data_7E6Y # _entry.id 7E6Y # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7E6Y pdb_00007e6y 10.2210/pdb7e6y/pdb WWPDB D_1300020888 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-04-07 2 'Structure model' 1 1 2023-09-06 3 'Structure model' 1 2 2023-11-29 4 'Structure model' 1 3 2024-11-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Refinement description' 4 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_related_exp_data_set 5 3 'Structure model' pdbx_initial_refinement_model 6 4 'Structure model' pdbx_entry_details 7 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7E6Y _pdbx_database_status.recvd_initial_deposition_date 2021-02-24 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Oda, K.' 1 0000-0003-0996-0393 'Nomura, T.' 2 ? 'Nakane, T.' 3 0000-0003-2697-2767 'Yamashita, K.' 4 ? 'Inoue, K.' 5 0000-0002-6898-4347 'Ito, S.' 6 ? 'Vierock, J.' 7 0000-0001-7368-5539 'Hirata, K.' 8 ? 'Maturana, A.D.' 9 ? 'Katayama, K.' 10 ? 'Ikuta, T.' 11 ? 'Ishigami, I.' 12 ? 'Izume, T.' 13 ? 'Umeda, R.' 14 ? 'Eguma, R.' 15 ? 'Oishi, S.' 16 ? 'Kasuya, G.' 17 0000-0003-1756-5764 'Kato, T.' 18 ? 'Kusakizako, T.' 19 ? 'Shihoya, W.' 20 ? 'Shimada, H.' 21 ? 'Takatsuji, T.' 22 ? 'Takemoto, M.' 23 0000-0002-6339-6431 'Taniguchi, R.' 24 ? 'Tomita, A.' 25 ? 'Nakamura, R.' 26 ? 'Fukuda, M.' 27 ? 'Miyauchi, H.' 28 ? 'Lee, Y.' 29 ? 'Nango, E.' 30 0000-0001-9851-7355 'Tanaka, R.' 31 ? 'Tanaka, T.' 32 ? 'Sugahara, M.' 33 ? 'Kimura, T.' 34 ? 'Shimamura, T.' 35 ? 'Fujiwara, T.' 36 ? 'Yamanaka, Y.' 37 ? 'Owada, S.' 38 ? 'Joti, Y.' 39 ? 'Tono, K.' 40 ? 'Ishitani, R.' 41 0000-0002-4136-5685 'Hayashi, S.' 42 ? 'Kandori, H.' 43 ? 'Hegemann, P.' 44 0000-0003-3589-6452 'Iwata, S.' 45 ? 'Kubo, M.' 46 ? 'Nishizawa, T.' 47 0000-0001-7463-8398 'Nureki, O.' 48 0000-0003-1813-7008 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Elife _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2050-084X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 10 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Time-resolved serial femtosecond crystallography reveals early structural changes in channelrhodopsin.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.7554/eLife.62389 _citation.pdbx_database_id_PubMed 33752801 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Oda, K.' 1 0000-0003-0996-0393 primary 'Nomura, T.' 2 ? primary 'Nakane, T.' 3 0000-0003-2697-2767 primary 'Yamashita, K.' 4 ? primary 'Inoue, K.' 5 0000-0002-6898-4347 primary 'Ito, S.' 6 ? primary 'Vierock, J.' 7 0000-0001-7368-5539 primary 'Hirata, K.' 8 ? primary 'Maturana, A.D.' 9 ? primary 'Katayama, K.' 10 ? primary 'Ikuta, T.' 11 ? primary 'Ishigami, I.' 12 ? primary 'Izume, T.' 13 ? primary 'Umeda, R.' 14 ? primary 'Eguma, R.' 15 ? primary 'Oishi, S.' 16 ? primary 'Kasuya, G.' 17 0000-0003-1756-5764 primary 'Kato, T.' 18 ? primary 'Kusakizako, T.' 19 ? primary 'Shihoya, W.' 20 ? primary 'Shimada, H.' 21 ? primary 'Takatsuji, T.' 22 ? primary 'Takemoto, M.' 23 0000-0002-6339-6431 primary 'Taniguchi, R.' 24 ? primary 'Tomita, A.' 25 ? primary 'Nakamura, R.' 26 ? primary 'Fukuda, M.' 27 ? primary 'Miyauchi, H.' 28 ? primary 'Lee, Y.' 29 ? primary 'Nango, E.' 30 0000-0001-9851-7355 primary 'Tanaka, R.' 31 ? primary 'Tanaka, T.' 32 ? primary 'Sugahara, M.' 33 ? primary 'Kimura, T.' 34 ? primary 'Shimamura, T.' 35 ? primary 'Fujiwara, T.' 36 ? primary 'Yamanaka, Y.' 37 ? primary 'Owada, S.' 38 ? primary 'Joti, Y.' 39 ? primary 'Tono, K.' 40 ? primary 'Ishitani, R.' 41 0000-0002-4136-5685 primary 'Hayashi, S.' 42 ? primary 'Kandori, H.' 43 ? primary 'Hegemann, P.' 44 0000-0003-3589-6452 primary 'Iwata, S.' 45 ? primary 'Kubo, M.' 46 ? primary 'Nishizawa, T.' 47 0000-0001-7463-8398 primary 'Nureki, O.' 48 0000-0003-1813-7008 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Archaeal-type opsin 1,Archaeal-type opsin 2' 39692.688 1 ? ? ? ? 2 branched man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401 1 ? ? ? ? 3 non-polymer syn RETINAL 284.436 1 ? ? ? ? 4 non-polymer syn '(2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate' 356.540 9 ? ? ? ? 5 water nat water 18.015 38 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Channelopsin-1,Chlamyopsin 4 light-gated ion channel,Retinal binding protein,Sensory opsin B' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSRRPWLLALALAVALAAGSAGASTGSDATVPVATQDGPDYVFHRAHERMLFQTSYTLENNGSVICIPNNGQCFCLAWLK SNGTNAEKLAANILQWITFALSALCLMFYGYQTWKSTCGWEEIYVATIEMIKFIIEYFHEFDEPAVIYSSNGNKTVWLRY AEWLLTCPVILIHLSNLTGLANDYNKRTMGLLVSDIGTIVWGTTAALSKGYVRVIFFLMGLCYGIYTFFNAAKVYIEAYH TVPKGRCRQVVTGMAWLFFVSWGMFPILFILGPEGFGVLSVYGSTVGHTIIDLMSKNCWGLLGHYLRVLIHEHILIHGDI RKTTKLNIGGTEIEVETLVEDEAEAGAVSSEDLYFQ ; _entity_poly.pdbx_seq_one_letter_code_can ;MSRRPWLLALALAVALAAGSAGASTGSDATVPVATQDGPDYVFHRAHERMLFQTSYTLENNGSVICIPNNGQCFCLAWLK SNGTNAEKLAANILQWITFALSALCLMFYGYQTWKSTCGWEEIYVATIEMIKFIIEYFHEFDEPAVIYSSNGNKTVWLRY AEWLLTCPVILIHLSNLTGLANDYNKRTMGLLVSDIGTIVWGTTAALSKGYVRVIFFLMGLCYGIYTFFNAAKVYIEAYH TVPKGRCRQVVTGMAWLFFVSWGMFPILFILGPEGFGVLSVYGSTVGHTIIDLMSKNCWGLLGHYLRVLIHEHILIHGDI RKTTKLNIGGTEIEVETLVEDEAEAGAVSSEDLYFQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 RETINAL RET 4 '(2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate' OLC 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 ARG n 1 4 ARG n 1 5 PRO n 1 6 TRP n 1 7 LEU n 1 8 LEU n 1 9 ALA n 1 10 LEU n 1 11 ALA n 1 12 LEU n 1 13 ALA n 1 14 VAL n 1 15 ALA n 1 16 LEU n 1 17 ALA n 1 18 ALA n 1 19 GLY n 1 20 SER n 1 21 ALA n 1 22 GLY n 1 23 ALA n 1 24 SER n 1 25 THR n 1 26 GLY n 1 27 SER n 1 28 ASP n 1 29 ALA n 1 30 THR n 1 31 VAL n 1 32 PRO n 1 33 VAL n 1 34 ALA n 1 35 THR n 1 36 GLN n 1 37 ASP n 1 38 GLY n 1 39 PRO n 1 40 ASP n 1 41 TYR n 1 42 VAL n 1 43 PHE n 1 44 HIS n 1 45 ARG n 1 46 ALA n 1 47 HIS n 1 48 GLU n 1 49 ARG n 1 50 MET n 1 51 LEU n 1 52 PHE n 1 53 GLN n 1 54 THR n 1 55 SER n 1 56 TYR n 1 57 THR n 1 58 LEU n 1 59 GLU n 1 60 ASN n 1 61 ASN n 1 62 GLY n 1 63 SER n 1 64 VAL n 1 65 ILE n 1 66 CYS n 1 67 ILE n 1 68 PRO n 1 69 ASN n 1 70 ASN n 1 71 GLY n 1 72 GLN n 1 73 CYS n 1 74 PHE n 1 75 CYS n 1 76 LEU n 1 77 ALA n 1 78 TRP n 1 79 LEU n 1 80 LYS n 1 81 SER n 1 82 ASN n 1 83 GLY n 1 84 THR n 1 85 ASN n 1 86 ALA n 1 87 GLU n 1 88 LYS n 1 89 LEU n 1 90 ALA n 1 91 ALA n 1 92 ASN n 1 93 ILE n 1 94 LEU n 1 95 GLN n 1 96 TRP n 1 97 ILE n 1 98 THR n 1 99 PHE n 1 100 ALA n 1 101 LEU n 1 102 SER n 1 103 ALA n 1 104 LEU n 1 105 CYS n 1 106 LEU n 1 107 MET n 1 108 PHE n 1 109 TYR n 1 110 GLY n 1 111 TYR n 1 112 GLN n 1 113 THR n 1 114 TRP n 1 115 LYS n 1 116 SER n 1 117 THR n 1 118 CYS n 1 119 GLY n 1 120 TRP n 1 121 GLU n 1 122 GLU n 1 123 ILE n 1 124 TYR n 1 125 VAL n 1 126 ALA n 1 127 THR n 1 128 ILE n 1 129 GLU n 1 130 MET n 1 131 ILE n 1 132 LYS n 1 133 PHE n 1 134 ILE n 1 135 ILE n 1 136 GLU n 1 137 TYR n 1 138 PHE n 1 139 HIS n 1 140 GLU n 1 141 PHE n 1 142 ASP n 1 143 GLU n 1 144 PRO n 1 145 ALA n 1 146 VAL n 1 147 ILE n 1 148 TYR n 1 149 SER n 1 150 SER n 1 151 ASN n 1 152 GLY n 1 153 ASN n 1 154 LYS n 1 155 