data_7E7C # _entry.id 7E7C # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7E7C pdb_00007e7c 10.2210/pdb7e7c/pdb WWPDB D_1300020909 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-04-06 2 'Structure model' 1 1 2023-11-29 3 'Structure model' 1 2 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' 3 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model 4 3 'Structure model' pdbx_entry_details 5 3 'Structure model' pdbx_modification_feature # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 3 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7E7C _pdbx_database_status.recvd_initial_deposition_date 2021-02-25 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email lht@tsinghua.edu.cn _pdbx_contact_author.name_first Haitao _pdbx_contact_author.name_last Li _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-6741-293X # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Li, Y.' 1 ? 'Li, H.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of ENL YEATS domain T1 mutant in complex with histone H3 acetylation at K27' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Li, Y.' 1 ? primary 'Li, H.' 2 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protein ENL' 18872.688 1 ? ? ? ? 2 polymer syn 'Histone H3K27ac(24-27) peptide' 487.573 1 ? ? ? ? 3 non-polymer syn 1,2-ETHANEDIOL 62.068 2 ? ? ? ? 4 non-polymer syn 'IODIDE ION' 126.904 2 ? ? ? ? 5 water nat water 18.015 53 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'YEATS domain-containing protein 1' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GSHMDNQCTVQVRLELGHRAQLRKKPTTEGFTHDWMVFVRGPEQCDIQHFVEKVVFWLHDSFPKPRRVCKEPPYKVEESG YAGFIMPIEVHFKNKEEPRKVCFTYDLFLNLEGNPPVNHLNHLRCEKLTFNNPTTEFRYKLLRAGGVMVMPEGAHHHHHH ; ;GSHMDNQCTVQVRLELGHRAQLRKKPTTEGFTHDWMVFVRGPEQCDIQHFVEKVVFWLHDSFPKPRRVCKEPPYKVEESG YAGFIMPIEVHFKNKEEPRKVCFTYDLFLNLEGNPPVNHLNHLRCEKLTFNNPTTEFRYKLLRAGGVMVMPEGAHHHHHH ; A ? 2 'polypeptide(L)' no yes 'AAR(ALY)' AARK B ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 1,2-ETHANEDIOL EDO 4 'IODIDE ION' IOD 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 ASP n 1 6 ASN n 1 7 GLN n 1 8 CYS n 1 9 THR n 1 10 VAL n 1 11 GLN n 1 12 VAL n 1 13 ARG n 1 14 LEU n 1 15 GLU n 1 16 LEU n 1 17 GLY n 1 18 HIS n 1 19 ARG n 1 20 ALA n 1 21 GLN n 1 22 LEU n 1 23 ARG n 1 24 LYS n 1 25 LYS n 1 26 PRO n 1 27 THR n 1 28 THR n 1 29 GLU n 1 30 GLY n 1 31 PHE n 1 32 THR n 1 33 HIS n 1 34 ASP n 1 35 TRP n 1 36 MET n 1 37 VAL n 1 38 PHE n 1 39 VAL n 1 40 ARG n 1 41 GLY n 1 42 PRO n 1 43 GLU n 1 44 GLN n 1 45 CYS n 1 46 ASP n 1 47 ILE n 1 48 GLN n 1 49 HIS n 1 50 PHE n 1 51 VAL n 1 52 GLU n 1 53 LYS n 1 54 VAL n 1 55 VAL n 1 56 PHE n 1 57 TRP n 1 58 LEU n 1 59 HIS n 1 60 ASP n 1 61 SER n 1 62 PHE n 1 63 PRO n 1 64 LYS n 1 65 PRO n 1 66 ARG n 1 67 ARG n 1 68 VAL n 1 69 CYS n 1 70 LYS n 1 71 GLU n 1 72 PRO n 1 73 PRO n 1 74 TYR n 1 75 LYS n 1 76 VAL n 1 77 GLU n 1 78 GLU n 1 79 SER n 1 80 GLY n 1 81 TYR n 1 82 ALA n 1 83 GLY n 1 84 PHE n 1 85 ILE n 1 86 MET n 1 87 PRO n 1 88 ILE n 1 89 GLU n 1 90 VAL n 1 91 HIS n 1 92 PHE n 1 93 LYS n 1 94 ASN n 1 95 LYS n 1 96 GLU n 1 97 GLU n 1 98 PRO n 1 99 ARG n 1 100 LYS n 1 101 VAL n 1 102 CYS n 1 103 PHE n 1 104 THR n 1 105 TYR n 1 106 ASP n 1 107 LEU n 1 108 PHE n 1 109 LEU n 1 110 ASN n 1 111 LEU n 1 112 GLU n 1 113 GLY n 1 114 ASN n 1 115 PRO n 1 116 PRO n 1 117 VAL n 1 118 ASN n 1 119 HIS n 1 120 LEU n 1 121 ASN n 1 122 HIS n 1 123 LEU n 1 124 ARG n 1 125 CYS n 1 126 GLU n 1 127 LYS n 1 128 LEU n 1 129 THR n 1 130 PHE n 1 131 ASN n 1 132 ASN n 1 133 PRO n 1 134 THR n 1 135 THR n 1 136 GLU n 1 137 PHE n 1 138 ARG n 1 139 TYR n 1 140 LYS n 1 141 LEU n 1 142 LEU n 1 143 ARG n 1 144 ALA n 1 145 GLY n 1 146 GLY n 1 147 VAL n 1 148 MET n 1 149 VAL n 1 150 MET n 1 151 PRO n 1 152 GLU n 1 153 GLY n 1 154 ALA n 1 155 HIS n 1 156 HIS n 1 157 HIS n 1 158 HIS n 1 159 HIS n 1 160 HIS n 2 1 ALA n 2 2 ALA n 2 3 ARG n 2 4 ALY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 160 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'MLLT1, ENL, LTG19, YEATS1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 4 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ALY 'L-peptide linking' n 'N(6)-ACETYLLYSINE' ? 'C8 H16 N2 O3' 188.224 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 IOD non-polymer . 'IODIDE ION' ? 'I -1' 126.904 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 ? ? ? A . n A 1 2 SER 2 -1 ? ? ? A . n A 1 3 HIS 3 0 ? ? ? A . n A 1 4 MET 4 1 1 MET MET A . n A 1 5 ASP 5 2 2 ASP ASP A . n A 1 6 ASN 6 3 3 ASN ASN A . n A 1 7 GLN 7 4 4 GLN GLN A . n A 1 8 CYS 8 5 5 CYS CYS A . n A 1 9 THR 9 6 6 THR THR A . n A 1 10 VAL 10 7 7 VAL VAL A . n A 1 11 GLN 11 8 8 GLN GLN A . n A 1 12 VAL 12 9 9 VAL VAL A . n A 1 13 ARG 13 10 10 ARG ARG A . n A 1 14 LEU 14 11 11 LEU LEU A . n A 1 15 GLU 15 12 12 GLU GLU A . n A 1 16 LEU 16 13 13 LEU LEU A . n A 1 17 GLY 17 14 14 GLY GLY A . n A 1 18 HIS 18 15 15 HIS HIS A . n A 1 19 ARG 19 16 16 ARG ARG A . n A 1 20 ALA 20 17 17 ALA ALA A . n A 1 21 GLN 21 18 18 GLN GLN A . n A 1 22 LEU 22 19 19 LEU LEU A . n A 1 23 ARG 23 20 20 ARG ARG A . n A 1 24 LYS 24 21 21 LYS LYS A . n A 1 25 LYS 25 22 22 LYS LYS A . n A 1 26 PRO 26 23 23 PRO PRO A . n A 1 27 THR 27 24 24 THR THR A . n A 1 28 THR 28 25 25 THR THR A . n A 1 29 GLU 29 26 26 GLU GLU A . n A 1 30 GLY 30 27 27 GLY GLY A . n A 1 31 PHE 31 28 28 PHE PHE A . n A 1 32 THR 32 29 29 THR THR A . n A 1 33 HIS 33 30 30 HIS HIS A . n A 1 34 ASP 34 31 31 ASP ASP A . n A 1 35 TRP 35 32 32 TRP TRP A . n A 1 36 MET 36 33 33 MET MET A . n A 1 37 VAL 37 34 34 VAL VAL A . n A 1 38 PHE 38 35 35 PHE PHE A . n A 1 39 VAL 39 36 36 VAL VAL A . n A 1 40 ARG 40 37 37 ARG ARG A . n A 1 41 GLY 41 38 38 GLY GLY A . n A 1 42 PRO 42 39 39 PRO PRO A . n A 1 43 GLU 43 40 40 GLU GLU A . n A 1 44 GLN 44 41 41 GLN GLN A . n A 1 45 CYS 45 42 42 CYS CYS A . n A 1 46 ASP 46 43 43 ASP ASP A . n A 1 47 ILE 47 44 44 ILE ILE A . n A 1 48 GLN 48 45 45 GLN GLN A . n A 1 49 HIS 49 46 46 HIS HIS A . n A 1 50 PHE 50 47 47 PHE PHE A . n A 1 51 VAL 51 48 48 VAL VAL A . n A 1 52 GLU 52 49 49 GLU GLU A . n A 1 53 LYS 53 50 50 LYS LYS A . n A 1 54 VAL 54 51 51 VAL VAL A . n A 1 55 VAL 55 52 52 VAL VAL A . n A 1 56 PHE 56 53 53 PHE PHE A . n A 1 57 TRP 57 54 54 TRP TRP A . n A 1 58 LEU 58 55 55 LEU LEU A . n A 1 59 HIS 59 56 56 HIS HIS A . n A 1 60 ASP 60 57 57 ASP ASP A . n A 1 61 SER 61 58 58 SER SER A . n A 1 62 PHE 62 59 59 PHE PHE A . n A 1 63 PRO 63 60 60 PRO PRO A . n A 1 64 LYS 64 61 61 LYS LYS A . n A 1 65 PRO 65 62 62 PRO PRO A . n A 1 66 ARG 66 63 63 ARG ARG A . n A 1 67 ARG 67 64 64 ARG ARG A . n A 1 68 VAL 68 65 65 VAL VAL A . n A 1 69 CYS 69 66 66 CYS CYS A . n A 1 70 LYS 70 67 67 LYS LYS A . n A 1 71 GLU 71 68 68 GLU GLU A . n A 1 72 PRO 72 69 69 PRO PRO A . n A 1 73 PRO 73 70 70 PRO PRO A . n A 1 74 TYR 74 71 71 TYR TYR A . n A 1 75 LYS 75 72 72 LYS LYS A . n A 1 76 VAL 76 73 73 VAL VAL A . n A 1 77 GLU 77 74 74 GLU GLU A . n A 1 78 GLU 78 75 75 GLU GLU A . n A 1 79 SER 79 76 76 SER SER A . n A 1 80 GLY 80 77 77 GLY GLY A . n A 1 81 TYR 81 78 78 TYR TYR A . n A 1 82 ALA 82 79 79 ALA ALA A . n A 1 83 GLY 83 80 80 GLY GLY A . n A 1 84 PHE 84 81 81 PHE PHE A . n A 1 85 ILE 85 82 82 ILE ILE A . n A 1 86 MET 86 83 83 MET MET A . n A 1 87 PRO 87 84 84 PRO PRO A . n A 1 88 ILE 88 85 85 ILE ILE A . n A 1 89 GLU 89 86 86 GLU GLU A . n A 1 90 VAL 90 87 87 VAL VAL A . n A 1 91 HIS 91 88 88 HIS HIS A . n A 1 92 PHE 92 89 89 PHE PHE A . n A 1 93 LYS 93 90 90 LYS LYS A . n A 1 94 ASN 94 91 91 ASN ASN A . n A 1 95 LYS 95 92 92 LYS LYS A . n A 1 96 GLU 96 93 93 GLU GLU A . n A 1 97 GLU 97 94 94 GLU GLU A . n A 1 98 PRO 98 95 95 PRO PRO A . n A 1 99 ARG 99 96 96 ARG ARG A . n A 1 100 LYS 100 97 97 LYS LYS A . n A 1 101 VAL 101 98 98 VAL VAL A . n A 1 102 CYS 102 99 99 CYS CYS A . n A 1 103 PHE 103 100 100 PHE PHE A . n A 1 104 THR 104 101 101 THR THR A . n A 1 105 TYR 105 102 102 TYR TYR A . n A 1 106 ASP 106 103 103 ASP ASP A . n A 1 107 LEU 107 104 104 LEU LEU A . n A 1 108 PHE 108 105 105 PHE PHE A . n A 1 109 LEU 109 106 106 LEU LEU A . n A 1 110 ASN 110 107 107 ASN ASN A . n A 1 111 LEU 111 108 108 LEU LEU A . n A 1 112 GLU 112 109 109 GLU GLU A . n A 1 113 GLY 113 110 110 GLY GLY A . n A 1 114 ASN 114 111 111 ASN ASN A . n A 1 115 PRO 115 112 112 PRO PRO A . n A 1 116 PRO 116 113 113 PRO PRO A . n A 1 117 VAL 117 114 114 VAL VAL A . n A 1 118 ASN 118 115 115 ASN ASN A . n A 1 119 HIS 119 116 116 HIS HIS A . n A 1 120 LEU 120 117 117 LEU LEU A . n A 1 121 ASN 121 118 118 ASN ASN A . n A 1 122 HIS 122 119 119 HIS HIS A . n A 1 123 LEU 123 120 120 LEU LEU A . n A 1 124 ARG 124 121 121 ARG ARG A . n A 1 125 CYS 125 122 122 CYS CYS A . n A 1 126 GLU 126 123 123 GLU GLU A . n A 1 127 LYS 127 124 124 LYS LYS A . n A 1 128 LEU 128 125 125 LEU LEU A . n A 1 129 THR 129 126 126 THR THR A . n A 1 130 PHE 130 127 127 PHE PHE A . n A 1 131 ASN 131 128 128 ASN ASN A . n A 1 132 ASN 132 129 129 ASN ASN A . n A 1 133 PRO 133 130 130 PRO PRO A . n A 1 134 THR 134 131 131 THR THR A . n A 1 135 THR 135 132 132 THR THR A . n A 1 136 GLU 136 133 133 GLU GLU A . n A 1 137 PHE 137 134 134 PHE PHE A . n A 1 138 ARG 138 135 135 ARG ARG A . n A 1 139 TYR 139 136 136 TYR TYR A . n A 1 140 LYS 140 137 137 LYS LYS A . n A 1 141 LEU 141 138 138 LEU LEU A . n A 1 142 LEU 142 139 139 LEU LEU A . n A 1 143 ARG 143 140 140 ARG ARG A . n A 1 144 ALA 144 141 141 ALA ALA A . n A 1 145 GLY 145 142 142 GLY GLY A . n A 1 146 GLY 146 143 143 GLY GLY A . n A 1 147 VAL 147 144 144 VAL VAL A . n A 1 148 MET 148 145 145 MET MET A . n A 1 149 VAL 149 146 146 VAL VAL A . n A 1 150 MET 150 147 147 MET MET A . n A 1 151 PRO 151 148 148 PRO PRO A . n A 1 152 GLU 152 149 ? ? ? A . n A 1 153 GLY 153 150 ? ? ? A . n A 1 154 ALA 154 151 ? ? ? A . n A 1 155 HIS 155 152 ? ? ? A . n A 1 156 HIS 156 153 ? ? ? A . n A 1 157 HIS 157 154 ? ? ? A . n A 1 158 HIS 158 155 ? ? ? A . n A 1 159 HIS 159 156 ? ? ? A . n A 1 160 HIS 160 157 ? ? ? A . n B 2 1 ALA 1 24 24 ALA ALA B . n B 2 2 ALA 2 25 25 ALA ALA B . n B 2 3 ARG 3 26 26 ARG ARG B . n B 2 4 ALY 4 27 27 ALY ALY B . n # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 ALY ? ? ALY ? ? 'SUBJECT OF INVESTIGATION' ? 2 EDO ? ? EDO ? ? 'SUBJECT OF INVESTIGATION' ? 