data_7EPO # _entry.id 7EPO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7EPO pdb_00007epo 10.2210/pdb7epo/pdb WWPDB D_1300021977 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7EPO _pdbx_database_status.recvd_initial_deposition_date 2021-04-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Liang, Y.' 1 ? 'Zhang, Q.' 2 0000-0002-1016-1874 'Bartlam, M.' 3 0000-0001-5173-5080 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochem.Biophys.Res.Commun. _citation.journal_id_ASTM BBRCA9 _citation.journal_id_CSD 0146 _citation.journal_id_ISSN 1090-2104 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 560 _citation.language ? _citation.page_first 159 _citation.page_last 164 _citation.title 'Structural characterization and Kemp eliminase activity of the Mycobacterium smegmatis Ketosteroid Isomerase.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.bbrc.2021.05.007 _citation.pdbx_database_id_PubMed 33992958 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Liang, Y.' 1 ? primary 'Li, W.' 2 ? primary 'Liang, H.' 3 ? primary 'Lou, X.' 4 ? primary 'Liu, R.' 5 ? primary 'Zhang, Q.' 6 ? primary 'Bartlam, M.' 7 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7EPO _cell.details ? _cell.formula_units_Z ? _cell.length_a 59.636 _cell.length_a_esd ? _cell.length_b 59.636 _cell.length_b_esd ? _cell.length_c 69.499 _cell.length_c_esd ? _cell.volume 214055.406 _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7EPO _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ;P 32 2" ; _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'SnoaL-like domain-containing protein' 16394.328 1 ? ? ? ? 2 non-polymer syn 5-nitro-1,2-benzoxazole 164.118 1 ? ? ? ? 3 water nat water 18.015 30 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Ketosteroid Isomerase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MVSTRETVNELLRRIAAGDPGRIAELYAEEVSWKLSWPAGDHMGVVPWIQQRSTRAGVEEHFRLIADHHVAKQSSAEVFS VLVDGADAVVLGELRNTAGPTGRSYEAPFALHLTVENGLVTRHHVYEDSLAVFRAFAENAGEPVRSRAS ; _entity_poly.pdbx_seq_one_letter_code_can ;MVSTRETVNELLRRIAAGDPGRIAELYAEEVSWKLSWPAGDHMGVVPWIQQRSTRAGVEEHFRLIADHHVAKQSSAEVFS VLVDGADAVVLGELRNTAGPTGRSYEAPFALHLTVENGLVTRHHVYEDSLAVFRAFAENAGEPVRSRAS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 SER n 1 4 THR n 1 5 ARG n 1 6 GLU n 1 7 THR n 1 8 VAL n 1 9 ASN n 1 10 GLU n 1 11 LEU n 1 12 LEU n 1 13 ARG n 1 14 ARG n 1 15 ILE n 1 16 ALA n 1 17 ALA n 1 18 GLY n 1 19 ASP n 1 20 PRO n 1 21 GLY n 1 22 ARG n 1 23 ILE n 1 24 ALA n 1 25 GLU n 1 26 LEU n 1 27 TYR n 1 28 ALA n 1 29 GLU n 1 30 GLU n 1 31 VAL n 1 32 SER n 1 33 TRP n 1 34 LYS n 1 35 LEU n 1 36 SER n 1 37 TRP n 1 38 PRO n 1 39 ALA n 1 40 GLY n 1 41 ASP n 1 42 HIS n 1 43 MET n 1 44 GLY n 1 45 VAL n 1 46 VAL n 1 47 PRO n 1 48 TRP n 1 49 ILE n 1 50 GLN n 1 51 GLN n 1 52 ARG n 1 53 SER n 1 54 THR n 1 55 ARG n 1 56 ALA n 1 57 GLY n 1 58 VAL n 1 59 GLU n 1 60 GLU n 1 61 HIS n 1 62 PHE n 1 63 ARG n 1 64 LEU n 1 65 ILE n 1 66 ALA n 1 67 ASP n 1 68 HIS n 1 69 HIS n 1 70 VAL n 1 71 ALA n 1 72 LYS n 1 73 GLN n 1 74 SER n 1 75 SER n 1 76 ALA n 1 77 GLU n 1 78 VAL n 1 79 PHE n 1 80 SER n 1 81 VAL n 1 82 LEU n 1 83 VAL n 1 84 ASP n 1 85 GLY n 1 86 ALA n 1 87 ASP n 1 88 ALA n 1 89 VAL n 1 90 VAL n 1 91 LEU n 1 92 GLY n 1 93 GLU n 1 94 LEU n 1 95 ARG n 1 96 ASN n 1 97 THR n 1 98 ALA n 1 99 GLY n 1 100 PRO n 1 101 THR n 1 102 GLY n 1 103 ARG n 1 104 SER n 1 105 TYR n 1 106 GLU n 1 107 ALA n 1 108 PRO n 1 109 PHE n 1 