THR n 1 156 VAL n 1 157 TRP n 1 158 LEU n 1 159 ARG n 1 160 TYR n 1 161 ALA n 1 162 GLU n 1 163 TRP n 1 164 LEU n 1 165 LEU n 1 166 THR n 1 167 CYS n 1 168 PRO n 1 169 VAL n 1 170 ILE n 1 171 LEU n 1 172 ILE n 1 173 HIS n 1 174 LEU n 1 175 SER n 1 176 ASN n 1 177 LEU n 1 178 THR n 1 179 GLY n 1 180 LEU n 1 181 ALA n 1 182 ASN n 1 183 ASP n 1 184 TYR n 1 185 ASN n 1 186 LYS n 1 187 ARG n 1 188 THR n 1 189 MET n 1 190 GLY n 1 191 LEU n 1 192 LEU n 1 193 VAL n 1 194 SER n 1 195 ASP n 1 196 ILE n 1 197 GLY n 1 198 THR n 1 199 ILE n 1 200 VAL n 1 201 TRP n 1 202 GLY n 1 203 THR n 1 204 THR n 1 205 ALA n 1 206 ALA n 1 207 LEU n 1 208 SER n 1 209 LYS n 1 210 GLY n 1 211 TYR n 1 212 VAL n 1 213 ARG n 1 214 VAL n 1 215 ILE n 1 216 PHE n 1 217 PHE n 1 218 LEU n 1 219 MET n 1 220 GLY n 1 221 LEU n 1 222 CYS n 1 223 TYR n 1 224 GLY n 1 225 ILE n 1 226 TYR n 1 227 THR n 1 228 PHE n 1 229 PHE n 1 230 ASN n 1 231 ALA n 1 232 ALA n 1 233 LYS n 1 234 VAL n 1 235 TYR n 1 236 ILE n 1 237 GLU n 1 238 ALA n 1 239 TYR n 1 240 HIS n 1 241 THR n 1 242 VAL n 1 243 PRO n 1 244 LYS n 1 245 GLY n 1 246 ARG n 1 247 CYS n 1 248 ARG n 1 249 GLN n 1 250 VAL n 1 251 VAL n 1 252 THR n 1 253 GLY n 1 254 MET n 1 255 ALA n 1 256 TRP n 1 257 LEU n 1 258 PHE n 1 259 PHE n 1 260 VAL n 1 261 SER n 1 262 TRP n 1 263 GLY n 1 264 MET n 1 265 PHE n 1 266 PRO n 1 267 ILE n 1 268 LEU n 1 269 PHE n 1 270 ILE n 1 271 LEU n 1 272 GLY n 1 273 PRO n 1 274 GLU n 1 275 GLY n 1 276 PHE n 1 277 GLY n 1 278 VAL n 1 279 LEU n 1 280 SER n 1 281 VAL n 1 282 TYR n 1 283 GLY n 1 284 SER n 1 285 THR n 1 286 VAL n 1 287 GLY n 1 288 HIS n 1 289 THR n 1 290 ILE n 1 291 ILE n 1 292 ASP n 1 293 LEU n 1 294 MET n 1 295 SER n 1 296 LYS n 1 297 ASN n 1 298 CYS n 1 299 TRP n 1 300 GLY n 1 301 LEU n 1 302 LEU n 1 303 GLY n 1 304 HIS n 1 305 TYR n 1 306 LEU n 1 307 ARG n 1 308 VAL n 1 309 LEU n 1 310 ILE n 1 311 HIS n 1 312 GLU n 1 313 HIS n 1 314 ILE n 1 315 LEU n 1 316 ILE n 1 317 HIS n 1 318 GLY n 1 319 ASP n 1 320 ILE n 1 321 ARG n 1 322 LYS n 1 323 THR n 1 324 THR n 1 325 LYS n 1 326 LEU n 1 327 ASN n 1 328 ILE n 1 329 GLY n 1 330 GLY n 1 331 THR n 1 332 GLU n 1 333 ILE n 1 334 GLU n 1 335 VAL n 1 336 GLU n 1 337 THR n 1 338 LEU n 1 339 VAL n 1 340 GLU n 1 341 ASP n 1 342 GLU n 1 343 ALA n 1 344 GLU n 1 345 ALA n 1 346 GLY n 1 347 ALA n 1 348 VAL n 1 349 SER n 1 350 SER n 1 351 GLU n 1 352 ASP n 1 353 LEU n 1 354 TYR n 1 355 PHE n 1 356 GLN n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 245 'Chlamydomonas smithii' ? acop1 ? ? ? ? ? ? 'Chlamydomonas reinhardtii' 3055 ? ? ? ? ? ? ? ? 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 2 sample 'Biological sequence' 246 356 'Chlamydomonas smithii' ? 'cop4, acop2, COP4, CSOB, CHLRE_02g085257v5, CHLREDRAFT_182032' ? ? ? ? ? ? 'Chlamydomonas reinhardtii' 3055 ? ? ? ? ? ? ? ? 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # _pdbx_entity_branch.entity_id 2 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 DGlcpNAcb1-4DGlcpNAcb1-ROH 'Glycam Condensed Sequence' GMML 1.0 2 2 'WURCS=2.0/1,2,1/[a2122h-1b_1-5_2*NCC/3=O]/1-1/a4-b1' WURCS PDB2Glycan 1.1.0 3 2 '[][D-1-deoxy-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}}' LINUCS PDB-CARE ? # _pdbx_entity_branch_link.link_id 1 _pdbx_entity_branch_link.entity_id 2 _pdbx_entity_branch_link.entity_branch_list_num_1 2 _pdbx_entity_branch_link.comp_id_1 NAG _pdbx_entity_branch_link.atom_id_1 C1 _pdbx_entity_branch_link.leaving_atom_id_1 O1 _pdbx_entity_branch_link.entity_branch_list_num_2 1 _pdbx_entity_branch_link.comp_id_2 NAG _pdbx_entity_branch_link.atom_id_2 O4 _pdbx_entity_branch_link.leaving_atom_id_2 HO4 _pdbx_entity_branch_link.value_order sing _pdbx_entity_branch_link.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE ; 'C8 H15 N O6' 221.208 OLC non-polymer . '(2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate' 1-Oleoyl-R-glycerol 'C21 H40 O4' 356.540 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 RET non-polymer . RETINAL ? 'C20 H28 O' 284.436 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 ARG 3 3 ? ? ? A . n A 1 4 ARG 4 4 ? ? ? A . n A 1 5 PRO 5 5 ? ? ? A . n A 1 6 TRP 6 6 ? ? ? A . n A 1 7 LEU 7 7 ? ? ? A . n A 1 8 LEU 8 8 ? ? ? A . n A 1 9 ALA 9 9 ? ? ? A . n A 1 10 LEU 10 10 ? ? ? A . n A 1 11 ALA 11 11 ? ? ? A . n A 1 12 LEU 12 12 ? ? ? A . n A 1 13 ALA 13 13 ? ? ? A . n A 1 14 VAL 14 14 ? ? ? A . n A 1 15 ALA 15 15 ? ? ? A . n A 1 16 LEU 16 16 ? ? ? A . n A 1 17 ALA 17 17 ? ? ? A . n A 1 18 ALA 18 18 ? ? ? A . n A 1 19 GLY 19 19 ? ? ? A . n A 1 20 SER 20 20 ? ? ? A . n A 1 21 ALA 21 21 ? ? ? A . n A 1 22 GLY 22 22 ? ? ? A . n A 1 23 ALA 23 23 ? ? ? A . n A 1 24 SER 24 24 ? ? ? A . n A 1 25 THR 25 25 ? ? ? A . n A 1 26 GLY 26 26 ? ? ? A . n A 1 27 SER 27 27 ? ? ? A . n A 1 28 ASP 28 28 ? ? ? A . n A 1 29 ALA 29 29 ? ? ? A . n A 1 30 THR 30 30 ? ? ? A . n A 1 31 VAL 31 31 ? ? ? A . n A 1 32 PRO 32 32 ? ? ? A . n A 1 33 VAL 33 33 ? ? ? A . n A 1 34 ALA 34 34 ? ? ? A . n A 1 35 THR 35 35 ? ? ? A . n A 1 36 GLN 36 36 ? ? ? A . n A 1 37 ASP 37 37 ? ? ? A . n A 1 38 GLY 38 38 ? ? ? A . n A 1 39 PRO 39 39 ? ? ? A . n A 1 40 ASP 40 40 ? ? ? A . n A 1 41 TYR 41 41 ? ? ? A . n A 1 42 VAL 42 42 ? ? ? A . n A 1 43 PHE 43 43 ? ? ? A . n A 1 44 HIS 44 44 ? ? ? A . n A 1 45 ARG 45 45 ? ? ? A . n A 1 46 ALA 46 46 ? ? ? A . n A 1 47 HIS 47 47 ? ? ? A . n A 1 48 GLU 48 48 ? ? ? A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 MET 50 50 50 MET MET A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 CYS 66 66 66 CYS CYS A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 PRO 68 68 68 PRO PRO A . n A 1 69 ASN 69 69 69 ASN ASN A . n A 1 70 ASN 70 70 70 ASN ASN A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 CYS 73 73 73 CYS CYS A . n A 1 74 PHE 74 74 74 PHE PHE A . n A 1 75 CYS 75 75 75 CYS CYS A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 TRP 78 78 78 TRP TRP A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 THR 84 84 84 THR THR A . n A 1 85 ASN 85 85 85 ASN ASN A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 ASN 92 92 92 ASN ASN A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 GLN 95 95 95 GLN GLN A . n A 1 96 TRP 96 96 96 TRP TRP A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 THR 98 98 98 THR THR A . n A 1 99 PHE 99 99 99 PHE PHE A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 SER 102 102 102 SER SER A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 CYS 105 105 105 CYS CYS A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 MET 107 107 107 MET MET A . n A 1 108 PHE 108 108 108 PHE PHE A . n A 1 109 TYR 109 109 109 TYR TYR A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 TYR 111 111 111 TYR TYR A . n A 1 112 GLN 112 112 ? ? ? A . n A 1 113 THR 113 113 ? ? ? A . n A 1 114 TRP 114 114 ? ? ? A . n A 1 115 LYS 115 115 ? ? ? A . n A 1 116 SER 116 116 ? ? ? A . n A 1 117 THR 117 117 ? ? ? A . n A 1 118 CYS 118 118 118 CYS CYS A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 TRP 120 120 120 TRP TRP A . n A 1 121 GLU 121 121 