3 IOD ? ? IOD ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 EDO 1 201 201 EDO EDO A . D 3 EDO 1 202 301 EDO EDO A . E 4 IOD 1 203 1 IOD IOD A . F 4 IOD 1 204 2 IOD IOD A . G 5 HOH 1 301 20 HOH HOH A . G 5 HOH 2 302 36 HOH HOH A . G 5 HOH 3 303 35 HOH HOH A . G 5 HOH 4 304 2 HOH HOH A . G 5 HOH 5 305 10 HOH HOH A . G 5 HOH 6 306 26 HOH HOH A . G 5 HOH 7 307 25 HOH HOH A . G 5 HOH 8 308 42 HOH HOH A . G 5 HOH 9 309 11 HOH HOH A . G 5 HOH 10 310 8 HOH HOH A . G 5 HOH 11 311 1 HOH HOH A . G 5 HOH 12 312 9 HOH HOH A . G 5 HOH 13 313 23 HOH HOH A . G 5 HOH 14 314 17 HOH HOH A . G 5 HOH 15 315 7 HOH HOH A . G 5 HOH 16 316 13 HOH HOH A . G 5 HOH 17 317 22 HOH HOH A . G 5 HOH 18 318 4 HOH HOH A . G 5 HOH 19 319 46 HOH HOH A . G 5 HOH 20 320 16 HOH HOH A . G 5 HOH 21 321 6 HOH HOH A . G 5 HOH 22 322 3 HOH HOH A . G 5 HOH 23 323 29 HOH HOH A . G 5 HOH 24 324 38 HOH HOH A . G 5 HOH 25 325 48 HOH HOH A . G 5 HOH 26 326 33 HOH HOH A . G 5 HOH 27 327 15 HOH HOH A . G 5 HOH 28 328 30 HOH HOH A . G 5 HOH 29 329 28 HOH HOH A . G 5 HOH 30 330 32 HOH HOH A . G 5 HOH 31 331 43 HOH HOH A . G 5 HOH 32 332 14 HOH HOH A . G 5 HOH 33 333 51 HOH HOH A . G 5 HOH 34 334 12 HOH HOH A . G 5 HOH 35 335 21 HOH HOH A . G 5 HOH 36 336 39 HOH HOH A . G 5 HOH 37 337 45 HOH HOH A . G 5 HOH 38 338 49 HOH HOH A . G 5 HOH 39 339 52 HOH HOH A . G 5 HOH 40 340 31 HOH HOH A . G 5 HOH 41 341 24 HOH HOH A . G 5 HOH 42 342 34 HOH HOH A . G 5 HOH 43 343 53 HOH HOH A . G 5 HOH 44 344 27 HOH HOH A . G 5 HOH 45 345 44 HOH HOH A . G 5 HOH 46 346 18 HOH HOH A . G 5 HOH 47 347 37 HOH HOH A . G 5 HOH 48 348 40 HOH HOH A . G 5 HOH 49 349 50 HOH HOH A . G 5 HOH 50 350 41 HOH HOH A . G 5 HOH 51 351 47 HOH HOH A . H 5 HOH 1 101 5 HOH HOH B . H 5 HOH 2 102 19 HOH HOH B . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.17.1_3660 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7E7C _cell.details ? _cell.formula_units_Z ? _cell.length_a 38.635 _cell.length_a_esd ? _cell.length_b 118.065 _cell.length_b_esd ? _cell.length_c 34.350 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7E7C _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7E7C _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.02 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 39.21 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '25% PEG 4000, 0.1M MES pH 6.5, 0.2M Potassium iodide' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MAR CCD 130 mm' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-11-02 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9779 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL19U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9779 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL19U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7E7C _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.840 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14147 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.800 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.000 _reflns.pdbx_Rmerge_I_obs 0.129 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.200 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.551 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.138 _reflns.pdbx_Rpim_I_all 0.047 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 141761 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 1.840 1.870 ? ? ? ? ? ? 659 99.100 ? ? ? ? 0.816 ? ? ? ? ? ? ? ? 12.100 ? 0.927 ? ? 0.852 0.244 ? 1 1 0.876 ? ? ? ? ? ? ? ? ? ? 1.870 1.910 ? ? ? ? ? ? 709 99.900 ? ? ? ? 0.788 ? ? ? ? ? ? ? ? 11.700 ? 1.158 ? ? 0.825 0.239 ? 2 1 0.808 ? ? ? ? ? ? ? ? ? ? 1.910 1.940 ? ? ? ? ? ? 672 96.700 ? ? ? ? 0.648 ? ? ? ? ? ? ? ? 11.900 ? 1.458 ? ? 0.678 0.196 ? 3 1 0.952 ? ? ? ? ? ? ? ? ? ? 1.940 1.980 ? ? ? ? ? ? 694 99.900 ? ? ? ? 0.503 ? ? ? ? ? ? ? ? 11.600 ? 1.378 ? ? 0.527 0.154 ? 4 1 0.941 ? ? ? ? ? ? ? ? ? ? 1.980 2.030 ? ? ? ? ? ? 704 99.400 ? ? ? ? 0.416 ? ? ? ? ? ? ? ? 11.000 ? 1.498 ? ? 0.436 0.130 ? 5 1 0.958 ? ? ? ? ? ? ? ? ? ? 2.030 2.070 ? ? ? ? ? ? 690 97.900 ? ? ? ? 0.415 ? ? ? ? ? ? ? ? 11.200 ? 1.794 ? ? 0.435 0.130 ? 6 1 0.963 ? ? ? ? ? ? ? ? ? ? 2.070 2.120 ? ? ? ? ? ? 688 100.000 ? ? ? ? 0.334 ? ? ? ? ? ? ? ? 10.700 ? 1.717 ? ? 0.352 0.107 ? 7 1 0.974 ? ? ? ? ? ? ? ? ? ? 2.120 2.180 ? ? ? ? ? ? 684 96.200 ? ? ? ? 0.298 ? ? ? ? ? ? ? ? 9.900 ? 1.872 ? ? 0.315 0.098 ? 8 1 0.966 ? ? ? ? ? ? ? ? ? ? 2.180 2.250 ? ? ? ? ? ? 704 99.900 ? ? ? ? 0.323 ? ? ? ? ? ? ? ? 10.800 ? 2.036 ? ? 0.339 0.102 ? 9 1 0.968 ? ? ? ? ? ? ? ? ? ? 2.250 2.320 ? ? ? ? ? ? 699 98.700 ? ? ? ? 0.286 ? ? ? ? ? ? ? ? 10.800 ? 1.969 ? ? 0.300 0.091 ? 10 1 0.977 ? ? ? ? ? ? ? ? ? ? 2.320 2.400 ? ? ? ? ? ? 696 99.600 ? ? ? ? 0.244 ? ? ? ? ? ? ? ? 11.000 ? 1.854 ? ? 0.257 0.078 ? 11 1 0.979 ? ? ? ? ? ? ? ? ? ? 2.400 2.500 ? ? ? ? ? ? 703 99.200 ? ? ? ? 0.218 ? ? ? ? ? ? ? ? 10.600 ? 1.802 ? ? 0.230 0.071 ? 12 1 0.981 ? ? ? ? ? ? ? ? ? ? 2.500 2.610 ? ? ? ? ? ? 718 99.400 ? ? ? ? 0.187 ? ? ? ? ? ? ? ? 10.200 ? 1.572 ? ? 0.197 0.062 ? 13 1 0.988 ? ? ? ? ? ? ? ? ? ? 2.610 2.750 ? ? ? ? ? ? 715 99.900 ? ? ? ? 0.175 ? ? ? ? ? ? ? ? 9.500 ? 1.601 ? ? 0.186 0.061 ? 14 1 0.984 ? ? ? ? ? ? ? ? ? ? 2.750 2.920 ? ? ? ? ? ? 690 96.200 ? ? ? ? 0.141 ? ? ? ? ? ? ? ? 9.100 ? 1.475 ? ? 0.149 0.049 ? 15 1 0.987 ? ? ? ? ? ? ? ? ? ? 2.920 3.150 ? ? ? ? ? ? 724 99.500 ? ? ? ? 0.127 ? ? ? ? ? ? ? ? 9.500 ? 1.475 ? ? 0.135 0.045 ? 16 1 0.990 ? ? ? ? ? ? ? ? ? ? 3.150 3.460 ? ? ? ? ? ? 