110 ALA n 1 111 LEU n 1 112 HIS n 1 113 LEU n 1 114 THR n 1 115 VAL n 1 116 GLU n 1 117 ASN n 1 118 GLY n 1 119 LEU n 1 120 VAL n 1 121 THR n 1 122 ARG n 1 123 HIS n 1 124 HIS n 1 125 VAL n 1 126 TYR n 1 127 GLU n 1 128 ASP n 1 129 SER n 1 130 LEU n 1 131 ALA n 1 132 VAL n 1 133 PHE n 1 134 ARG n 1 135 ALA n 1 136 PHE n 1 137 ALA n 1 138 GLU n 1 139 ASN n 1 140 ALA n 1 141 GLY n 1 142 GLU n 1 143 PRO n 1 144 VAL n 1 145 ARG n 1 146 SER n 1 147 ARG n 1 148 ALA n 1 149 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 149 _entity_src_gen.gene_src_common_name 'Mycobacterium smegmatis' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene MSMEI_6677 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 700084 / mc(2)155' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 246196 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code I7FVV8_MYCS2 _struct_ref.pdbx_db_accession I7FVV8 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MVSTRETVNELLRRIAAGDPGRIAELYAEEVSWKLSWPAGDHMGVVPWIQQRSTRAGVEEHFRLIADHHVAKQSSAEVFS VLVDGADAVVLGELRNTAGPTGRSYEAPFALHLTVENGLVTRHHVYEDSLAVFRAFAENAGEPVRSRAS ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7EPO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 149 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession I7FVV8 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 149 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 149 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 H5J non-polymer . 5-nitro-1,2-benzoxazole ? 'C7 H4 N2 O3' 164.118 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7EPO _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.18 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 43.48 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M Sodium acetate trihydrate, 0.1 M Tris, pH 8.5, 30% (w/v) PEG 3000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-11-15 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9793 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL18U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9793 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL18U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate 70.38 _reflns.entry_id 7EPO _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.35 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 6258 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 18.4 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 39.77 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.019 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.35 _reflns_shell.d_res_low 2.39 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.29 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 312 _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 15.0 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.424 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 82.95 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7EPO _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.35 _refine.ls_d_res_low 24.21 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6228 _refine.ls_number_reflns_R_free 619 _refine.ls_number_reflns_R_work 5609 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.74 _refine.ls_percent_reflns_R_free 9.94 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1987 _refine.ls_R_factor_R_free 0.2574 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1925 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.37 