121 GLU GLU A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 ILE 123 123 123 ILE ILE A . n A 1 124 TYR 124 124 124 TYR TYR A . n A 1 125 VAL 125 125 125 VAL VAL A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 THR 127 127 127 THR THR A . n A 1 128 ILE 128 128 128 ILE ILE A . n A 1 129 GLU 129 129 129 GLU GLU A . n A 1 130 MET 130 130 130 MET MET A . n A 1 131 ILE 131 131 131 ILE ILE A . n A 1 132 LYS 132 132 132 LYS LYS A . n A 1 133 PHE 133 133 133 PHE PHE A . n A 1 134 ILE 134 134 134 ILE ILE A . n A 1 135 ILE 135 135 135 ILE ILE A . n A 1 136 GLU 136 136 136 GLU GLU A . n A 1 137 TYR 137 137 137 TYR TYR A . n A 1 138 PHE 138 138 138 PHE PHE A . n A 1 139 HIS 139 139 139 HIS HIS A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 PHE 141 141 141 PHE PHE A . n A 1 142 ASP 142 142 142 ASP ASP A . n A 1 143 GLU 143 143 143 GLU GLU A . n A 1 144 PRO 144 144 144 PRO PRO A . n A 1 145 ALA 145 145 145 ALA ALA A . n A 1 146 VAL 146 146 146 VAL VAL A . n A 1 147 ILE 147 147 147 ILE ILE A . n A 1 148 TYR 148 148 148 TYR TYR A . n A 1 149 SER 149 149 149 SER SER A . n A 1 150 SER 150 150 150 SER SER A . n A 1 151 ASN 151 151 151 ASN ASN A . n A 1 152 GLY 152 152 152 GLY GLY A . n A 1 153 ASN 153 153 153 ASN ASN A . n A 1 154 LYS 154 154 154 LYS LYS A . n A 1 155 THR 155 155 155 THR THR A . n A 1 156 VAL 156 156 156 VAL VAL A . n A 1 157 TRP 157 157 157 TRP TRP A . n A 1 158 LEU 158 158 158 LEU LEU A . n A 1 159 ARG 159 159 159 ARG ARG A . n A 1 160 TYR 160 160 160 TYR TYR A . n A 1 161 ALA 161 161 161 ALA ALA A . n A 1 162 GLU 162 162 162 GLU GLU A . n A 1 163 TRP 163 163 163 TRP TRP A . n A 1 164 LEU 164 164 164 LEU LEU A . n A 1 165 LEU 165 165 165 LEU LEU A . n A 1 166 THR 166 166 166 THR THR A . n A 1 167 CYS 167 167 167 CYS CYS A . n A 1 168 PRO 168 168 168 PRO PRO A . n A 1 169 VAL 169 169 169 VAL VAL A . n A 1 170 ILE 170 170 170 ILE ILE A . n A 1 171 LEU 171 171 171 LEU LEU A . n A 1 172 ILE 172 172 172 ILE ILE A . n A 1 173 HIS 173 173 173 HIS HIS A . n A 1 174 LEU 174 174 174 LEU LEU A . n A 1 175 SER 175 175 175 SER SER A . n A 1 176 ASN 176 176 176 ASN ASN A . n A 1 177 LEU 177 177 177 LEU LEU A . n A 1 178 THR 178 178 178 THR THR A . n A 1 179 GLY 179 179 179 GLY GLY A . n A 1 180 LEU 180 180 180 LEU LEU A . n A 1 181 ALA 181 181 181 ALA ALA A . n A 1 182 ASN 182 182 182 ASN ASN A . n A 1 183 ASP 183 183 183 ASP ASP A . n A 1 184 TYR 184 184 184 TYR TYR A . n A 1 185 ASN 185 185 185 ASN ASN A . n A 1 186 LYS 186 186 186 LYS LYS A . n A 1 187 ARG 187 187 187 ARG ARG A . n A 1 188 THR 188 188 188 THR THR A . n A 1 189 MET 189 189 189 MET MET A . n A 1 190 GLY 190 190 190 GLY GLY A . n A 1 191 LEU 191 191 191 LEU LEU A . n A 1 192 LEU 192 192 192 LEU LEU A . n A 1 193 VAL 193 193 193 VAL VAL A . n A 1 194 SER 194 194 194 SER SER A . n A 1 195 ASP 195 195 195 ASP ASP A . n A 1 196 ILE 196 196 196 ILE ILE A . n A 1 197 GLY 197 197 197 GLY GLY A . n A 1 198 THR 198 198 198 THR THR A . n A 1 199 ILE 199 199 199 ILE ILE A . n A 1 200 VAL 200 200 200 VAL VAL A . n A 1 201 TRP 201 201 201 TRP TRP A . n A 1 202 GLY 202 202 202 GLY GLY A . n A 1 203 THR 203 203 203 THR THR A . n A 1 204 THR 204 204 204 THR THR A . n A 1 205 ALA 205 205 205 ALA ALA A . n A 1 206 ALA 206 206 206 ALA ALA A . n A 1 207 LEU 207 207 207 LEU LEU A . n A 1 208 SER 208 208 208 SER SER A . n A 1 209 LYS 209 209 209 LYS LYS A . n A 1 210 GLY 210 210 210 GLY GLY A . n A 1 211 TYR 211 211 211 TYR TYR A . n A 1 212 VAL 212 212 212 VAL VAL A . n A 1 213 ARG 213 213 213 ARG ARG A . n A 1 214 VAL 214 214 214 VAL VAL A . n A 1 215 ILE 215 215 215 ILE ILE A . n A 1 216 PHE 216 216 216 PHE PHE A . n A 1 217 PHE 217 217 217 PHE PHE A . n A 1 218 LEU 218 218 218 LEU LEU A . n A 1 219 MET 219 219 219 MET MET A . n A 1 220 GLY 220 220 220 GLY GLY A . n A 1 221 LEU 221 221 221 LEU LEU A . n A 1 222 CYS 222 222 222 CYS CYS A . n A 1 223 TYR 223 223 223 TYR TYR A . n A 1 224 GLY 224 224 224 GLY GLY A . n A 1 225 ILE 225 225 225 ILE ILE A . n A 1 226 TYR 226 226 226 TYR TYR A . n A 1 227 THR 227 227 227 THR THR A . n A 1 228 PHE 228 228 228 PHE PHE A . n A 1 229 PHE 229 229 229 PHE PHE A . n A 1 230 ASN 230 230 230 ASN ASN A . n A 1 231 ALA 231 231 231 ALA ALA A . n A 1 232 ALA 232 232 232 ALA ALA A . n A 1 233 LYS 233 233 233 LYS LYS A . n A 1 234 VAL 234 234 234 VAL VAL A . n A 1 235 TYR 235 235 235 TYR TYR A . n A 1 236 ILE 236 236 236 ILE ILE A . n A 1 237 GLU 237 237 237 GLU GLU A . n A 1 238 ALA 238 238 238 ALA ALA A . n A 1 239 TYR 239 239 239 TYR TYR A . n A 1 240 HIS 240 240 240 HIS HIS A . n A 1 241 THR 241 241 241 THR THR A . n A 1 242 VAL 242 242 242 VAL VAL A . n A 1 243 PRO 243 243 243 PRO PRO A . n A 1 244 LYS 244 244 244 LYS LYS A . n A 1 245 GLY 245 245 245 GLY GLY A . n A 1 246 ARG 246 246 246 ARG ARG A . n A 1 247 CYS 247 247 247 CYS CYS A . n A 1 248 ARG 248 248 248 ARG ARG A . n A 1 249 GLN 249 249 249 GLN GLN A . n A 1 250 VAL 250 250 250 VAL VAL A . n A 1 251 VAL 251 251 251 VAL VAL A . n A 1 252 THR 252 252 252 THR THR A . n A 1 253 GLY 253 253 253 GLY GLY A . n A 1 254 MET 254 254 254 MET MET A . n A 1 255 ALA 255 255 255 ALA ALA A . n A 1 256 TRP 256 256 256 TRP TRP A . n A 1 257 LEU 257 257 257 LEU LEU A . n A 1 258 PHE 258 258 258 PHE PHE A . n A 1 259 PHE 259 259 259 PHE PHE A . n A 1 260 VAL 260 260 260 VAL VAL A . n A 1 261 SER 261 261 261 SER SER A . n A 1 262 TRP 262 262 262 TRP TRP A . n A 1 263 GLY 263 263 263 GLY GLY A . n A 1 264 MET 264 264 264 MET MET A . n A 1 265 PHE 265 265 265 PHE PHE A . n A 1 266 PRO 266 266 266 PRO PRO A . n A 1 267 ILE 267 267 267 ILE ILE A . n A 1 268 LEU 268 268 268 LEU LEU A . n A 1 269 PHE 269 269 269 PHE PHE A . n A 1 270 ILE 270 270 270 ILE ILE A . n A 1 271 LEU 271 271 271 LEU LEU A . n A 1 272 GLY 272 272 272 GLY GLY A . n A 1 273 PRO 273 273 273 PRO PRO A . n A 1 274 GLU 274 274 274 GLU GLU A . n A 1 275 GLY 275 275 275 GLY GLY A . n A 1 276 PHE 276 276 276 PHE PHE A . n A 1 277 GLY 277 277 277 GLY GLY A . n A 1 278 VAL 278 278 278 VAL VAL A . n A 1 279 LEU 279 279 279 LEU LEU A . n A 1 280 SER 280 280 280 SER SER A . n A 1 281 VAL 281 281 281 VAL VAL A . n A 1 282 TYR 282 282 282 TYR TYR A . n A 1 283 GLY 283 283 283 GLY GLY A . n A 1 284 SER 284 284 284 SER SER A . n A 1 285 THR 285 285 285 THR THR A . n A 1 286 VAL 286 286 286 VAL VAL A . n A 1 287 GLY 287 287 287 GLY GLY A . n A 1 288 HIS 288 288 288 HIS HIS A . n A 1 289 THR 289 289 289 THR THR A . n A 1 290 ILE 290 290 290 ILE ILE A . n A 1 291 ILE 291 291 291 ILE ILE A . n A 1 292 ASP 292 292 292 ASP ASP A . n A 1 293 LEU 293 293 293 LEU LEU A . n A 1 294 MET 294 294 294 MET MET A . n A 1 295 SER 295 295 295 SER SER A . n A 1 296 LYS 296 296 296 LYS LYS A . n A 1 297 ASN 297 297 297 ASN ASN A . n A 1 298 CYS 298 298 298 CYS CYS A . n A 1 299 TRP 299 299 299 TRP TRP A . n A 1 300 GLY 300 300 300 GLY GLY A . n A 1 301 LEU 301 301 301 LEU LEU A . n A 1 302 LEU 302 302 302 LEU LEU A . n A 1 303 GLY 303 303 303 GLY GLY A . n A 1 304 HIS 304 304 304 HIS HIS A . n A 1 