727 99.700 ? ? ? ? 0.104 ? ? ? ? ? ? ? ? 8.800 ? 1.284 ? ? 0.112 0.039 ? 17 1 0.993 ? ? ? ? ? ? ? ? ? ? 3.460 3.960 ? ? ? ? ? ? 727 99.600 ? ? ? ? 0.091 ? ? ? ? ? ? ? ? 7.700 ? 1.171 ? ? 0.099 0.036 ? 18 1 0.994 ? ? ? ? ? ? ? ? ? ? 3.960 4.990 ? ? ? ? ? ? 741 98.100 ? ? ? ? 0.082 ? ? ? ? ? ? ? ? 7.000 ? 1.304 ? ? 0.089 0.034 ? 19 1 0.991 ? ? ? ? ? ? ? ? ? ? 4.990 50.000 ? ? ? ? ? ? 803 98.000 ? ? ? ? 0.081 ? ? ? ? ? ? ? ? 6.400 ? 1.539 ? ? 0.088 0.035 ? 20 1 0.992 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 139.990 _refine.B_iso_mean 33.6941 _refine.B_iso_min 13.470 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7E7C _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.8400 _refine.ls_d_res_low 34.3500 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 14106 _refine.ls_number_reflns_R_free 1411 _refine.ls_number_reflns_R_work 12695 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.2400 _refine.ls_percent_reflns_R_free 10.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2189 _refine.ls_R_factor_R_free 0.2513 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2153 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5j9s _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.2800 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2200 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.8400 _refine_hist.d_res_low 34.3500 _refine_hist.number_atoms_solvent 53 _refine_hist.number_atoms_total 1325 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 152 _refine_hist.pdbx_B_iso_mean_ligand 59.69 _refine_hist.pdbx_B_iso_mean_solvent 37.06 _refine_hist.pdbx_number_atoms_protein 1262 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 10 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.8400 1.9000 1296 . 130 1166 93.0000 . . . 0.3092 0.0000 0.2540 . . . . . . . 10 . . . 'X-RAY DIFFRACTION' 1.9000 1.9800 1366 . 136 1230 98.0000 . . . 0.2769 0.0000 0.2201 . . . . . . . 10 . . . 'X-RAY DIFFRACTION' 1.9800 2.0700 1405 . 141 1264 99.0000 . . . 0.2515 0.0000 0.2176 . . . . . . . 10 . . . 'X-RAY DIFFRACTION' 2.0700 2.1800 1376 . 138 1238 98.0000 . . . 0.2734 0.0000 0.2114 . . . . . . . 10 . . . 'X-RAY DIFFRACTION' 2.1800 2.3100 1409 . 141 1268 99.0000 . . . 0.2777 0.0000 0.2230 . . . . . . . 10 . . . 'X-RAY DIFFRACTION' 2.3100 2.4900 1416 . 142 1274 99.0000 . . . 0.3012 0.0000 0.2239 . . . . . . . 10 . . . 'X-RAY DIFFRACTION' 2.4900 2.7400 1433 . 142 1291 100.0000 . . . 0.2785 0.0000 0.2427 . . . . . . . 10 . . . 'X-RAY DIFFRACTION' 2.7400 3.1400 1418 . 143 1275 98.0000 . . . 0.2897 0.0000 0.2309 . . . . . . . 10 . . . 'X-RAY DIFFRACTION' 3.1400 3.9500 1453 . 145 1308 100.0000 . . . 0.2566 0.0000 0.1883 . . . . . . . 10 . . . 'X-RAY DIFFRACTION' 3.9600 34.3500 1534 . 153 1381 98.0000 . . . 0.1987 0.0000 0.2143 . . . . . . . 10 . . . # _struct.entry_id 7E7C _struct.title 'Crystal structure of ENL YEATS domain T1 mutant in complex with histone H3 acetylation at K27' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7E7C _struct_keywords.text 'YEATS domain, Complex, histone, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 4 ? G N N 5 ? H N N 5 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP ENL_HUMAN Q03111 ? 1 ;MDNQCTVQVRLELGHRAQLRKKPTTEGFTHDWMVFVRGPEQCDIQHFVEKVVFWLHDSFPKPRRVCKEPPYKVEESGYAG FIMPIEVHFKNKEEPRKVCFTYDLFLNLEGNPPVNHLRCEKLTFNNPTTEFRYKLLRAGGVMVMPEGA ; 1 2 PDB 7E7C 7E7C ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7E7C A 4 ? 154 ? Q03111 1 ? 148 ? 1 151 2 2 7E7C B 1 ? 4 ? 7E7C 24 ? 27 ? 24 27 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7E7C GLY A 1 ? UNP Q03111 ? ? 'expression tag' -2 1 1 7E7C SER A 2 ? UNP Q03111 ? ? 'expression tag' -1 2 1 7E7C HIS A 3 ? UNP Q03111 ? ? 'expression tag' 0 3 1 7E7C ASN A 118 ? UNP Q03111 ? ? insertion 115 4 1 7E7C HIS A 119 ? UNP Q03111 ? ? insertion 116 5 1 7E7C LEU A 120 ? UNP Q03111 ? ? insertion 117 6 1 7E7C HIS A 155 ? UNP Q03111 ? ? 'expression tag' 152 7 1 7E7C HIS A 156 ? UNP Q03111 ? ? 'expression tag' 153 8 1 7E7C HIS A 157 ? UNP Q03111 ? ? 'expression tag' 154 9 1 7E7C HIS A 158 ? UNP Q03111 ? ? 'expression tag' 155 10 1 7E7C HIS A 159 ? UNP Q03111 ? ? 'expression tag' 156 11 1 7E7C HIS A 160 ? UNP Q03111 ? ? 'expression tag' 157 12 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1280 ? 1 MORE 1 ? 1 'SSA (A^2)' 9520 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 46 ? HIS A 49 ? ASP A 43 HIS A 46 5 ? 4 HELX_P HELX_P2 AA2 THR A 134 ? ALA A 144 ? THR A 131 ALA A 141 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag both _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id B _struct_conn.ptnr1_label_comp_id ARG _struct_conn.ptnr1_label_seq_id 3 _struct_conn.ptnr1_label_atom_id C _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id ALY _struct_conn.ptnr2_label_seq_id 4 _struct_conn.ptnr2_label_atom_id N _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id B _struct_conn.ptnr1_auth_comp_id ARG _struct_conn.ptnr1_auth_seq_id 26 _struct_conn.ptnr2_auth_asym_id B _struct_conn.ptnr2_auth_comp_id ALY _struct_conn.ptnr2_auth_seq_id 27 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.321 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id ALY _pdbx_modification_feature.label_asym_id