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 7EPN _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 32.7489 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4253 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.35 _refine_hist.d_res_low 24.21 _refine_hist.number_atoms_solvent 30 _refine_hist.number_atoms_total 1057 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1015 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 12 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0071 ? 1051 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.8294 ? 1430 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0551 ? 158 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0065 ? 186 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 5.9974 ? 142 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.35 2.59 . . 151 1367 99.41 . . . 0.3916 . 0.2792 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.59 2.96 . . 151 1383 99.93 . . . 0.3783 . 0.2425 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.96 3.73 . . 154 1391 100.00 . . . 0.3071 . 0.2118 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.73 24.21 . . 163 1468 99.63 . . . 0.2107 . 0.1707 . . . . . . . . . . . # _struct.entry_id 7EPO _struct.title 'Ketosteroid Isomerase KSI with 5-nitrobenzoxazole (5NBI)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7EPO _struct_keywords.text 'Kemp elimination, MsKSI, Mycobacterium smegmatis, Crystal structure., ISOMERASE' _struct_keywords.pdbx_keywords ISOMERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 3 ? GLY A 18 ? SER A 3 GLY A 18 1 ? 16 HELX_P HELX_P2 AA2 ASP A 19 ? LEU A 26 ? ASP A 19 LEU A 26 1 ? 8 HELX_P HELX_P3 AA3 PRO A 38 ? HIS A 42 ? PRO A 38 HIS A 42 5 ? 5 HELX_P HELX_P4 AA4 THR A 54 ? HIS A 68 ? THR A 54 HIS A 68 1 ? 15 HELX_P HELX_P5 AA5 ASP A 128 ? ALA A 135 ? ASP A 128 ALA A 135 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 27 ? LEU A 35 ? TYR A 27 LEU A 35 AA1 2 LEU A 119 ? GLU A 127 ? LEU A 119 GLU A 127 AA1 3 SER A 104 ? GLU A 116 ? SER A 104 GLU A 116 AA1 4 ASP A 87 ? THR A 97 ? ASP A 87 THR A 97 AA1 5 SER A 75 ? ASP A 84 ? SER A 75 ASP A 84 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ALA A 28 ? N ALA A 28 O VAL A 120 ? O VAL A 120 AA1 2 3 O TYR A 126 ? O TYR A 126 N ALA A 110 ? N ALA A 110 AA1 3 4 O LEU A 113 ? O LEU A 113 N ALA A 88 ? N ALA A 88 AA1 4 5 O ASP A 87 ? O ASP A 87 N ASP A 84 ? N ASP A 84 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id H5J _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 6 _struct_site.details 'binding site for residue H5J A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 TRP A 48 ? TRP A 48 . ? 1_555 ? 2 AC1 6 HIS A 61 ? HIS A 61 . ? 1_555 ? 3 AC1 6 LEU A 94 ? LEU A 94 . ? 1_555 ? 4 AC1 6 HIS A 123 ? HIS A 123 . ? 1_555 ? 5 AC1 6 VAL A 125 ? VAL A 125 . ? 1_555 ? 6 AC1 6 GLU A 127 ? GLU A 127 . ? 1_555 ? # _atom_sites.entry_id 7EPO _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.016768 _atom_sites.fract_transf_matrix[1][2] 0.009681 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019362 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014389 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 TRP 33 33 33 TRP TRP A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 TRP 37 37 37 TRP TRP A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 HIS 42 42 42 HIS HIS A . n A 1 43 MET 43 43 43 MET MET