305 TYR 305 305 305 TYR TYR A . n A 1 306 LEU 306 306 306 LEU LEU A . n A 1 307 ARG 307 307 307 ARG ARG A . n A 1 308 VAL 308 308 308 VAL VAL A . n A 1 309 LEU 309 309 309 LEU LEU A . n A 1 310 ILE 310 310 310 ILE ILE A . n A 1 311 HIS 311 311 311 HIS HIS A . n A 1 312 GLU 312 312 312 GLU GLU A . n A 1 313 HIS 313 313 313 HIS HIS A . n A 1 314 ILE 314 314 314 ILE ILE A . n A 1 315 LEU 315 315 315 LEU LEU A . n A 1 316 ILE 316 316 316 ILE ILE A . n A 1 317 HIS 317 317 317 HIS HIS A . n A 1 318 GLY 318 318 318 GLY GLY A . n A 1 319 ASP 319 319 319 ASP ASP A . n A 1 320 ILE 320 320 320 ILE ILE A . n A 1 321 ARG 321 321 321 ARG ARG A . n A 1 322 LYS 322 322 322 LYS LYS A . n A 1 323 THR 323 323 323 THR THR A . n A 1 324 THR 324 324 324 THR THR A . n A 1 325 LYS 325 325 325 LYS LYS A . n A 1 326 LEU 326 326 326 LEU LEU A . n A 1 327 ASN 327 327 327 ASN ASN A . n A 1 328 ILE 328 328 328 ILE ILE A . n A 1 329 GLY 329 329 ? ? ? A . n A 1 330 GLY 330 330 ? ? ? A . n A 1 331 THR 331 331 331 THR ALA A . n A 1 332 GLU 332 332 332 GLU GLU A . n A 1 333 ILE 333 333 333 ILE ILE A . n A 1 334 GLU 334 334 334 GLU GLU A . n A 1 335 VAL 335 335 335 VAL VAL A . n A 1 336 GLU 336 336 336 GLU GLU A . n A 1 337 THR 337 337 337 THR THR A . n A 1 338 LEU 338 338 338 LEU LEU A . n A 1 339 VAL 339 339 339 VAL VAL A . n A 1 340 GLU 340 340 340 GLU GLU A . n A 1 341 ASP 341 341 341 ASP ASP A . n A 1 342 GLU 342 342 342 GLU GLU A . n A 1 343 ALA 343 343 343 ALA ALA A . n A 1 344 GLU 344 344 344 GLU GLU A . n A 1 345 ALA 345 345 345 ALA ALA A . n A 1 346 GLY 346 346 346 GLY GLY A . n A 1 347 ALA 347 347 347 ALA ALA A . n A 1 348 VAL 348 348 348 VAL VAL A . n A 1 349 SER 349 349 349 SER SER A . n A 1 350 SER 350 350 350 SER SER A . n A 1 351 GLU 351 351 351 GLU GLU A . n A 1 352 ASP 352 352 352 ASP ASP A . n A 1 353 LEU 353 353 ? ? ? A . n A 1 354 TYR 354 354 ? ? ? A . n A 1 355 PHE 355 355 ? ? ? A . n A 1 356 GLN 356 356 ? ? ? A . n # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 NAG 1 E NAG 1 E NAG 701 n B 2 NAG 2 E NAG 2 E NAG 702 n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 RET 1 401 401 RET RET A . D 4 OLC 1 402 1 OLC OLC A . E 4 OLC 1 403 2 OLC OLC A . F 4 OLC 1 404 3 OLC OLC A . G 4 OLC 1 405 4 OLC OLC A . H 4 OLC 1 406 5 OLC OLC A . I 4 OLC 1 407 1 OLC OLC A . J 4 OLC 1 408 2 OLC OLC A . K 4 OLC 1 409 3 OLC OLC A . L 4 OLC 1 410 4 OLC OLC A . M 5 HOH 1 501 18 HOH HOH A . M 5 HOH 2 502 17 HOH HOH A . M 5 HOH 3 503 12 HOH HOH A . M 5 HOH 4 504 37 HOH HOH A . M 5 HOH 5 505 6 HOH HOH A . M 5 HOH 6 506 4 HOH HOH A . M 5 HOH 7 507 35 HOH HOH A . M 5 HOH 8 508 8 HOH HOH A . M 5 HOH 9 509 2 HOH HOH A . M 5 HOH 10 510 38 HOH HOH A . M 5 HOH 11 511 25 HOH HOH A . M 5 HOH 12 512 33 HOH HOH A . M 5 HOH 13 513 40 HOH HOH A . M 5 HOH 14 514 7 HOH HOH A . M 5 HOH 15 515 41 HOH HOH A . M 5 HOH 16 516 14 HOH HOH A . M 5 HOH 17 517 28 HOH HOH A . M 5 HOH 18 518 16 HOH HOH A . M 5 HOH 19 519 29 HOH HOH A . M 5 HOH 20 520 1 HOH HOH A . M 5 HOH 21 521 15 HOH HOH A . M 5 HOH 22 522 32 HOH HOH A . M 5 HOH 23 523 24 HOH HOH A . M 5 HOH 24 524 5 HOH HOH A . M 5 HOH 25 525 27 HOH HOH A . M 5 HOH 26 526 20 HOH HOH A . M 5 HOH 27 527 23 HOH HOH A . M 5 HOH 28 528 34 HOH HOH A . M 5 HOH 29 529 21 HOH HOH A . M 5 HOH 30 530 3 HOH HOH A . M 5 HOH 31 531 31 HOH HOH A . M 5 HOH 32 532 11 HOH HOH A . M 5 HOH 33 533 30 HOH HOH A . M 5 HOH 34 534 36 HOH HOH A . M 5 HOH 35 535 22 HOH HOH A . M 5 HOH 36 536 39 HOH HOH A . M 5 HOH 37 537 19 HOH HOH A . M 5 HOH 38 538 26 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 49 ? CG ? A ARG 49 CG 2 1 Y 1 A ARG 49 ? CD ? A ARG 49 CD 3 1 Y 1 A ARG 49 ? NE ? A ARG 49 NE 4 1 Y 1 A ARG 49 ? CZ ? A ARG 49 CZ 5 1 Y 1 A ARG 49 ? NH1 ? A ARG 49 NH1 6 1 Y 1 A ARG 49 ? NH2 ? A ARG 49 NH2 7 1 Y 1 A MET 50 ? CG ? A MET 50 CG 8 1 Y 1 A MET 50 ? SD ? A MET 50 SD 9 1 Y 1 A MET 50 ? CE ? A MET 50 CE 10 1 Y 1 A CYS 118 ? SG ? A CYS 118 SG 11 1 Y 1 A LYS 186 ? CG ? A LYS 186 CG 12 1 Y 1 A LYS 186 ? CD ? A LYS 186 CD 13 1 Y 1 A LYS 186 ? CE ? A LYS 186 CE 14 1 Y 1 A LYS 186 ? NZ ? A LYS 186 NZ 15 1 Y 1 A LYS 244 ? CG ? A LYS 244 CG 16 1 Y 1 A LYS 244 ? CD ? A LYS 244 CD 17 1 Y 1 A LYS 244 ? CE ? A LYS 244 CE 18 1 Y 1 A LYS 244 ? NZ ? A LYS 244 NZ 19 1 Y 1 A ASN 327 ? CG ? A ASN 327 CG 20 1 Y 1 A ASN 327 ? OD1 ? A ASN 327 OD1 21 1 Y 1 A ASN 327 ? ND2 ? A ASN 327 ND2 22 1 Y 1 A ILE 328 ? CG1 ? A ILE 328 CG1 23 1 Y 1 A ILE 328 ? CG2 ? A ILE 328 CG2 24 1 Y 1 A ILE 328 ? CD1 ? A ILE 328 CD1 25 1 Y 1 A THR 331 ? OG1 ? A THR 331 OG1 26 1 Y 1 A THR 331 ? CG2 ? A THR 331 CG2 27 1 Y 1 A GLU 332 ? CG ? A GLU 332 CG 28 1 Y 1 A GLU 332 ? CD ? A GLU 332 CD 29 1 Y 1 A GLU 332 ? OE1 ? A GLU 332 OE1 30 1 Y 1 A GLU 332 ? OE2 ? A GLU 332 OE2 31 1 Y 1 A GLU 342 ? CG ? A GLU 342 CG 32 1 Y 1 A GLU 342 ? CD ? A GLU 342 CD 33 1 Y 1 A GLU 342 ? OE1 ? A GLU 342 OE1 34 1 Y 1 A GLU 342 ? OE2 ? A GLU 342 OE2 35 1 N 1 A OLC 403 ? C18 ? E OLC 1 C18 36 1 N 1 A OLC 403 ? C17 ? E OLC 1 C17 37 1 N 1 A OLC 403 ? C24 ? E OLC 1 C24 38 1 N 1 A OLC 403 ? C16 ? E OLC 1 C16 39 1 N 1 A OLC 403 ? C15 ? E OLC 1 C15 40 1 N 1 A OLC 403 ? C21 ? E OLC 1 C21 41 1 N 1 A OLC 403 ? C22 ? E OLC 1 C22 42 1 N 1 A OLC 403 ? O25 ? E OLC 1 O25 43 1 N 1 A OLC 403 ? O23 ? E OLC 1 O23 44 1 N 1 A OLC 404 ? C18 ? F OLC 1 C18 45 1 N 1 A OLC 404 ? C10 ? F OLC 1 C10 46 1 N 1 A OLC 404 ? C9 ? F OLC 1 C9 47 1 N 1 A OLC 404 ? C17 ? F OLC 1 C17 48 1 N 1 A OLC 404 ? C11 ? F OLC 1 C11 49 1 N 1 A OLC 404 ? C8 ? F OLC 1 C8 50 1 N 1 A OLC 404 ? C16 ? F OLC 1 C16 51 1 N 1 A OLC 404 ? C12 ? F OLC 1 C12 52 1 N 1 A OLC 404 ? C15 ? F OLC 1 C15 53 1 N 1 A OLC 404 ? C13 ? F OLC 1 C13 54 1 N 1 A OLC 404 ? C14 ? F OLC 1 C14 55 1 N 1 A OLC 405 ? C18 ? G OLC 1 C18 56 1 N 1 A OLC 405 ? C10 ? G OLC 1 C10 57 1 N 1 A OLC 405 ? C17 ? G OLC 1 C17 58 1 N 1 A OLC 405 ? C11 ? G OLC 1 C11 59 1 N 1 A OLC 405 ? C16 ? G OLC 1 C16 60 1 N 1 A OLC 405 ? C12 ? G OLC 1 C12 61 1 N 1 A OLC 405 ? C15 ? G OLC 1 C15 62 1 N 1 A OLC 405 ? C13 ? G OLC 1 C13 63 1 N 1 A OLC 405 ? C14 ? G OLC 1 C14 64 1 N 1 A OLC 406 ? C18 ? H OLC 1 C18 65 1 N 1 A OLC 406 ? C17 ? H OLC 1 C17 66 1 N 1 A OLC 406 ? C16 ? H OLC 1 C16 67 1 N 1 A OLC 406 ? C12 ? H OLC 1 C12 68 1 N 1 A OLC 406 ? C15 ? H OLC 1 C15 69 1 N 1 A OLC 406 ? C13 ? H OLC 1 C13 70 1 N 1 A OLC 406 ? C14 ? H OLC 1 C14 71 1 N 1 A OLC 407 ? C18 ? I OLC 1 C18 72 1 N 1 A OLC 407 ? C10 ? I OLC 1 C10 73 1 N 1 A OLC 407 ? C9 ? I OLC 1 C9 74 1 N 1 A OLC 407 ? C17 ? I OLC 1 C17 75 1 N 1 A OLC 407 ? C11 ? I OLC 1 C11 76 1 N 1 A OLC 407 ? C24 ? I OLC 1 C24 77 1 N 1 A OLC 407 ? C16 ? I OLC 1 C16 78 1 N 1 A OLC 407 ? C12 ? I OLC 1 C12 79 1 N 1 A OLC 407 ? C15 ? I OLC 1 C15 80 1 N 1 A OLC 407 ? C13 ? I OLC 1 C13 81 1 N 1 A OLC 407 ? C14 ? I OLC 1 C14 82 1 N 1 A OLC 407 ? C21 ? I OLC 1 C21 83 1 N 1 A OLC 407 ? C22 ? I OLC 1 C22 84 1 N 1 A OLC 407 ? O25 ? I OLC 1 O25 85 1 N 1 A OLC 407 ? O23 ? I OLC 1 O23 86 1 N 1 A OLC 408 ? C18 ? J OLC 1 C18 87 1 N 1 A OLC 408 ? C10 ? J OLC 1 C10 88 1 N 1 A OLC 408 ? C9 ? J OLC 1 C9 89 1 N 1 A OLC 408 ? C17 ? J OLC 1 