B _pdbx_modification_feature.label_seq_id 4 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id . _pdbx_modification_feature.modified_residue_label_asym_id . _pdbx_modification_feature.modified_residue_label_seq_id . _pdbx_modification_feature.modified_residue_label_alt_id . _pdbx_modification_feature.auth_comp_id ALY _pdbx_modification_feature.auth_asym_id B _pdbx_modification_feature.auth_seq_id 27 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id . _pdbx_modification_feature.modified_residue_auth_asym_id . _pdbx_modification_feature.modified_residue_auth_seq_id . _pdbx_modification_feature.modified_residue_PDB_ins_code . _pdbx_modification_feature.modified_residue_symmetry . _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id LYS _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id ALY _pdbx_modification_feature.type Acetylation _pdbx_modification_feature.category 'Named protein modification' # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 PRO 72 A . ? PRO 69 A PRO 73 A ? PRO 70 A 1 2.97 2 GLU 97 A . ? GLU 94 A PRO 98 A ? PRO 95 A 1 -5.07 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 4 ? AA3 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 74 ? GLY A 80 ? TYR A 71 GLY A 77 AA1 2 HIS A 33 ? ARG A 40 ? HIS A 30 ARG A 37 AA1 3 THR A 9 ? LEU A 22 ? THR A 6 LEU A 19 AA1 4 HIS A 119 ? ASN A 131 ? HIS A 116 ASN A 128 AA2 1 TYR A 74 ? GLY A 80 ? TYR A 71 GLY A 77 AA2 2 HIS A 33 ? ARG A 40 ? HIS A 30 ARG A 37 AA2 3 THR A 9 ? LEU A 22 ? THR A 6 LEU A 19 AA2 4 VAL A 147 ? MET A 148 ? VAL A 144 MET A 145 AA3 1 ARG A 66 ? CYS A 69 ? ARG A 63 CYS A 66 AA3 2 VAL A 51 ? TRP A 57 ? VAL A 48 TRP A 54 AA3 3 PHE A 84 ? PHE A 92 ? PHE A 81 PHE A 89 AA3 4 LYS A 100 ? LEU A 107 ? LYS A 97 LEU A 104 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLU A 78 ? O GLU A 75 N TRP A 35 ? N TRP A 32 AA1 2 3 O PHE A 38 ? O PHE A 35 N GLY A 17 ? N GLY A 14 AA1 3 4 N VAL A 12 ? N VAL A 9 O LEU A 128 ? O LEU A 125 AA2 1 2 O GLU A 78 ? O GLU A 75 N TRP A 35 ? N TRP A 32 AA2 2 3 O PHE A 38 ? O PHE A 35 N GLY A 17 ? N GLY A 14 AA2 3 4 N GLN A 11 ? N GLN A 8 O VAL A 147 ? O VAL A 144 AA3 1 2 O ARG A 67 ? O ARG A 64 N PHE A 56 ? N PHE A 53 AA3 2 3 N TRP A 57 ? N TRP A 54 O PRO A 87 ? O PRO A 84 AA3 3 4 N MET A 86 ? N MET A 83 O TYR A 105 ? O TYR A 102 # _pdbx_entry_details.entry_id 7E7C _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 N _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 PRO _pdbx_validate_rmsd_bond.auth_seq_id_1 60 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 CA _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 PRO _pdbx_validate_rmsd_bond.auth_seq_id_2 60 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.696 _pdbx_validate_rmsd_bond.bond_target_value 1.468 _pdbx_validate_rmsd_bond.bond_deviation 0.228 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.017 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 C A PHE 59 ? ? N A PRO 60 ? ? CA A PRO 60 ? ? 138.04 119.30 18.74 1.50 Y 2 1 CA A PRO 60 ? ? N A PRO 60 ? ? CD A PRO 60 ? ? 101.08 111.70 -10.62 1.40 N # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 350 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id G _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -2 ? A GLY 1 2 1 Y 1 A SER -1 ? A SER 2 3 1 Y 1 A HIS 0 ? A HIS 3 4 1 Y 1 A GLU 149 ? A GLU 152 5 1 Y 1 A GLY 150 ? A GLY 153 6 1 Y 1 A ALA 151 ? A ALA 154 7 1 Y 1 A HIS 152 ? A HIS 155 8 1 Y 1 A HIS 153 ? A HIS 156 9 1 Y 1 A HIS 154 ? A HIS 157 10 1 Y 1 A HIS 155 ? A HIS 158 11 1 Y 1 A HIS 156 ? A HIS 159 12 1 Y 1 A HIS 157 ? A HIS 160 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ALY OH O N N 14 ALY CH C N N 15 ALY CH3 C N N 16 ALY NZ N N N 17 ALY CE C N N 18 ALY CD C N N 19 ALY CG C N N 20 ALY CB C N N 21 ALY CA C N S 22 ALY N N N N 23 ALY C C N N 24 ALY O O N N 25 ALY OXT O N N 26 ALY HH31 H N N 27 ALY HH32 H N N 28 ALY HH33 H N N 29 ALY HZ H N N 30 ALY HE3 H N N 31 ALY HE2 H N N 32 ALY HD3 H N N 33 ALY HD2 H N N 34 ALY HG3 H N N 35 ALY HG2 H N N 36 ALY HB3 H N N 37 ALY HB2 H N N 38 ALY HA H N N 39 ALY H H N N 40 ALY H2 H N N 41 ALY HXT H N N 42 ARG N N N N 43 ARG CA C N S 44 ARG C C N N 45 ARG O O N N 46 ARG CB C N N 47 ARG CG C N N 48 ARG CD C N N 49 ARG NE N N N 50 ARG CZ C N N 51 ARG NH1 N N N 52 ARG NH2 N N N 53 ARG OXT O N N 54 ARG H H N N 55 ARG H2 H N N 56 ARG HA H N N 57 ARG HB2 H N N 58 ARG HB3 H N N 59 ARG HG2 H N N 60 ARG HG3 H N N 61 ARG HD2 H N N 62 ARG HD3 H N N 63 ARG HE H N N 64 ARG HH11 H N N 65 ARG HH12 H N N 66 ARG HH21 H N N 67 ARG HH22 H N N 68 ARG HXT H N N 69 ASN N N N N 70 ASN CA C N S 71 ASN C C N N 72 ASN O O N N 73 ASN CB C N N 74 ASN CG C N N 75 ASN OD1 O N N 76 ASN ND2 N N N 77 ASN OXT O N N 78 ASN H H N N 79 ASN H2 H N N 80 ASN HA H N N 81 ASN HB2 H N N 82 ASN HB3 H N N 83 ASN HD21 H N N 84 ASN HD22 H N N 85 ASN HXT H N N 86 ASP N N N N 87 ASP CA C N S 88 ASP C C N N 89 ASP O O N N 90 ASP CB C N N 91 ASP CG C N N 92 ASP OD1 O N N 93 ASP OD2 O N N 94 ASP OXT O N N 95 ASP H H N N 96 ASP H2 H N N 97 ASP HA H N N 98 ASP HB2 H N N 99 ASP HB3 H N N 100 ASP HD2 H N N 101 ASP HXT H N N 102 CYS N N N N 103 CYS CA C N R 104 CYS C C N N 105 CYS O O N N 106 CYS CB C N N 107 CYS SG S N N 108 CYS OXT O N