A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 TRP 48 48 48 TRP TRP A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 HIS 61 61 61 HIS HIS A . n A 1 62 PHE 62 62 62 PHE PHE A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 HIS 68 68 68 HIS HIS A . n A 1 69 HIS 69 69 ? ? ? A . n A 1 70 VAL 70 70 ? ? ? A . n A 1 71 ALA 71 71 ? ? ? A . n A 1 72 LYS 72 72 ? ? ? A . n A 1 73 GLN 73 73 ? ? ? A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 ARG 95 95 95 ARG ARG A . n A 1 96 ASN 96 96 96 ASN ASN A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 PRO 100 100 100 PRO PRO A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 ARG 103 103 103 ARG ARG A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 TYR 105 105 105 TYR TYR A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 PRO 108 108 108 PRO PRO A . n A 1 109 PHE 109 109 109 PHE PHE A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 HIS 112 112 112 HIS HIS A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 THR 114 114 114 THR THR A . n A 1 115 VAL 115 115 115 VAL VAL A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 ASN 117 117 117 ASN ASN A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 THR 121 121 121 THR THR A . n A 1 122 ARG 122 122 122 ARG ARG A . n A 1 123 HIS 123 123 123 HIS HIS A . n A 1 124 HIS 124 124 124 HIS HIS A . n A 1 125 VAL 125 125 125 VAL VAL A . n A 1 126 TYR 126 126 126 TYR TYR A . n A 1 127 GLU 127 127 127 GLU GLU A . n A 1 128 ASP 128 128 128 ASP ASP A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 VAL 132 132 132 VAL VAL A . n A 1 133 PHE 133 133 133 PHE PHE A . n A 1 134 ARG 134 134 134 ARG ARG A . n A 1 135 ALA 135 135 135 ALA ALA A . n A 1 136 PHE 136 136 136 PHE PHE A . n A 1 137 ALA 137 137 ? ? ? A . n A 1 138 GLU 138 138 ? ? ? A . n A 1 139 ASN 139 139 ? ? ? A . n A 1 140 ALA 140 140 ? ? ? A . n A 1 141 GLY 141 141 ? ? ? A . n A 1 142 GLU 142 142 ? ? ? A . n A 1 143 PRO 143 143 ? ? ? A . n A 1 144 VAL 144 144 ? ? ? A . n A 1 145 ARG 145 145 ? ? ? A . n A 1 146 SER 146 146 ? ? ? A . n A 1 147 ARG 147 147 ? ? ? A . n A 1 148 ALA 148 148 ? ? ? A . n A 1 149 SER 149 149 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 H5J 1 201 201 H5J H5J A . C 3 HOH 1 301 19 HOH HOH A . C 3 HOH 2 302 3 HOH HOH A . C 3 HOH 3 303 1 HOH HOH A . C 3 HOH 4 304 38 HOH HOH A . C 3 HOH 5 305 2 HOH HOH A . C 3 HOH 6 306 21 HOH HOH A . C 3 HOH 7 307 8 HOH HOH A . C 3 HOH 8 308 27 HOH HOH A . C 3 HOH 9 309 28 HOH HOH A . C 3 HOH 10 310 7 HOH HOH A . C 3 HOH 11 311 34 HOH HOH A . C 3 HOH 12 312 4 HOH HOH A . C 3 HOH 13 313 5 HOH HOH A . C 3 HOH 14 314 6 HOH HOH A . C 3 HOH 15 315 26 HOH HOH A . C 3 HOH 16 316 43 HOH HOH A . C 3 HOH 17 317 22 HOH HOH A . C 3 HOH 18 318 41 HOH HOH A . C 3 HOH 19 319 17 HOH HOH A . C 3 HOH 20 320 18 HOH HOH A . C 3 HOH 21 321 37 HOH HOH A . C 3 HOH 22 322 15 HOH HOH A . C 3 HOH 23 323 10 HOH HOH A . C 3 HOH 24 324 12 HOH HOH A . C 3 HOH 25 325 24 HOH HOH A . C 3 HOH 26 326 23 HOH HOH A . C 3 HOH 27 327 16 HOH HOH A . C 3 HOH 28 328 20 HOH HOH A . C 3 HOH 29 329 13 HOH HOH A . C 3 HOH 30 330 29 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2000 ? 1 MORE -14 ? 