C17 90 1 N 1 A OLC 408 ? C11 ? J OLC 1 C11 91 1 N 1 A OLC 408 ? C24 ? J OLC 1 C24 92 1 N 1 A OLC 408 ? C16 ? J OLC 1 C16 93 1 N 1 A OLC 408 ? C12 ? J OLC 1 C12 94 1 N 1 A OLC 408 ? C15 ? J OLC 1 C15 95 1 N 1 A OLC 408 ? C13 ? J OLC 1 C13 96 1 N 1 A OLC 408 ? C14 ? J OLC 1 C14 97 1 N 1 A OLC 408 ? C21 ? J OLC 1 C21 98 1 N 1 A OLC 408 ? C22 ? J OLC 1 C22 99 1 N 1 A OLC 408 ? O25 ? J OLC 1 O25 100 1 N 1 A OLC 408 ? O23 ? J OLC 1 O23 101 1 N 1 A OLC 409 ? C18 ? K OLC 1 C18 102 1 N 1 A OLC 409 ? C17 ? K OLC 1 C17 103 1 N 1 A OLC 409 ? C11 ? K OLC 1 C11 104 1 N 1 A OLC 409 ? C24 ? K OLC 1 C24 105 1 N 1 A OLC 409 ? C16 ? K OLC 1 C16 106 1 N 1 A OLC 409 ? C12 ? K OLC 1 C12 107 1 N 1 A OLC 409 ? C15 ? K OLC 1 C15 108 1 N 1 A OLC 409 ? C13 ? K OLC 1 C13 109 1 N 1 A OLC 409 ? C14 ? K OLC 1 C14 110 1 N 1 A OLC 409 ? C21 ? K OLC 1 C21 111 1 N 1 A OLC 409 ? C1 ? K OLC 1 C1 112 1 N 1 A OLC 409 ? C22 ? K OLC 1 C22 113 1 N 1 A OLC 409 ? O19 ? K OLC 1 O19 114 1 N 1 A OLC 409 ? O25 ? K OLC 1 O25 115 1 N 1 A OLC 409 ? O23 ? K OLC 1 O23 116 1 N 1 A OLC 409 ? O20 ? K OLC 1 O20 117 1 N 1 A OLC 410 ? C18 ? L OLC 1 C18 118 1 N 1 A OLC 410 ? C10 ? L OLC 1 C10 119 1 N 1 A OLC 410 ? C17 ? L OLC 1 C17 120 1 N 1 A OLC 410 ? C11 ? L OLC 1 C11 121 1 N 1 A OLC 410 ? C24 ? L OLC 1 C24 122 1 N 1 A OLC 410 ? C16 ? L OLC 1 C16 123 1 N 1 A OLC 410 ? C12 ? L OLC 1 C12 124 1 N 1 A OLC 410 ? C15 ? L OLC 1 C15 125 1 N 1 A OLC 410 ? C13 ? L OLC 1 C13 126 1 N 1 A OLC 410 ? C14 ? L OLC 1 C14 127 1 N 1 A OLC 410 ? C21 ? L OLC 1 C21 128 1 N 1 A OLC 410 ? C1 ? L OLC 1 C1 129 1 N 1 A OLC 410 ? C22 ? L OLC 1 C22 130 1 N 1 A OLC 410 ? O19 ? L OLC 1 O19 131 1 N 1 A OLC 410 ? O25 ? L OLC 1 O25 132 1 N 1 A OLC 410 ? O23 ? L OLC 1 O23 133 1 N 1 A OLC 410 ? O20 ? L OLC 1 O20 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? CrystFEL ? ? ? 0.6.3 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? CrystFEL ? ? ? 0.6.3 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7E6Y _cell.details ? _cell.formula_units_Z ? _cell.length_a 61.800 _cell.length_a_esd ? _cell.length_b 142.200 _cell.length_b_esd ? _cell.length_c 94.700 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7E6Y _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7E6Y _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.62 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 53.07 _exptl_crystal.description ;This is a time-resolved study and two sets of structure factors are deposited: extrapolated and observed data. Data collection statistics is about the latter but we used the former for refinement, where some reflections were rejected. ; _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'LIPIDIC CUBIC PHASE' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.9 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100 mM MES, pH 6.9, 100 mM Na formate, and 30% PEG500DM' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 293 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type MPCCD _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-10-12 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.77 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'FREE ELECTRON LASER' _diffrn_source.target ? _diffrn_source.type 'SACLA BEAMLINE BL3' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.77 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL3 _diffrn_source.pdbx_synchrotron_site SACLA # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7E6Y _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.40 _reflns.d_resolution_low 39.41 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 16730 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.00 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 131.1 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 6.15 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.9873 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split 0.100 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 6.506 39.526 ? 13.21 ? ? ? ? 916 100.00 ? ? ? ? ? ? ? ? ? ? ? ? ? 344.4 ? ? ? ? ? ? ? 1 1 0.9789 ? 0.0864 5.168 6.506 ? 12.32 ? ? ? ? 865 100.00 ? ? ? ? ? ? ? ? ? ? ? ? ? 232.4 ? ? ? ? ? ? ? 2 1 0.9832 ? 0.0815 4.515 5.168 ? 13.86 ? ? ? ? 860 100.00 ? ? ? ? ? ? ? ? ? ? ? ? ? 202.0 ? ? ? ? ? ? ? 3 1 0.9871 ? 0.0741 4.103 4.515 ? 13.60 ? ? ? ? 847 100.00 ? ? ? ? ? ? ? ? ? ? ? ? ? 184.3 ? ? ? ? ? ? ? 4 1 0.9802 ? 0.0756 3.810 4.103 ? 12.19 ? ? ? ? 846 100.00 ? ? ? ? ? ? ? ? ? ? ? ? ? 168.9 ? ? ? ? ? ? ? 5 1 0.9877 ? 0.0795 3.584 3.810 ? 10.66 ? ? ? ? 834 100.00 ? ? ? ? ? ? ? ? ? ? ? ? ? 145.5 ? ? ? ? ? ? ? 6 1 0.9832 ? 0.0893 3.405 3.584 ? 8.18 ? ? ? ? 830 100.00 ? ? ? ? ? ? ? ? ? ? ? ? ? 126.8 ? ? ? ? ? ? ? 7 1 0.9818 ? 0.1101 3.257 3.405 ? 6.78 ? ? ? ? 831 100.00 ? ? ? ? ? ? ? ? ? ? ? ? ? 126.2 ? ? ? ? ? ? ? 8 1 0.9743 ? 0.1422 3.132 3.257 ? 5.71 ? ? ? ? 836 100.00 ? ? ? ? ? ? ? ? ? ? ? ? ? 122.8 ? ? ? ? ? ? ? 9 1 0.9696 ? 0.1653 3.024 3.132 ? 4.88 ? ? ? ? 843 100.00 ? ? ? ? ? ? ? ? ? ? ? ? ? 120.1 ? ? ? ? ? ? ? 10 1 0.9587 ? 0.1984 2.929 3.024 ? 3.85 ? ? ? ? 812 100.00 ? ? ? ? ? ? ? ? ? ? ? ? ? 116.1 ? ? ? ? ? ? ? 11 1 0.9435 ? 0.2621 2.846 2.929 ? 3.08 ? ? ? ? 820 100.00 ? ? ? ? ? ? ? ? ? ? ? ? ? 111.5 ? ? ? ? ? ? ? 12 1 0.9222 ? 0.3182 2.771 2.846 ? 2.66 ? ? ? ? 824 100.00 ? ? ? ? ? ? ? ? ? ? ? ? ? 106.4 ? ? ? ? ? ? ? 13 1 0.9139 ? 0.3694 2.703 2.771 ? 2.22 ? ? ? ? 839 100.00 ? ? ? ? ? ? ? ? ? ? ? ? ? 98.6 ? ? ? ? ? ? ? 14 1 0.8579 ? 0.4544 2.641 2.703 ? 1.87 ? ? ? ? 827 100.00 ? ? ? ? ? ? ? ? ? ? ? ? ? 90.2 ? ? ? ? ? ? ? 15 1 0.8155 ? 0.5624 2.585 2.641 ? 1.55 ? ? ? ? 804 100.00 ? ? ? ? ? ? ? ? ? ? ? ? ? 80.2 ? ? ? ? ? ? ? 16 1 0.7840 ? 0.6748 2.534 2.585 ? 1.34 ? ? ? ? 850 100.00 ? ? ? ? ? ? ? ? ? ? ? ? ? 68.3 ? ? ? ? ? ? ? 17 1 0.7517 ? 0.7482 2.486 2.534 ? 1.23 ? ? ? ? 815 100.00 ? ? ? ? ? ? ? ? ? ? ? ? ? 57.1 ? ? ? ? ? ? ? 18 1 0.6766 ? 0.8820 2.441 2.486 ? 0.99 ? ? ? ? 823 100.00 ? ? ? ? ? ? ? ? ? ? ? ? ? 46.3 ? ? ? ? ? ? ? 19 1 0.5435 ? 1.0745 2.400 2.441 ? 0.86 ? ? ? ? 808 100.00 ? ? ? ? ? ? ? ? ? ? ? ? ? 37.8 ? ? ? ? ? ? ? 20 1 0.4389 ? 