N 109 CYS H H N N 110 CYS H2 H N N 111 CYS HA H N N 112 CYS HB2 H N N 113 CYS HB3 H N N 114 CYS HG H N N 115 CYS HXT H N N 116 EDO C1 C N N 117 EDO O1 O N N 118 EDO C2 C N N 119 EDO O2 O N N 120 EDO H11 H N N 121 EDO H12 H N N 122 EDO HO1 H N N 123 EDO H21 H N N 124 EDO H22 H N N 125 EDO HO2 H N N 126 GLN N N N N 127 GLN CA C N S 128 GLN C C N N 129 GLN O O N N 130 GLN CB C N N 131 GLN CG C N N 132 GLN CD C N N 133 GLN OE1 O N N 134 GLN NE2 N N N 135 GLN OXT O N N 136 GLN H H N N 137 GLN H2 H N N 138 GLN HA H N N 139 GLN HB2 H N N 140 GLN HB3 H N N 141 GLN HG2 H N N 142 GLN HG3 H N N 143 GLN HE21 H N N 144 GLN HE22 H N N 145 GLN HXT H N N 146 GLU N N N N 147 GLU CA C N S 148 GLU C C N N 149 GLU O O N N 150 GLU CB C N N 151 GLU CG C N N 152 GLU CD C N N 153 GLU OE1 O N N 154 GLU OE2 O N N 155 GLU OXT O N N 156 GLU H H N N 157 GLU H2 H N N 158 GLU HA H N N 159 GLU HB2 H N N 160 GLU HB3 H N N 161 GLU HG2 H N N 162 GLU HG3 H N N 163 GLU HE2 H N N 164 GLU HXT H N N 165 GLY N N N N 166 GLY CA C N N 167 GLY C C N N 168 GLY O O N N 169 GLY OXT O N N 170 GLY H H N N 171 GLY H2 H N N 172 GLY HA2 H N N 173 GLY HA3 H N N 174 GLY HXT H N N 175 HIS N N N N 176 HIS CA C N S 177 HIS C C N N 178 HIS O O N N 179 HIS CB C N N 180 HIS CG C Y N 181 HIS ND1 N Y N 182 HIS CD2 C Y N 183 HIS CE1 C Y N 184 HIS NE2 N Y N 185 HIS OXT O N N 186 HIS H H N N 187 HIS H2 H N N 188 HIS HA H N N 189 HIS HB2 H N N 190 HIS HB3 H N N 191 HIS HD1 H N N 192 HIS HD2 H N N 193 HIS HE1 H N N 194 HIS HE2 H N N 195 HIS HXT H N N 196 HOH O O N N 197 HOH H1 H N N 198 HOH H2 H N N 199 ILE N N N N 200 ILE CA C N S 201 ILE C C N N 202 ILE O O N N 203 ILE CB C N S 204 ILE CG1 C N N 205 ILE CG2 C N N 206 ILE CD1 C N N 207 ILE OXT O N N 208 ILE H H N N 209 ILE H2 H N N 210 ILE HA H N N 211 ILE HB H N N 212 ILE HG12 H N N 213 ILE HG13 H N N 214 ILE HG21 H N N 215 ILE HG22 H N N 216 ILE HG23 H N N 217 ILE HD11 H N N 218 ILE HD12 H N N 219 ILE HD13 H N N 220 ILE HXT H N N 221 IOD I I N N 222 LEU N N N N 223 LEU CA C N S 224 LEU C C N N 225 LEU O O N N 226 LEU CB C N N 227 LEU CG C N N 228 LEU CD1 C N N 229 LEU CD2 C N N 230 LEU OXT O N N 231 LEU H H N N 232 LEU H2 H N N 233 LEU HA H N N 234 LEU HB2 H N N 235 LEU HB3 H N N 236 LEU HG H N N 237 LEU HD11 H N N 238 LEU HD12 H N N 239 LEU HD13 H N N 240 LEU HD21 H N N 241 LEU HD22 H N N 242 LEU HD23 H N N 243 LEU HXT H N N 244 LYS N N N N 245 LYS CA C N S 246 LYS C C N N 247 LYS O O N N 248 LYS CB C N N 249 LYS CG C N N 250 LYS CD C N N 251 LYS CE C N N 252 LYS NZ N N N 253 LYS OXT O N N 254 LYS H H N N 255 LYS H2 H N N 256 LYS HA H N N 257 LYS HB2 H N N 258 LYS HB3 H N N 259 LYS HG2 H N N 260 LYS HG3 H N N 261 LYS HD2 H N N 262 LYS HD3 H N N 263 LYS HE2 H N N 264 LYS HE3 H N N 265 LYS HZ1 H N N 266 LYS HZ2 H N N 267 LYS HZ3 H N N 268 LYS HXT H N N 269 MET N N N N 270 MET CA C N S 271 MET C C N N 272 MET O O N N 273 MET CB C N N 274 MET CG C N N 275 MET SD S N N 276 MET CE C N N 277 MET OXT O N N 278 MET H H N N 279 MET H2 H N N 280 MET HA H N N 281 MET HB2 H N N 282 MET HB3 H N N 283 MET HG2 H N N 284 MET HG3 H N N 285 MET HE1 H N N 286 MET HE2 H N N 287 MET HE3 H N N 288 MET HXT H N N 289 PHE N N N N 290 PHE CA C N S 291 PHE C C N N 292 PHE O O N N 293 PHE CB C N N 294 PHE CG C Y N 295 PHE CD1 C Y N 296 PHE CD2 C Y N 297 PHE CE1 C Y N 298 PHE CE2 C Y N 299 PHE CZ C Y N 300 PHE OXT O N N 301 PHE H H N N 302 PHE H2 H N N 303 PHE HA H N N 304 PHE HB2 H N N 305 PHE HB3 H N N 306 PHE HD1 H N N 307 PHE HD2 H N N 308 PHE HE1 H N N 309 PHE HE2 H N N 310 PHE HZ H N N 311 PHE HXT H N N 312 PRO N N N N 313 PRO CA C N S 314 PRO C C N N 315 PRO O O N N 316 PRO CB C N N 317 PRO CG C N N 318 PRO CD C N N 319 PRO OXT O N N 320 PRO H H N N 321 PRO HA H N N 322 PRO HB2 H N N 323 PRO HB3 H N N 324 PRO HG2 H N N 325 PRO HG3 H N N 326 PRO HD2 H N N 327 PRO HD3 H N N 328 PRO HXT H N N 329 SER N N N N 330 SER CA C N S 331 SER C C N N 332 SER O O N N 333 SER CB C N N 334 SER OG O N N 335 SER OXT O N N 336 SER H H N N 337 SER H2 H N N 338 SER HA H N N 339 SER HB2 H N N 340 SER HB3 H N N 341 SER HG H N N 342 SER HXT H N N 343 THR N N N N 344 THR CA C N S 345 THR C C N N 346 THR O O N N 347 THR CB C N R 348 THR OG1 O N N 349 THR CG2 C N N 350 THR OXT O N N 351 THR H H N N 352 THR H2 H N N 353 THR HA H N N 354 THR HB H N N 355 THR HG1 H N N 356 THR HG21 H N N 357 THR HG22 H N N 358 THR HG23 H N N 359 THR HXT H N N 360 TRP N N N N 361 TRP CA C N S 362 TRP C C N N 363 TRP O O N N 364 TRP CB C N N 365 TRP CG C Y N 366 TRP CD1 C Y N 367 TRP CD2 C Y N 368 TRP NE1 N Y N 369 TRP CE2 C Y N 370 TRP CE3 C Y N 371 TRP CZ2 C Y N 372 TRP CZ3 C Y N 373 TRP CH2 C Y N 374 TRP OXT O N N 375 TRP H H N N 376 TRP H2 H N N 377 TRP HA H N N 378 TRP HB2 H N N 379 TRP HB3 H N N 380 TRP HD1 H N N 381 TRP HE1 H N N 382 TRP HE3 H N N 383 TRP HZ2 H N N 384 TRP HZ3 H N N 385 TRP HH2 H N N 386 TRP HXT H N N 387 TYR N N N N 388 TYR CA C N S 389 TYR C C N N 390 TYR O O N N 391 TYR CB C N N 392 TYR CG C Y N 393 TYR CD1 C Y N 394 TYR CD2 C Y N 395 TYR CE1 C Y N 396 TYR CE2 C Y N 397 TYR CZ C Y N 398 TYR OH O N N 399 TYR OXT O N N 400 TYR H H N N 401 TYR H2 H N N 402 TYR HA H N N 403 TYR HB2 H N N 404 TYR HB3 H N N 405 TYR HD1 H N N 406 TYR HD2 H N N 407 TYR HE1 H N N 408 TYR HE2 