1 'SSA (A^2)' 12090 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_555 x-y,-y,-z+1/3 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 23.1663333333 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-12-22 2 'Structure model' 1 1 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x-y,z+2/3 3 -x+y,-x,z+1/3 4 x-y,-y,-z+1/3 5 -x,-x+y,-z+2/3 6 y,x,-z # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -27.6370394468 _pdbx_refine_tls.origin_y 4.5944811018 _pdbx_refine_tls.origin_z 0.85362577942 _pdbx_refine_tls.T[1][1] 0.561820928635 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] -0.0803434038021 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.0202398879943 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.527279241103 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.00243734486251 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.502138579007 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 4.73398790872 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] 0.160204299543 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 0.33661853449 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 6.64770752234 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] -2.00817717742 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 4.58159185385 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] -0.185259215873 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] 0.529984477998 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] -0.018050684598 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.693018453634 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] 0.139363697121 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] -0.09521529878 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] 0.0656504923106 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.071709144945 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.0740981663822 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.beg_auth_asym_id ? _pdbx_refine_tls_group.beg_auth_seq_id ? _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id ? _pdbx_refine_tls_group.end_auth_seq_id ? _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.17.1_3660 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_entry_details.entry_id 7EPO _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 49 ? ? -65.33 94.68 2 1 ASP A 128 ? ? -66.43 83.32 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A HIS 69 ? A HIS 69 3 1 Y 1 A VAL 70 ? A VAL 70 4 1 Y 1 A ALA 71 ? A ALA 71 5 1 Y 1 A LYS 72 ? A LYS 72 6 1 Y 1 A GLN 73 ? A GLN 73 7 1 Y 1 A ALA 137 ? A ALA 137 8 1 Y 1 A GLU 138 ? A GLU 138 9 1 Y 1 A ASN 139 ? A ASN 139 10 1 Y 1 A ALA 140 ? A ALA 140 11 1 Y 1 A GLY 141 ? A GLY 141 12 1 Y 1 A GLU 142 ? A GLU 142 13 1 Y 1 A PRO 143 ? A PRO 143 14 1 Y 1 A VAL 144 ? A VAL 144 15 1 Y 1 A ARG 145 ? A ARG 145 16 1 Y 1 A SER 146 ? A SER 146 17 1 Y 1 A ARG 147 ? A ARG 147 18 1 Y 1 A ALA 148 ? A ALA 148 19 1 Y 1 A SER 149 ? A SER 149 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 H5J OAB O N N 123 H5J NAL N N N 124 H5J OAA O N N 125 H5J CAI C Y N 126 H5J CAF C Y N 127 H5J CAJ C Y N 128 H5J CAE C Y N 129 H5J NAG N Y N 130 H5J OAH O Y N 131 H5J CAK C Y N 132 H5J CAD C Y N 133 H5J CAC C Y N 134 H5J H1 H N N 135 H5J H2 H N N 136 H5J H3 H N N 137 H5J H4 H N N 138 HIS N N N N 139 HIS CA C N S 140 HIS C C N N 141 HIS O O N N 142 HIS CB C N N 143 HIS CG C Y N 144 HIS ND1 N Y N 145 HIS CD2 C Y N 146 HIS CE1 C Y N 147 HIS NE2 N Y N 148 HIS OXT O N N 149 HIS H H N N 150 HIS H2 H N N 151 HIS HA H N N 152 HIS HB2 H N N 153 HIS HB3 H N N 154 HIS HD1 H N N 155 HIS HD2 H N N 156 HIS HE1 H N N 157 HIS HE2 H N N 158 HIS HXT H N N 159 HOH O O N