1.3251 # _refine.aniso_B[1][1] 0.8900 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] -4.0300 _refine.aniso_B[2][3] -0.0000 _refine.aniso_B[3][3] 3.1400 _refine.B_iso_max 227.760 _refine.B_iso_mean 68.7070 _refine.B_iso_min 11.930 _refine.correlation_coeff_Fo_to_Fc 0.7750 _refine.correlation_coeff_Fo_to_Fc_free 0.6960 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7E6Y _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.5000 _refine.ls_d_res_low 14.9600 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10428 _refine.ls_number_reflns_R_free 542 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 74.0600 _refine.ls_percent_reflns_R_free 4.9000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.4485 _refine.ls_R_factor_R_free 0.5148 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.4448 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3ug9 _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 3.5590 _refine.pdbx_overall_ESU_R_Free 0.7120 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 84.5540 _refine.overall_SU_ML 1.6920 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.5000 _refine_hist.d_res_low 14.9600 _refine_hist.number_atoms_solvent 38 _refine_hist.number_atoms_total 2529 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 296 _refine_hist.pdbx_B_iso_mean_ligand 73.57 _refine_hist.pdbx_B_iso_mean_solvent 45.06 _refine_hist.pdbx_number_atoms_protein 2317 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 174 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.012 0.013 2545 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.002 0.017 2439 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.595 1.648 3426 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.236 1.573 5598 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.049 4.993 294 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 37.020 21.579 114 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 19.415 15.000 371 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 20.177 15.000 7 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.066 0.200 329 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.008 0.020 2754 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 586 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.5000 _refine_ls_shell.d_res_low 2.5650 _refine_ls_shell.number_reflns_all 714 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 35 _refine_ls_shell.number_reflns_R_work 679 _refine_ls_shell.percent_reflns_obs 66.9800 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.7700 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.6870 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7E6Y _struct.title 'Time-resolved serial femtosecond crystallography reveals early structural changes in channelrhodopsin: 1 microsecond structure' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7E6Y _struct_keywords.text 'Channelrhodopsin, Rhodopsin, Membrane Protein' _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 4 ? G N N 4 ? H N N 4 ? I N N 4 ? J N N 4 ? K N N 4 ? L N N 4 ? M N N 5 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP Q93WP2_CHLRE Q93WP2 ? 1 ;MSRRPWLLALALAVALAAGSAGASTGSDATVPVATQDGPDYVFHRAHERMLFQTSYTLENNGSVICIPNNGQCFCLAWLK SNGTNAEKLAANILQWITFALSALCLMFYGYQTWKSTCGWEEIYVATIEMIKFIIEYFHEFDEPAVIYSSNGNKTVWLRY AEWLLTCPVILIHLSNLTGLANDYNKRTMGLLVSDIGTIVWGTTAALSKGYVRVIFFLMGLCYGIYTFFNAAKVYIEAYH TVPKG ; 1 2 UNP Q8RUT8_CHLRE Q8RUT8 ? 1 ;RCRQVVTGMAWLFFVSWGMFPILFILGPEGFGVLSVYGSTVGHTIIDLMSKNCWGLLGHYLRVLIHEHILIHGDIRKTTK LNIGGTEIEVETLVEDEAEAGAV ; 207 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7E6Y A 1 ? 245 ? Q93WP2 1 ? 245 ? 1 245 2 2 7E6Y A 246 ? 348 ? Q8RUT8 207 ? 309 ? 246 348 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 2 7E6Y SER A 349 ? UNP Q8RUT8 ? ? 'expression tag' 349 1 2 7E6Y SER A 350 ? UNP Q8RUT8 ? ? 'expression tag' 350 2 2 7E6Y GLU A 351 ? UNP Q8RUT8 ? ? 'expression tag' 351 3 2 7E6Y ASP A 352 ? UNP Q8RUT8 ? ? 'expression tag' 352 4 2 7E6Y LEU A 353 ? UNP Q8RUT8 ? ? 'expression tag' 353 5 2 7E6Y TYR A 354 ? UNP Q8RUT8 ? ? 'expression tag' 354 6 2 7E6Y PHE A 355 ? UNP Q8RUT8 ? ? 'expression tag' 355 7 2 7E6Y GLN A 356 ? UNP Q8RUT8 ? ? 'expression tag' 356 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 8200 ? 1 MORE -52 ? 1 'SSA (A^2)' 26490 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J,K,L,M # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 3_555 -x,y,-z+1/2 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 47.3500000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 CYS A 75 ? LYS A 80 ? CYS A 75 LYS A 80 5 ? 6 HELX_P HELX_P2 AA2 THR A 84 ? GLY A 110 ? THR A 84 GLY A 110 1 ? 27 HELX_P HELX_P3 AA3 GLY A 119 ? GLU A 140 ? GLY A 119 GLU A 140 1 ? 22 HELX_P HELX_P4 AA4 VAL A 156 ? SER A 175 ? VAL A 156 SER A 175 1 ? 20 HELX_P HELX_P5 AA5 ASN A 185 ? SER A 208 ? ASN A 185 SER A 208 1 ? 24 HELX_P HELX_P6 AA6 LYS A 209 ? VAL A 242 ? LYS A 209 VAL A 242 1 ? 34 HELX_P HELX_P7 AA7 GLY A 245 ? GLY A 272 ? GLY A 245 GLY A 272 1 ? 28 HELX_P HELX_P8 AA8 SER A 280 ? LYS A 296 ? SER A 280 LYS A 296 1 ? 17 HELX_P HELX_P9 AA9 LYS A 296 ? HIS A 317 ? LYS A 296 HIS A 317 1 ? 22 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 73 SG ? ? ? 1_555 A CYS 75 SG ? ? A CYS 73 A CYS 75 3_555 ? ? ? ? ? ? ? 2.380 ? ? covale1 covale one ? A ASN 61 ND2 ? ? ? 1_555 B NAG . C1 ? ? A ASN 61 E NAG 1 1_555 ? ? ? ? ? ? ? 1.464 ? N-Glycosylation covale2 covale one ? A LYS 296 NZ ? ? ? 1_555 C RET . C15 ? ? A LYS 296 A RET 401 1_555 ? ? ? ? ? ? ? 1.324 ? ? covale3 covale both ? B NAG . O4 ? ? ? 1_555 B NAG . C1 ? ? E NAG 1 E NAG 2 1_555 ? ? ? ? ? ? ? 1.358 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 NAG B . ? ASN A 61 ? NAG E 1 ? 1_555 ASN A 61 ? 1_555 C1 ND2 ASN 1 NAG N-Glycosylation Carbohydrate 2 RET C . ? LYS A 296 ? RET A 401 ? 1_555 LYS A 296 ? 1_555 C15 NZ LYS 1 RET Retinoylation Lipid/lipid-like 3 CYS A 73 ? CYS A 75 ? CYS A 73 ? 1_555 CYS A 75 ? 3_555 SG SG . . . None 'Disulfide bridge' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLU _struct_mon_prot_cis.label_seq_id 143 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLU _struct_mon_prot_cis.auth_seq_id 143 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 144 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 144 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 9.73 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 57 ? GLU A 59 ? THR A 57 GLU A 59 AA1 2 VAL A 64 ? CYS A 66 ? VAL A 64 CYS A 66 AA2 1 ILE A 147 ? TYR A 148 ? ILE A 147 TYR A 148 AA2 2 LYS A 154 ? THR A 155 ? LYS A 154 THR A 155 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 59 ? N GLU A 59 O VAL A 64 ? O VAL A 64 AA2 1 2 N ILE A 147 ? N ILE A 147 O THR A 155 ? O THR A 155 # _pdbx_entry_details.entry_id 7E6Y _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 NE2 A HIS 288 ? ? O A HOH 501 ? ? 1.82 2 1 O A LEU 165 ? ? O A HOH 502 ? ? 1.99 3 1 OE1 A GLU 162 ? ? O A HOH 503 ? ? 2.03 4 1 O A GLU 140 ? ? O A HOH 504 ? ? 2.10 5 1 CD1 A ILE 215 ? ? O20 A OLC 403 ? ? 2.13 6 1 OG1 A THR 155 ? ? O A HOH 505 ? ? 2.13 7 1 OD1 A ASP 195 ? ? O A HOH 506 ? ? 2.16 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 SG A CYS 66 ? ? 1_555 SG A CYS 66 ? ? 3_555 1.65 2 1 OE1 A GLU 351 ? ? 1_555 OE1 A GLU 351 ? ? 4_565 2.04 3 1 O A SER 349 ? ? 1_555 O A SER 349 ? ? 