H N N 409 TYR HH H N N 410 TYR HXT H N N 411 VAL N N N N 412 VAL CA C N S 413 VAL C C N N 414 VAL O O N N 415 VAL CB C N N 416 VAL CG1 C N N 417 VAL CG2 C N N 418 VAL OXT O N N 419 VAL H H N N 420 VAL H2 H N N 421 VAL HA H N N 422 VAL HB H N N 423 VAL HG11 H N N 424 VAL HG12 H N N 425 VAL HG13 H N N 426 VAL HG21 H N N 427 VAL HG22 H N N 428 VAL HG23 H N N 429 VAL HXT H N N 430 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ALY OH CH doub N N 13 ALY CH CH3 sing N N 14 ALY CH NZ sing N N 15 ALY CH3 HH31 sing N N 16 ALY CH3 HH32 sing N N 17 ALY CH3 HH33 sing N N 18 ALY NZ CE sing N N 19 ALY NZ HZ sing N N 20 ALY CE CD sing N N 21 ALY CE HE3 sing N N 22 ALY CE HE2 sing N N 23 ALY CD CG sing N N 24 ALY CD HD3 sing N N 25 ALY CD HD2 sing N N 26 ALY CG CB sing N N 27 ALY CG HG3 sing N N 28 ALY CG HG2 sing N N 29 ALY CB CA sing N N 30 ALY CB HB3 sing N N 31 ALY CB HB2 sing N N 32 ALY CA N sing N N 33 ALY CA C sing N N 34 ALY CA HA sing N N 35 ALY N H sing N N 36 ALY N H2 sing N N 37 ALY C O doub N N 38 ALY C OXT sing N N 39 ALY OXT HXT sing N N 40 ARG N CA sing N N 41 ARG N H sing N N 42 ARG N H2 sing N N 43 ARG CA C sing N N 44 ARG CA CB sing N N 45 ARG CA HA sing N N 46 ARG C O doub N N 47 ARG C OXT sing N N 48 ARG CB CG sing N N 49 ARG CB HB2 sing N N 50 ARG CB HB3 sing N N 51 ARG CG CD sing N N 52 ARG CG HG2 sing N N 53 ARG CG HG3 sing N N 54 ARG CD NE sing N N 55 ARG CD HD2 sing N N 56 ARG CD HD3 sing N N 57 ARG NE CZ sing N N 58 ARG NE HE sing N N 59 ARG CZ NH1 sing N N 60 ARG CZ NH2 doub N N 61 ARG NH1 HH11 sing N N 62 ARG NH1 HH12 sing N N 63 ARG NH2 HH21 sing N N 64 ARG NH2 HH22 sing N N 65 ARG OXT HXT sing N N 66 ASN N CA sing N N 67 ASN N H sing N N 68 ASN N H2 sing N N 69 ASN CA C sing N N 70 ASN CA CB sing N N 71 ASN CA HA sing N N 72 ASN C O doub N N 73 ASN C OXT sing N N 74 ASN CB CG sing N N 75 ASN CB HB2 sing N N 76 ASN CB HB3 sing N N 77 ASN CG OD1 doub N N 78 ASN CG ND2 sing N N 79 ASN ND2 HD21 sing N N 80 ASN ND2 HD22 sing N N 81 ASN OXT HXT sing N N 82 ASP N CA sing N N 83 ASP N H sing N N 84 ASP N H2 sing N N 85 ASP CA C sing N N 86 ASP CA CB sing N N 87 ASP CA HA sing N N 88 ASP C O doub N N 89 ASP C OXT sing N N 90 ASP CB CG sing N N 91 ASP CB HB2 sing N N 92 ASP CB HB3 sing N N 93 ASP CG OD1 doub N N 94 ASP CG OD2 sing N N 95 ASP OD2 HD2 sing N N 96 ASP OXT HXT sing N N 97 CYS N CA sing N N 98 CYS N H sing N N 99 CYS N H2 sing N N 100 CYS CA C sing N N 101 CYS CA CB sing N N 102 CYS CA HA sing N N 103 CYS C O doub N N 104 CYS C OXT sing N N 105 CYS CB SG sing N N 106 CYS CB HB2 sing N N 107 CYS CB HB3 sing N N 108 CYS SG HG sing N N 109 CYS OXT HXT sing N N 110 EDO C1 O1 sing N N 111 EDO C1 C2 sing N N 112 EDO C1 H11 sing N N 113 EDO C1 H12 sing N N 114 EDO O1 HO1 sing N N 115 EDO C2 O2 sing N N 116 EDO C2 H21 sing N N 117 EDO C2 H22 sing N N 118 EDO O2 HO2 sing N N 119 GLN N CA sing N N 120 GLN N H sing N N 121 GLN N H2 sing N N 122 GLN CA C sing N N 123 GLN CA CB sing N N 124 GLN CA HA sing N N 125 GLN C O doub N N 126 GLN C OXT sing N N 127 GLN CB CG sing N N 128 GLN CB HB2 sing N N 129 GLN CB HB3 sing N N 130 GLN CG CD sing N N 131 GLN CG HG2 sing N N 132 GLN CG HG3 sing N N 133 GLN CD OE1 doub N N 134 GLN CD NE2 sing N N 135 GLN NE2 HE21 sing N N 136 GLN NE2 HE22 sing N N 137 GLN OXT HXT sing N N 138 GLU N CA sing N N 139 GLU N H sing N N 140 GLU N H2 sing N N 141 GLU CA C sing N N 142 GLU CA CB sing N N 143 GLU CA HA sing N N 144 GLU C O doub N N 145 GLU C OXT sing N N 146 GLU CB CG sing N N 147 GLU CB HB2 sing N N 148 GLU CB HB3 sing N N 149 GLU CG CD sing N N 150 GLU CG HG2 sing N N 151 GLU CG HG3 sing N N 152 GLU CD OE1 doub N N 153 GLU CD OE2 sing N N 154 GLU OE2 HE2 sing N N 155 GLU OXT HXT sing N N 156 GLY N CA sing N N 157 GLY N H sing N N 158 GLY N H2 sing N N 159 GLY CA C sing N N 160 GLY CA HA2 sing N N 161 GLY CA HA3 sing N N 162 GLY C O doub N N 163 GLY C OXT sing N N 164 GLY OXT HXT sing N N 165 HIS N CA sing N N 166 HIS N H sing N N 167 HIS N H2 sing N N 168 HIS CA C sing N N 169 HIS CA CB sing N N 170 HIS CA HA sing N N 171 HIS C O doub N N 172 HIS C OXT sing N N 173 HIS CB CG sing N N 174 HIS CB HB2 sing N N 175 HIS CB HB3 sing N N 176 HIS CG ND1 sing Y N 177 HIS CG CD2 doub Y N 178 HIS ND1 CE1 doub Y N 179 HIS ND1 HD1 sing N N 180 HIS CD2 NE2 sing Y N 181 HIS CD2 HD2 sing N N 182 HIS CE1 NE2 sing Y N 183 HIS CE1 HE1 sing N N 184 HIS NE2 HE2 sing N N 185 HIS OXT HXT sing N N 186 HOH O H1 sing N N 187 HOH O H2 sing N N 188 ILE N CA sing N N 189 ILE N H sing N N 190 ILE N H2 sing N N 191 ILE CA C sing N N 192 ILE CA CB sing N N 193 ILE CA HA sing N N 194 ILE C O doub N N 195 ILE C OXT sing N N 196 ILE CB CG1 sing N N 197 ILE CB CG2 sing N N 198 ILE CB HB sing N N 199 ILE CG1 CD1 sing N N 200 ILE CG1 HG12 sing N N 201 ILE CG1 HG13 sing N N 202 ILE CG2 HG21 sing N N 203 ILE CG2 HG22 sing N N 204 ILE CG2 HG23 sing N N 205 ILE CD1 HD11 sing N N 206 ILE CD1 HD12 sing N N 207 ILE CD1 HD13 sing N N 208 ILE OXT HXT sing N N 209 LEU N CA sing N N 210 LEU N H sing N N 211 LEU N H2 sing N N 212 LEU CA C sing N N 213 LEU CA CB sing N N 214 LEU CA HA sing N N 215 LEU C O doub N N 216 LEU C OXT sing N N 217 LEU CB CG sing N N 218 LEU CB HB2 sing N N 219 LEU CB HB3 sing N N 220 LEU CG