N 160 HOH H1 H N N 161 HOH H2 H N N 162 ILE N N N N 163 ILE CA C N S 164 ILE C C N N 165 ILE O O N N 166 ILE CB C N S 167 ILE CG1 C N N 168 ILE CG2 C N N 169 ILE CD1 C N N 170 ILE OXT O N N 171 ILE H H N N 172 ILE H2 H N N 173 ILE HA H N N 174 ILE HB H N N 175 ILE HG12 H N N 176 ILE HG13 H N N 177 ILE HG21 H N N 178 ILE HG22 H N N 179 ILE HG23 H N N 180 ILE HD11 H N N 181 ILE HD12 H N N 182 ILE HD13 H N N 183 ILE HXT H N N 184 LEU N N N N 185 LEU CA C N S 186 LEU C C N N 187 LEU O O N N 188 LEU CB C N N 189 LEU CG C N N 190 LEU CD1 C N N 191 LEU CD2 C N N 192 LEU OXT O N N 193 LEU H H N N 194 LEU H2 H N N 195 LEU HA H N N 196 LEU HB2 H N N 197 LEU HB3 H N N 198 LEU HG H N N 199 LEU HD11 H N N 200 LEU HD12 H N N 201 LEU HD13 H N N 202 LEU HD21 H N N 203 LEU HD22 H N N 204 LEU HD23 H N N 205 LEU HXT H N N 206 LYS N N N N 207 LYS CA C N S 208 LYS C C N N 209 LYS O O N N 210 LYS CB C N N 211 LYS CG C N N 212 LYS CD C N N 213 LYS CE C N N 214 LYS NZ N N N 215 LYS OXT O N N 216 LYS H H N N 217 LYS H2 H N N 218 LYS HA H N N 219 LYS HB2 H N N 220 LYS HB3 H N N 221 LYS HG2 H N N 222 LYS HG3 H N N 223 LYS HD2 H N N 224 LYS HD3 H N N 225 LYS HE2 H N N 226 LYS HE3 H N N 227 LYS HZ1 H N N 228 LYS HZ2 H N N 229 LYS HZ3 H N N 230 LYS HXT H N N 231 MET N N N N 232 MET CA C N S 233 MET C C N N 234 MET O O N N 235 MET CB C N N 236 MET CG C N N 237 MET SD S N N 238 MET CE C N N 239 MET OXT O N N 240 MET H H N N 241 MET H2 H N N 242 MET HA H N N 243 MET HB2 H N N 244 MET HB3 H N N 245 MET HG2 H N N 246 MET HG3 H N N 247 MET HE1 H N N 248 MET HE2 H N N 249 MET HE3 H N N 250 MET HXT H N N 251 PHE N N N N 252 PHE CA C N S 253 PHE C C N N 254 PHE O O N N 255 PHE CB C N N 256 PHE CG C Y N 257 PHE CD1 C Y N 258 PHE CD2 C Y N 259 PHE CE1 C Y N 260 PHE CE2 C Y N 261 PHE CZ C Y N 262 PHE OXT O N N 263 PHE H H N N 264 PHE H2 H N N 265 PHE HA H N N 266 PHE HB2 H N N 267 PHE HB3 H N N 268 PHE HD1 H N N 269 PHE HD2 H N N 270 PHE HE1 H N N 271 PHE HE2 H N N 272 PHE HZ H N N 273 PHE HXT H N N 274 PRO N N N N 275 PRO CA C N S 276 PRO C C N N 277 PRO O O N N 278 PRO CB C N N 279 PRO CG C N N 280 PRO CD C N N 281 PRO OXT O N N 282 PRO H H N N 283 PRO HA H N N 284 PRO HB2 H N N 285 PRO HB3 H N N 286 PRO HG2 H N N 287 PRO HG3 H N N 288 PRO HD2 H N N 289 PRO HD3 H N N 290 PRO HXT H N N 291 SER N N N N 292 SER CA C N S 293 SER C C N N 294 SER O O N N 295 SER CB C N N 296 SER OG O N N 297 SER OXT O N N 298 SER H H N N 299 SER H2 H N N 300 SER HA H N N 301 SER HB2 H N N 302 SER HB3 H N N 303 SER HG H N N 304 SER HXT H N N 305 THR N N N N 306 THR CA C N S 307 THR C C N N 308 THR O O N N 309 THR CB C N R 310 THR OG1 O N N 311 THR CG2 C N N 312 THR OXT O N N 313 THR H H N N 314 THR H2 H N N 315 THR HA H N N 316 THR HB H N N 317 THR HG1 H N N 318 THR HG21 H N N 319 THR HG22 H N N 320 THR HG23 H N N 321 THR HXT H N N 322 TRP N N N N 323 TRP CA C N S 324 TRP C C N N 325 TRP O O N N 326 TRP CB C N N 327 TRP CG C Y N 328 TRP CD1 C Y N 329 TRP CD2 C Y N 330 TRP NE1 N Y N 331 TRP CE2 C Y N 332 TRP CE3 C Y N 333 TRP CZ2 C Y N 334 TRP CZ3 C Y N 335 TRP CH2 C Y N 336 TRP OXT O N N 337 TRP H H N N 338 TRP H2 H N N 339 TRP HA H N N 340 TRP HB2 H N N 341 TRP HB3 H N N 342 TRP HD1 H N N 343 TRP HE1 H N N 344 TRP HE3 H N N 345 TRP HZ2 H N N 346 TRP HZ3 H N N 347 TRP HH2 H N N 348 TRP HXT H N N 349 TYR N N N N 350 TYR CA C N S 351 TYR C C N N 352 TYR O O N N 353 TYR CB C N N 354 TYR CG C Y N 355 TYR CD1 C Y N 356 TYR CD2 