4_565 2.05 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 51 ? ? -102.73 40.16 2 1 HIS A 139 ? ? -145.23 40.07 3 1 LYS A 296 ? ? -107.41 -76.73 4 1 ILE A 316 ? ? -102.54 -61.37 5 1 ASN A 327 ? ? -144.31 26.78 6 1 ALA A 345 ? ? -164.32 54.77 7 1 SER A 349 ? ? -68.08 90.60 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A SER 2 ? A SER 2 3 1 Y 1 A ARG 3 ? A ARG 3 4 1 Y 1 A ARG 4 ? A ARG 4 5 1 Y 1 A PRO 5 ? A PRO 5 6 1 Y 1 A TRP 6 ? A TRP 6 7 1 Y 1 A LEU 7 ? A LEU 7 8 1 Y 1 A LEU 8 ? A LEU 8 9 1 Y 1 A ALA 9 ? A ALA 9 10 1 Y 1 A LEU 10 ? A LEU 10 11 1 Y 1 A ALA 11 ? A ALA 11 12 1 Y 1 A LEU 12 ? A LEU 12 13 1 Y 1 A ALA 13 ? A ALA 13 14 1 Y 1 A VAL 14 ? A VAL 14 15 1 Y 1 A ALA 15 ? A ALA 15 16 1 Y 1 A LEU 16 ? A LEU 16 17 1 Y 1 A ALA 17 ? A ALA 17 18 1 Y 1 A ALA 18 ? A ALA 18 19 1 Y 1 A GLY 19 ? A GLY 19 20 1 Y 1 A SER 20 ? A SER 20 21 1 Y 1 A ALA 21 ? A ALA 21 22 1 Y 1 A GLY 22 ? A GLY 22 23 1 Y 1 A ALA 23 ? A ALA 23 24 1 Y 1 A SER 24 ? A SER 24 25 1 Y 1 A THR 25 ? A THR 25 26 1 Y 1 A GLY 26 ? A GLY 26 27 1 Y 1 A SER 27 ? A SER 27 28 1 Y 1 A ASP 28 ? A ASP 28 29 1 Y 1 A ALA 29 ? A ALA 29 30 1 Y 1 A THR 30 ? A THR 30 31 1 Y 1 A VAL 31 ? A VAL 31 32 1 Y 1 A PRO 32 ? A PRO 32 33 1 Y 1 A VAL 33 ? A VAL 33 34 1 Y 1 A ALA 34 ? A ALA 34 35 1 Y 1 A THR 35 ? A THR 35 36 1 Y 1 A GLN 36 ? A GLN 36 37 1 Y 1 A ASP 37 ? A ASP 37 38 1 Y 1 A GLY 38 ? A GLY 38 39 1 Y 1 A PRO 39 ? A PRO 39 40 1 Y 1 A ASP 40 ? A ASP 40 41 1 Y 1 A TYR 41 ? A TYR 41 42 1 Y 1 A VAL 42 ? A VAL 42 43 1 Y 1 A PHE 43 ? A PHE 43 44 1 Y 1 A HIS 44 ? A HIS 44 45 1 Y 1 A ARG 45 ? A ARG 45 46 1 Y 1 A ALA 46 ? A ALA 46 47 1 Y 1 A HIS 47 ? A HIS 47 48 1 Y 1 A GLU 48 ? A GLU 48 49 1 Y 1 A GLN 112 ? A GLN 112 50 1 Y 1 A THR 113 ? A THR 113 51 1 Y 1 A TRP 114 ? A TRP 114 52 1 Y 1 A LYS 115 ? A LYS 115 53 1 Y 1 A SER 116 ? A SER 116 54 1 Y 1 A THR 117 ? A THR 117 55 1 Y 1 A GLY 329 ? A GLY 329 56 1 Y 1 A GLY 330 ? A GLY 330 57 1 Y 1 A LEU 353 ? A LEU 353 58 1 Y 1 A TYR 354 ? A TYR 354 59 1 Y 1 A PHE 355 ? A PHE 355 60 1 Y 1 A GLN 356 ? A GLN 356 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 NAG C1 C N R 250 NAG C2 C N R 251 NAG C3 C N R 252 NAG C4 C N S 253 NAG C5 C N R 254 NAG C6 C N N 255 NAG C7 C N N 256 NAG C8 C N N 257 NAG N2 N N N 258 NAG O1 O N N 259 NAG O3 O N N 260 NAG O4 O N N 261 NAG O5 O N N 262 NAG O6 O N N 263 NAG O7 O N N 264 NAG H1 H N N 265 NAG H2 H N N 266 NAG H3 H N N 267 NAG H4 H N N 268 NAG H5 H N N 269 NAG H61 H N N 270 NAG H62 H N N 271 NAG H81 H N N 272 NAG H82 H N N 273 NAG H83 H N N 274 NAG HN2 H N N 275 NAG HO1 H N N 276 NAG HO3 H N N 277 NAG HO4 H N N 278 NAG HO6 H N N 279 OLC C18 C N N 280 OLC C10 C N N 281 OLC C9 C N N 282 OLC C17 C N N 283 OLC C11 C N N 284 OLC C8 C N N 285 OLC C24 C N N 286 OLC C16 C N N 287 OLC C12 C N N 288 OLC C7 C N N 289 OLC C15 C N N 290 OLC C13 C N N 291 OLC C6 C N N 292 OLC C14 C N N 293 OLC C5 C N N 294 OLC C4 C N N 295 OLC C3 C N N 296 OLC C2 C N N 297 OLC C21 C N N 298 OLC C1 C N N 299 OLC C22 C N R 300 OLC O19 O N N 301 OLC O25 O N N 302 OLC O23 O N N 303 OLC O20 O N N 304 OLC H18 H N N 305 OLC H18A H N N 306 OLC H18B H N N 307 OLC H10 H N N 308 OLC H9 H N N 309 OLC H17 H N N 310 OLC H17A H N N 311 OLC H11 H N N 312 OLC H11A H N N 313 OLC H8 H N N 314 OLC H8A H N N 315 OLC H24 H N N 316 OLC H24A H N N 317 OLC H16 H N N 318 OLC H16A H N N 319 OLC H12 H N N 320 OLC H12A H N N 321 OLC H7 H N N 322 OLC H7A H N N 323 OLC H15 H N N 324 OLC H15A H N N 325 OLC H13 H N N 326 OLC H13A H N N 327 OLC H6 H N N 328 OLC H6A H N N 329 OLC H14 H N N 330 OLC H14A H N N 331 OLC H5 H N N 332 OLC H5A H N N 333 OLC H4 H N N 334 OLC H4A H N N 335 OLC H3 H N N 336 OLC H3A H N N 337 OLC H2 H N N 338 OLC H2A H N N 339 OLC H21 H N N 340 OLC H21A H N N 341 OLC H22 H N N 342 OLC HO25 H N N 343 OLC HO23 H N N 344 PHE N N N N 345 PHE CA C N S 346 PHE C C N N 347 PHE O O N N 348 PHE CB C N N 349 PHE CG C Y N 350 PHE CD1 C Y N 351 PHE CD2 C Y N 352 PHE CE1 C Y N 353 PHE CE2 C Y N 354 PHE CZ C Y N 355 PHE OXT O N N 356 PHE H H N N 357 PHE H2 H N N 358 PHE HA H N N 359 PHE HB2 H N N 360 PHE HB3 H N N 361 PHE HD1 H N N 362 PHE HD2 H N N 363 PHE HE1 H N N 364 PHE HE2 H N N 365 PHE HZ H N N 366 PHE HXT H N N 367 PRO N N N N 368 PRO CA C N S 369 PRO C C N N 370 PRO O O N N 371 PRO CB C N N 372 PRO CG C N N 373 PRO CD C N N 374 PRO OXT O N N 375 PRO H H N N 376 PRO HA H N N 377 PRO HB2 H N N 378 PRO HB3 H N N 379 PRO HG2 H N N 380 PRO HG3 H N N 381 PRO HD2 H N N 382 PRO HD3 H N N 383 PRO HXT H N N 384 RET C1 C N N 385 RET C2 C N N 386 RET C3 C N N 387 RET C4 C N N 388 RET C5 C N N 389 RET C6 C N N 390 RET C7 C N N 391 RET C8 C N N 392 RET C9 C N N 393 RET C10 C N N 394 RET C11 C N N 395 RET C12 C N N 396 RET C13 C N N 397 RET C14 C N N 398 RET C15 C N N 399 RET O1 O N N 400 RET C16 C N N 401 RET C17 C N N 402 RET C18 C N N 403 RET C19 C N N 404 RET C20 C N N 405 RET H21 H N N 406 RET H22 H N N 407 RET H31 H N N 408 RET H32 H N N 409 RET H41 H N N 410 RET H42 H N N 411 RET H7 H N N 412 RET H8 H N N 413 RET H10 H N N 414 RET H11 H N N 415 RET H12 H N N 416 RET H14 H N N 417 RET H15 H N N 418 RET H161 H N N 419 RET H162 H N N 420 RET H163 H N N 421 RET H171 H N N 422 RET H172 H N N 423 RET H173 H N N 424 RET H181 H N N 425 RET H182 H N N 426 RET H183 H N N 427 RET H191 H N N 428 RET H192 H N N 429 RET H193 H N N 430 RET H201 H N N 431 RET H202 H N N 432 RET H203 H N N 433 SER N N N N 434 SER CA C N S 435 SER C C N N 436 SER O O N N 437 SER CB C N N 438 SER OG O N N 439 SER OXT O N N 440 SER H H N N 441 SER H2 H N N 442 SER HA H N N 443 SER HB2 H N N 444 SER HB3 H N N 445 SER HG H N N 446 SER HXT H N N 447 THR N N N N 448 THR CA C N S 449 THR C C N N 450 THR O O N N 451 THR CB C N R 452 THR OG1 O N N 453 THR CG2 C N N 454 THR OXT O N N 455 THR H H N N 456 THR H2 H N N 457 THR HA H N N 458 THR HB H N N 459 THR HG1 H N N 460 THR HG21 H N N 461 THR HG22 H N N 462 THR HG23 H N N 463 THR HXT H N N 464 TRP N N N N 465 TRP CA C N S 466 TRP C C N N 467 TRP O O N N 468 TRP CB C N N 469 TRP CG C Y N 470 TRP CD1 C Y N 471 TRP CD2 C Y N 472 TRP NE1 N Y N 473 TRP CE2 C Y N 474 TRP CE3 C Y N 475 TRP CZ2 C Y N 476 TRP CZ3 C Y N 477 TRP CH2 C Y N 478 TRP OXT O N N 479 TRP H H N N 480 TRP H2 H N N 481 TRP HA H N N 482 TRP HB2 H N N 483 TRP HB3 H N N 484 TRP HD1 H N N 485 TRP HE1 H N N 486 TRP HE3 H N N 487 TRP HZ2 H N N 488 TRP HZ3 H N N 489 TRP HH2 H N N 490 TRP HXT H N N 491 TYR N N N N 492 TYR CA C N S 493 TYR C C N N 494 TYR O O N N 495 TYR CB C N N 496 TYR CG C Y N 497 TYR CD1 C Y N 498 TYR CD2 C Y N 499 TYR CE1 C Y N 500 TYR CE2 C Y N 501 TYR CZ C Y N 502 TYR OH O N N 503 TYR OXT O N N 504 TYR H H N N 505 TYR H2 H N N 506 TYR HA H N N 507 TYR HB2 H N N 508 TYR HB3 H N N 509 TYR HD1 H N N 510 TYR HD2 H N N 511 TYR HE1 H N N 512 TYR HE2 H N N 513 TYR HH H N N 514 TYR HXT H N N 515 VAL N N N N 516 VAL CA C N S 517 VAL C C N N 518 VAL O O N N 519 VAL CB C N N 520 VAL CG1 C N N 521 VAL CG2 C N N 522 VAL OXT O N N 523 VAL H H N N 524 VAL H2 H N N 525 VAL HA H N N 526 VAL HB H N N 527 VAL HG11 H N N 528 VAL HG12 H N N 529 VAL HG13 H N N 530 VAL HG21 H N N 531 VAL HG22 H N N 532 VAL HG23 H N N 533 VAL HXT H N N 534 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 NAG C1 C2 sing N N 237 NAG C1 O1 sing N N 238 NAG C1 O5 sing N N 239 NAG C1 H1 sing N N 240 NAG C2 C3 sing N N 241 NAG C2 N2 sing N N 242 NAG C2 H2 sing N N 243 NAG C3 C4 sing N N 244 NAG C3 O3 sing N N 245 NAG C3 H3 sing N N 246 NAG C4 C5 sing N N 247 NAG C4 O4 sing N N 248 NAG C4 H4 sing N N 249 NAG C5 C6 sing N N 250 NAG C5 O5 sing N N 251 NAG C5 H5 sing N N 252 NAG C6 O6 sing N N 253 NAG C6 H61 sing N N 254 NAG C6 H62 sing N N 255 NAG C7 