CD1 sing N N 221 LEU CG CD2 sing N N 222 LEU CG HG sing N N 223 LEU CD1 HD11 sing N N 224 LEU CD1 HD12 sing N N 225 LEU CD1 HD13 sing N N 226 LEU CD2 HD21 sing N N 227 LEU CD2 HD22 sing N N 228 LEU CD2 HD23 sing N N 229 LEU OXT HXT sing N N 230 LYS N CA sing N N 231 LYS N H sing N N 232 LYS N H2 sing N N 233 LYS CA C sing N N 234 LYS CA CB sing N N 235 LYS CA HA sing N N 236 LYS C O doub N N 237 LYS C OXT sing N N 238 LYS CB CG sing N N 239 LYS CB HB2 sing N N 240 LYS CB HB3 sing N N 241 LYS CG CD sing N N 242 LYS CG HG2 sing N N 243 LYS CG HG3 sing N N 244 LYS CD CE sing N N 245 LYS CD HD2 sing N N 246 LYS CD HD3 sing N N 247 LYS CE NZ sing N N 248 LYS CE HE2 sing N N 249 LYS CE HE3 sing N N 250 LYS NZ HZ1 sing N N 251 LYS NZ HZ2 sing N N 252 LYS NZ HZ3 sing N N 253 LYS OXT HXT sing N N 254 MET N CA sing N N 255 MET N H sing N N 256 MET N H2 sing N N 257 MET CA C sing N N 258 MET CA CB sing N N 259 MET CA HA sing N N 260 MET C O doub N N 261 MET C OXT sing N N 262 MET CB CG sing N N 263 MET CB HB2 sing N N 264 MET CB HB3 sing N N 265 MET CG SD sing N N 266 MET CG HG2 sing N N 267 MET CG HG3 sing N N 268 MET SD CE sing N N 269 MET CE HE1 sing N N 270 MET CE HE2 sing N N 271 MET CE HE3 sing N N 272 MET OXT HXT sing N N 273 PHE N CA sing N N 274 PHE N H sing N N 275 PHE N H2 sing N N 276 PHE CA C sing N N 277 PHE CA CB sing N N 278 PHE CA HA sing N N 279 PHE C O doub N N 280 PHE C OXT sing N N 281 PHE CB CG sing N N 282 PHE CB HB2 sing N N 283 PHE CB HB3 sing N N 284 PHE CG CD1 doub Y N 285 PHE CG CD2 sing Y N 286 PHE CD1 CE1 sing Y N 287 PHE CD1 HD1 sing N N 288 PHE CD2 CE2 doub Y N 289 PHE CD2 HD2 sing N N 290 PHE CE1 CZ doub Y N 291 PHE CE1 HE1 sing N N 292 PHE CE2 CZ sing Y N 293 PHE CE2 HE2 sing N N 294 PHE CZ HZ sing N N 295 PHE OXT HXT sing N N 296 PRO N CA sing N N 297 PRO N CD sing N N 298 PRO N H sing N N 299 PRO CA C sing N N 300 PRO CA CB sing N N 301 PRO CA HA sing N N 302 PRO C O doub N N 303 PRO C OXT sing N N 304 PRO CB CG sing N N 305 PRO CB HB2 sing N N 306 PRO CB HB3 sing N N 307 PRO CG CD sing N N 308 PRO CG HG2 sing N N 309 PRO CG HG3 sing N N 310 PRO CD HD2 sing N N 311 PRO CD HD3 sing N N 312 PRO OXT HXT sing N N 313 SER N CA sing N N 314 SER N H sing N N 315 SER N H2 sing N N 316 SER CA C sing N N 317 SER CA CB sing N N 318 SER CA HA sing N N 319 SER C O doub N N 320 SER C OXT sing N N 321 SER CB OG sing N N 322 SER CB HB2 sing N N 323 SER CB HB3 sing N N 324 SER OG HG sing N N 325 SER OXT HXT sing N N 326 THR N CA sing N N 327 THR N H sing N N 328 THR N H2 sing N N 329 THR CA C sing N N 330 THR CA CB sing N N 331 THR CA HA sing N N 332 THR C O doub N N 333 THR C OXT sing N N 334 THR CB OG1 sing N N 335 THR CB CG2 sing N N 336 THR CB HB sing N N 337 THR OG1 HG1 sing N N 338 THR CG2 HG21 sing N N 339 THR CG2 HG22 sing N N 340 THR CG2 HG23 sing N N 341 THR OXT HXT sing N N 342 TRP N CA sing N N 343 TRP N H sing N N 344 TRP N H2 sing N N 345 TRP CA C sing N N 346 TRP CA CB sing N N 347 TRP CA HA sing N N 348 TRP C O doub N N 349 TRP C OXT sing N N 350 TRP CB CG sing N N 351 TRP CB HB2 sing N N 352 TRP CB HB3 sing N N 353 TRP CG CD1 doub Y N 354 TRP CG CD2 sing Y N 355 TRP CD1 NE1 sing Y N 356 TRP CD1 HD1 sing N N 357 TRP CD2 CE2 doub Y N 358 TRP CD2 CE3 sing Y N 359 TRP NE1 CE2 sing Y N 360 TRP NE1 HE1 sing N N 361 TRP CE2 CZ2 sing Y N 362 TRP CE3 CZ3 doub Y N 363 TRP CE3 HE3 sing N N 364 TRP CZ2 CH2 doub Y N 365 TRP CZ2 HZ2 sing N N 366 TRP CZ3 CH2 sing Y N 367 TRP CZ3 HZ3 sing N N 368 TRP CH2 HH2 sing N N 369 TRP OXT HXT sing N N 370 TYR N CA sing N N 371 TYR N H sing N N 372 TYR N H2 sing N N 373 TYR CA C sing N N 374 TYR CA CB sing N N 375 TYR CA HA sing N N 376 TYR C O doub N N 377 TYR C OXT sing N N 378 TYR CB CG sing N N 379 TYR CB HB2 sing N N 380 TYR CB HB3 sing N N 381 TYR CG CD1 doub Y N 382 TYR CG CD2 sing Y N 383 TYR CD1 CE1 sing Y N 384 TYR CD1 HD1 sing N N 385 TYR CD2 CE2 doub Y N 386 TYR CD2 HD2 sing N N 387 TYR CE1 CZ doub Y N 388 TYR CE1 HE1 sing N N 389 TYR CE2 CZ sing Y N 390 TYR CE2 HE2 sing N N 391 TYR CZ OH sing N N 392 TYR OH HH sing N N 393 TYR OXT HXT sing N N 394 VAL N CA sing N N 395 VAL N H sing N N 396 VAL N H2 sing N N 397 VAL CA C sing N N 398 VAL CA CB sing N N 399 VAL CA HA sing N N 400 VAL C O doub N N 401 VAL C OXT sing N N 402 VAL CB CG1 sing N N 403 VAL CB CG2 sing N N 404 VAL CB HB sing N N 405 VAL CG1 HG11 sing N N 406 VAL CG1 HG12 sing N N 407 VAL CG1 HG13 sing N N 408 VAL CG2 HG21 sing N N 409 VAL CG2 HG22 sing N N 410 VAL CG2 HG23 sing N N 411 VAL OXT HXT sing N N 412 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Natural Science Foundation of China (NSFC)' China 91753203 1 'National Natural Science Foundation of China (NSFC)' China 31725014 2 'National Natural Science Foundation of China (NSFC)' China 31871283 3 'National Natural Science Foundation of China (NSFC)' China 31922016 4 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5J9S _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7E7C _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.025883 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008470 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.029112 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H I N O S # loop_