H2 sing N N 298 SER CA C sing N N 299 SER CA CB sing N N 300 SER CA HA sing N N 301 SER C O doub N N 302 SER C OXT sing N N 303 SER CB OG sing N N 304 SER CB HB2 sing N N 305 SER CB HB3 sing N N 306 SER OG HG sing N N 307 SER OXT HXT sing N N 308 THR N CA sing N N 309 THR N H sing N N 310 THR N H2 sing N N 311 THR CA C sing N N 312 THR CA CB sing N N 313 THR CA HA sing N N 314 THR C O doub N N 315 THR C OXT sing N N 316 THR CB OG1 sing N N 317 THR CB CG2 sing N N 318 THR CB HB sing N N 319 THR OG1 HG1 sing N N 320 THR CG2 HG21 sing N N 321 THR CG2 HG22 sing N N 322 THR CG2 HG23 sing N N 323 THR OXT HXT sing N N 324 TYR N CA sing N N 325 TYR N H sing N N 326 TYR N H2 sing N N 327 TYR CA C sing N N 328 TYR CA CB sing N N 329 TYR CA HA sing N N 330 TYR C O doub N N 331 TYR C OXT sing N N 332 TYR CB CG sing N N 333 TYR CB HB2 sing N N 334 TYR CB HB3 sing N N 335 TYR CG CD1 doub Y N 336 TYR CG CD2 sing Y N 337 TYR CD1 CE1 sing Y N 338 TYR CD1 HD1 sing N N 339 TYR CD2 CE2 doub Y N 340 TYR CD2 HD2 sing N N 341 TYR CE1 CZ doub Y N 342 TYR CE1 HE1 sing N N 343 TYR CE2 CZ sing Y N 344 TYR CE2 HE2 sing N N 345 TYR CZ OH sing N N 346 TYR OH HH sing N N 347 TYR OXT HXT sing N N 348 VAL N CA sing N N 349 VAL N H sing N N 350 VAL N H2 sing N N 351 VAL CA C sing N N 352 VAL CA CB sing N N 353 VAL CA HA sing N N 354 VAL C O doub N N 355 VAL C OXT sing N N 356 VAL CB CG1 sing N N 357 VAL CB CG2 sing N N 358 VAL CB HB sing N N 359 VAL CG1 HG11 sing N N 360 VAL CG1 HG12 sing N N 361 VAL CG1 HG13 sing N N 362 VAL CG2 HG21 sing N N 363 VAL CG2 HG22 sing N N 364 VAL CG2 HG23 sing N N 365 VAL OXT HXT sing N N 366 # _pdbx_audit_support.funding_organization 'National Research Foundation (NRF, Korea)' _pdbx_audit_support.country 'Korea, Republic Of' _pdbx_audit_support.grant_number 2015R1A5A1008958 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 HY6 ? ? HY6 ? ? 'SUBJECT OF INVESTIGATION' ? 2 ZN ? ? ZN ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 'N-[2-(oxidanylamino)-2-oxidanylidene-ethyl]-2-(4-sulfamoylphenyl)ethanamide' HY6 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6JMZ _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'isothermal titration calorimetry' _pdbx_struct_assembly_auth_evidence.details ? #