C8 sing N N 256 NAG C7 N2 sing N N 257 NAG C7 O7 doub N N 258 NAG C8 H81 sing N N 259 NAG C8 H82 sing N N 260 NAG C8 H83 sing N N 261 NAG N2 HN2 sing N N 262 NAG O1 HO1 sing N N 263 NAG O3 HO3 sing N N 264 NAG O4 HO4 sing N N 265 NAG O6 HO6 sing N N 266 OLC C18 C17 sing N N 267 OLC C10 C9 doub N N 268 OLC C10 C11 sing N N 269 OLC C9 C8 sing N N 270 OLC C17 C16 sing N Z 271 OLC C11 C12 sing N N 272 OLC C8 C7 sing N N 273 OLC C24 C22 sing N N 274 OLC C24 O25 sing N N 275 OLC C16 C15 sing N N 276 OLC C12 C13 sing N N 277 OLC C7 C6 sing N N 278 OLC C15 C14 sing N N 279 OLC C13 C14 sing N N 280 OLC C6 C5 sing N N 281 OLC C5 C4 sing N N 282 OLC C4 C3 sing N N 283 OLC C3 C2 sing N N 284 OLC C2 C1 sing N N 285 OLC C21 C22 sing N N 286 OLC C21 O20 sing N N 287 OLC C1 O19 doub N N 288 OLC C1 O20 sing N N 289 OLC C22 O23 sing N N 290 OLC C18 H18 sing N N 291 OLC C18 H18A sing N N 292 OLC C18 H18B sing N N 293 OLC C10 H10 sing N N 294 OLC C9 H9 sing N N 295 OLC C17 H17 sing N N 296 OLC C17 H17A sing N N 297 OLC C11 H11 sing N N 298 OLC C11 H11A sing N N 299 OLC C8 H8 sing N N 300 OLC C8 H8A sing N N 301 OLC C24 H24 sing N N 302 OLC C24 H24A sing N N 303 OLC C16 H16 sing N N 304 OLC C16 H16A sing N N 305 OLC C12 H12 sing N N 306 OLC C12 H12A sing N N 307 OLC C7 H7 sing N N 308 OLC C7 H7A sing N N 309 OLC C15 H15 sing N N 310 OLC C15 H15A sing N N 311 OLC C13 H13 sing N N 312 OLC C13 H13A sing N N 313 OLC C6 H6 sing N N 314 OLC C6 H6A sing N N 315 OLC C14 H14 sing N N 316 OLC C14 H14A sing N N 317 OLC C5 H5 sing N N 318 OLC C5 H5A sing N N 319 OLC C4 H4 sing N N 320 OLC C4 H4A sing N N 321 OLC C3 H3 sing N N 322 OLC C3 H3A sing N N 323 OLC C2 H2 sing N N 324 OLC C2 H2A sing N N 325 OLC C21 H21 sing N N 326 OLC C21 H21A sing N N 327 OLC C22 H22 sing N N 328 OLC O25 HO25 sing N N 329 OLC O23 HO23 sing N N 330 PHE N CA sing N N 331 PHE N H sing N N 332 PHE N H2 sing N N 333 PHE CA C sing N N 334 PHE CA CB sing N N 335 PHE CA HA sing N N 336 PHE C O doub N N 337 PHE C OXT sing N N 338 PHE CB CG sing N N 339 PHE CB HB2 sing N N 340 PHE CB HB3 sing N N 341 PHE CG CD1 doub Y N 342 PHE CG CD2 sing Y N 343 PHE CD1 CE1 sing Y N 344 PHE CD1 HD1 sing N N 345 PHE CD2 CE2 doub Y N 346 PHE CD2 HD2 sing N N 347 PHE CE1 CZ doub Y N 348 PHE CE1 HE1 sing N N 349 PHE CE2 CZ sing Y N 350 PHE CE2 HE2 sing N N 351 PHE CZ HZ sing N N 352 PHE OXT HXT sing N N 353 PRO N CA sing N N 354 PRO N CD sing N N 355 PRO N H sing N N 356 PRO CA C sing N N 357 PRO CA CB sing N N 358 PRO CA HA sing N N 359 PRO C O doub N N 360 PRO C OXT sing N N 361 PRO CB CG sing N N 362 PRO CB HB2 sing N N 363 PRO CB HB3 sing N N 364 PRO CG CD sing N N 365 PRO CG HG2 sing N N 366 PRO CG HG3 sing N N 367 PRO CD HD2 sing N N 368 PRO CD HD3 sing N N 369 PRO OXT HXT sing N N 370 RET C1 C2 sing N N 371 RET C1 C6 sing N N 372 RET C1 C16 sing N N 373 RET C1 C17 sing N N 374 RET C2 C3 sing N N 375 RET C2 H21 sing N N 376 RET C2 H22 sing N N 377 RET C3 C4 sing N N 378 RET C3 H31 sing N N 379 RET C3 H32 sing N N 380 RET C4 C5 sing N N 381 RET C4 H41 sing N N 382 RET C4 H42 sing N N 383 RET C5 C6 doub N N 384 RET C5 C18 sing N N 385 RET C6 C7 sing N N 386 RET C7 C8 doub N E 387 RET C7 H7 sing N N 388 RET C8 C9 sing N N 389 RET C8 H8 sing N N 390 RET C9 C10 doub N E 391 RET C9 C19 sing N N 392 RET C10 C11 sing N N 393 RET C10 H10 sing N N 394 RET C11 C12 doub N E 395 RET C11 H11 sing N N 396 RET C12 C13 sing N N 397 RET C12 H12 sing N N 398 RET C13 C14 doub N E 399 RET C13 C20 sing N N 400 RET C14 C15 sing N N 401 RET C14 H14 sing N N 402 RET C15 O1 doub N N 403 RET C15 H15 sing N N 404 RET C16 H161 sing N N 405 RET C16 H162 sing N N 406 RET C16 H163 sing N N 407 RET C17 H171 sing N N 408 RET C17 H172 sing N N 409 RET C17 H173 sing N N 410 RET C18 H181 sing N N 411 RET C18 H182 sing N N 412 RET C18 H183 sing N N 413 RET C19 H191 sing N N 414 RET C19 H192 sing N N 415 RET C19 H193 sing N N 416 RET C20 H201 sing N N 417 RET C20 H202 sing N N 418 RET C20 H203 sing N N 419 SER N CA sing N N 420 SER N H sing N N 421 SER N H2 sing N N 422 SER CA C sing N N 423 SER CA CB sing N N 424 SER CA HA sing N N 425 SER C O doub N N 426 SER C OXT sing N N 427 SER CB OG sing N N 428 SER CB HB2 sing N N 429 SER CB HB3 sing N N 430 SER OG HG sing N N 431 SER OXT HXT sing N N 432 THR N CA sing N N 433 THR N H sing N N 434 THR N H2 sing N N 435 THR CA C sing N N 436 THR CA CB sing N N 437 THR CA HA sing N N 438 THR C O doub N N 439 THR C OXT sing N N 440 THR CB OG1 sing N N 441 THR CB CG2 sing N N 442 THR CB HB sing N N 443 THR OG1 HG1 sing N N 444 THR CG2 HG21 sing N N 445 THR CG2 HG22 sing N N 446 THR CG2 HG23 sing N N 447 THR OXT HXT sing N N 448 TRP N CA sing N N 449 TRP N H sing N N 450 TRP N H2 sing N N 451 TRP CA C sing N N 452 TRP CA CB sing N N 453 TRP CA HA sing N N 454 TRP C O doub N N 455 TRP C OXT sing N N 456 TRP CB CG sing N N 457 TRP CB HB2 sing N N 458 TRP CB HB3 sing N N 459 TRP CG CD1 doub Y N 460 TRP CG CD2 sing Y N 461 TRP CD1 NE1 sing Y N 462 TRP CD1 HD1 sing N N 463 TRP CD2 CE2 doub Y N 464 TRP CD2 CE3 sing Y N 465 TRP NE1 CE2 sing Y N 466 TRP NE1 HE1 sing N N 467 TRP CE2 CZ2 sing Y N 468 TRP CE3 CZ3 doub Y N 469 TRP CE3 HE3 sing N N 470 TRP CZ2 CH2 doub Y N 471 TRP CZ2 HZ2 sing N N 472 TRP CZ3 CH2 sing Y N 473 TRP CZ3 HZ3 sing N N 474 TRP CH2 HH2 sing N N 475 TRP OXT HXT sing N N 476 TYR N CA sing N N 477 TYR N H sing N N 478 TYR N H2 sing N N 479 TYR CA C sing N N 480 TYR CA CB sing N N 481 TYR CA HA sing N N 482 TYR C O doub N N 483 TYR C OXT sing N N 484 TYR CB CG sing N N 485 TYR CB HB2 sing N N 486 TYR CB HB3 sing N N 487 TYR CG CD1 doub Y N 488 TYR CG CD2 sing Y N 489 TYR CD1 CE1 sing Y N 490 TYR CD1 HD1 sing N N 491 TYR CD2 CE2 doub Y N 492 TYR CD2 HD2 sing N N 493 TYR CE1 CZ doub Y N 494 TYR CE1 HE1 sing N N 495 TYR CE2 CZ sing Y N 496 TYR CE2 HE2 sing N N 497 TYR CZ OH sing N N 498 TYR OH HH sing N N 499 TYR OXT HXT sing N N 500 VAL N CA sing N N 501 VAL N H sing N N 502 VAL N H2 sing N N 503 VAL CA C sing N N 504 VAL CA CB sing N N 505 VAL CA HA sing N N 506 VAL C O doub N N 507 VAL C OXT sing N N 508 VAL CB CG1 sing N N 509 VAL CB CG2 sing N N 510 VAL CB HB sing N N 511 VAL CG1 HG11 sing N N 512 VAL CG1 HG12 sing N N 513 VAL CG1 HG13 sing N N 514 VAL CG2 HG21 sing N N 515 VAL CG2 HG22 sing N N 516 VAL CG2 HG23 sing N N 517 VAL OXT HXT sing N N 518 # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 NAG 1 n 2 NAG 2 n # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3UG9 _pdbx_initial_refinement_model.details ? # _pdbx_related_exp_data_set.ordinal 1 _pdbx_related_exp_data_set.data_set_type 'diffraction image data' _pdbx_related_exp_data_set.data_reference 10.11577/1768368 _pdbx_related_exp_data_set.metadata_reference ? _pdbx_related_exp_data_set.details ? # _atom_sites.entry_id 7E6Y _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.016181 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.007032 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010560 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_