C Y N 357 TYR CE1 C Y N 358 TYR CE2 C Y N 359 TYR CZ C Y N 360 TYR OH O N N 361 TYR OXT O N N 362 TYR H H N N 363 TYR H2 H N N 364 TYR HA H N N 365 TYR HB2 H N N 366 TYR HB3 H N N 367 TYR HD1 H N N 368 TYR HD2 H N N 369 TYR HE1 H N N 370 TYR HE2 H N N 371 TYR HH H N N 372 TYR HXT H N N 373 VAL N N N N 374 VAL CA C N S 375 VAL C C N N 376 VAL O O N N 377 VAL CB C N N 378 VAL CG1 C N N 379 VAL CG2 C N N 380 VAL OXT O N N 381 VAL H H N N 382 VAL H2 H N N 383 VAL HA H N N 384 VAL HB H N N 385 VAL HG11 H N N 386 VAL HG12 H N N 387 VAL HG13 H N N 388 VAL HG21 H N N 389 VAL HG22 H N N 390 VAL HG23 H N N 391 VAL HXT H N N 392 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 H5J OAB NAL doub N N 116 H5J OAA NAL doub N N 117 H5J NAL CAI sing N N 118 H5J CAI CAF doub Y N 119 H5J CAI CAC sing Y N 120 H5J CAF CAJ sing Y N 121 H5J CAC CAD doub Y N 122 H5J CAJ CAE sing Y N 123 H5J CAJ CAK doub Y N 124 H5J CAE NAG doub Y N 125 H5J CAD CAK sing Y N 126 H5J CAK OAH sing Y N 127 H5J NAG OAH sing Y N 128 H5J CAF H1 sing N N 129 H5J CAE H2 sing N N 130 H5J CAD H3 sing N N 131 H5J CAC H4 sing N N 132 HIS N CA sing N N 133 HIS N H sing N N 134 HIS N H2 sing N N 135 HIS CA C sing N N 136 HIS CA CB sing N N 137 HIS CA HA sing N N 138 HIS C O doub N N 139 HIS C OXT sing N N 140 HIS CB CG sing N N 141 HIS CB HB2 sing N N 142 HIS CB HB3 sing N N 143 HIS CG ND1 sing Y N 144 HIS CG CD2 doub Y N 145 HIS ND1 CE1 doub Y N 146 HIS ND1 HD1 sing N N 147 HIS CD2 NE2 sing Y N 148 HIS CD2 HD2 sing N N 149 HIS CE1 NE2 sing Y N 150 HIS CE1 HE1 sing N N 151 HIS NE2 HE2 sing N N 152 HIS OXT HXT sing N N 153 HOH O H1 sing N N 154 HOH O H2 sing N N 155 ILE N CA sing N N 156 ILE N H sing N N 157 ILE N H2 sing N N 158 ILE CA C sing N N 159 ILE CA CB sing N N 160 ILE CA HA sing N N 161 ILE C O doub N N 162 ILE C OXT sing N N 163 ILE CB CG1 sing N N 164 ILE CB CG2 sing N N 165 ILE CB HB sing N N 166 ILE CG1 CD1 sing N N 167 ILE CG1 HG12 sing N N 168 ILE CG1 HG13 sing N N 169 ILE CG2 HG21 sing N N 170 ILE CG2 HG22 sing N N 171 ILE CG2 HG23 sing N N 172 ILE CD1 HD11 sing N N 173 ILE CD1 HD12 sing N N 174 ILE CD1 HD13 sing N N 175 ILE OXT HXT sing N N 176 LEU N CA sing N N 177 LEU N H sing N N 178 LEU N H2 sing N N 179 LEU CA C sing N N 180 LEU CA CB sing N N 181 LEU CA HA sing N N 182 LEU C O doub N N 183 LEU C OXT sing N N 184 LEU CB CG sing N N 185 LEU CB HB2 sing N N 186 LEU CB HB3 sing N N 187 LEU CG CD1 sing N N 188 LEU CG CD2 sing N N 189 LEU CG HG sing N N 190 LEU CD1 HD11 sing N N 191 LEU CD1 HD12 sing N N 192 LEU CD1 HD13 sing N N 193 LEU CD2 HD21 sing N N 194 LEU CD2 HD22 sing N N 195 LEU CD2 HD23 sing N N 196 LEU OXT HXT sing N N 197 LYS N CA sing N N 198 LYS N H sing N N 199 LYS N H2 sing N N 200 LYS CA C sing N N 201 LYS CA CB sing N N 202 LYS CA HA sing N N 203 LYS C O doub N N 204 LYS C OXT sing N N 205 LYS CB CG sing N N 206 LYS CB HB2 sing N N 207 LYS CB HB3 sing N N 208 LYS CG CD sing N N 209 LYS CG HG2 sing N N 210 LYS CG HG3 sing N N 211 LYS CD CE sing N N 212 LYS CD HD2 sing N N 213 LYS CD HD3 sing N N 214 LYS CE NZ sing N N 215 LYS CE HE2 sing N N 216 LYS CE HE3 sing N N 217 LYS NZ HZ1 sing N N 218 LYS NZ HZ2 sing N N 219 LYS NZ HZ3 sing N N 220 LYS OXT HXT sing N N 221 MET N CA sing N N 222 MET N H sing N N 223 MET N H2 sing N N 224 MET CA C sing N N 225 MET CA CB sing N N 226 MET CA HA sing N N 227 MET C O doub N N 228 MET C OXT sing N N 229 MET CB CG sing N N 230 MET CB HB2 sing N N 231 MET CB HB3 sing N N 232 MET CG SD sing N N 233 MET CG HG2 sing N N 234 MET CG HG3 sing N N 235 MET SD CE sing N N 236 MET CE HE1 sing N N 237 MET CE HE2 sing N N 238 MET CE HE3 sing N N 239 MET OXT HXT sing N N 240 PHE N CA sing N N 241 PHE N H sing N N 242 PHE N H2 sing N N 243 PHE CA C sing N N 244 PHE CA CB sing N N 245 PHE CA HA sing N N 246 PHE C O doub N N 247 PHE C OXT sing N N 248 PHE CB CG sing N N 249 PHE CB HB2 sing N N 250 PHE CB HB3 sing N N 251 PHE CG CD1 doub Y N 252 PHE CG CD2 sing Y N 253 PHE CD1 CE1 sing Y N 254 PHE CD1 HD1 sing N N 255 PHE CD2 CE2 doub Y N 256 PHE CD2 HD2 sing N N 257 PHE CE1 CZ doub Y N 258 PHE CE1 HE1 sing N N 259 PHE CE2 CZ sing Y N 260 PHE CE2 HE2 sing N N 261 PHE CZ HZ sing N N 262 PHE OXT HXT sing N N 263 PRO N CA sing N N 264 PRO N CD sing N N 265 PRO N H sing N N 266 PRO CA C sing N N 267 PRO CA CB sing N N 268 PRO CA HA sing N N 269 PRO C O doub N N 270 PRO C OXT sing N N 271 PRO CB CG sing N N 272 PRO CB HB2 sing N N 273 PRO CB HB3 sing N N 274 PRO CG CD sing N N 275 PRO CG HG2 sing N N 276 PRO CG HG3 sing N N 277 PRO CD HD2 sing N N 278 PRO CD HD3 sing N N 279 PRO OXT HXT sing N N 280 SER N CA sing N N 281 SER N H sing N N 282 SER N H2 sing N N 283 SER CA C sing N N 284 SER CA CB sing N N 285 SER CA HA sing N N 286 SER C O doub N N 287 SER C OXT sing N N 288 SER CB OG sing N N 289 SER CB HB2 sing N N 290 SER CB HB3 sing N N 291 SER OG HG sing N N 292 SER OXT HXT sing N N 293 THR N CA sing N N 294 THR N H sing N N 295 THR N H2 sing N N 296 THR CA C sing N N 297 THR CA CB sing N N 298 THR CA HA sing N N 299 THR C O doub N N 300 THR C OXT sing N N 301 THR CB OG1 sing N N 302 THR CB CG2 sing N N 303 THR CB HB sing N N 304 THR OG1 HG1 sing N N 305 THR CG2 HG21 sing N N 306 THR CG2 HG22 sing N N 307 THR CG2 HG23 sing N N 308 THR OXT HXT sing N N 309 TRP N CA sing N N 310 TRP N H sing N N 311 TRP N H2 sing N N 312 TRP CA C sing N N 313 TRP CA CB sing N N 314 TRP CA HA sing N N 315 TRP C O doub N N 316 TRP C OXT sing N N 317 TRP CB CG sing N N 318 TRP CB HB2 sing N N 319 TRP CB HB3 sing N N 320 TRP CG CD1 doub Y N 321 TRP CG CD2 sing Y N 322 TRP CD1 NE1 sing Y N 323 TRP CD1 HD1 sing N N 324 TRP CD2 CE2 doub Y N 325 TRP CD2 CE3 sing Y N 326 TRP NE1 CE2 sing Y N 327 TRP NE1 HE1 sing N N 328 TRP CE2 CZ2 sing Y N 329 TRP CE3 CZ3 doub Y N 330 TRP CE3 HE3 sing N N 331 TRP CZ2 CH2 doub Y N 332 TRP CZ2 HZ2 sing N N 333 TRP CZ3 CH2 sing Y N 334 TRP CZ3 HZ3 sing N N 335 TRP CH2 HH2 sing N N 336 TRP OXT HXT sing N N 337 TYR N CA sing N N 338 TYR N H sing N N 339 TYR N H2 sing N N 340 TYR CA C sing N N 341 TYR CA CB sing N N 342 TYR CA HA sing N N 343 TYR C O doub N N 344 TYR C OXT sing N N 345 TYR CB CG sing N N 346 TYR CB HB2 sing N N 347 TYR CB HB3 sing N N 348 TYR CG CD1 doub Y N 349 TYR CG CD2 sing Y N 350 TYR CD1 CE1 sing Y N 351 TYR CD1 HD1 sing N N 352 TYR CD2 CE2 doub Y N 353 TYR CD2 HD2 sing N N 354 TYR CE1 CZ doub Y N 355 TYR CE1 HE1 sing N N 356 TYR CE2 CZ sing Y N 357 TYR CE2 HE2 sing N N 358 TYR CZ OH sing N N 359 TYR OH HH sing N N 360 TYR OXT HXT sing N N 361 VAL N CA sing N N 362 VAL N H sing N N 363 VAL N H2 sing N N 364 VAL CA C sing N N 365 VAL CA CB sing N N 366 VAL CA HA sing N N 367 VAL C O doub N N 368 VAL C OXT sing N N 369 VAL CB CG1 sing N N 370 VAL CB CG2 sing N N 371 VAL CB HB sing N N 372 VAL CG1 HG11 sing N N 373 VAL CG1 HG12 sing N N 374 VAL CG1 HG13 sing N N 375 VAL CG2 HG21 sing N N 376 VAL CG2 HG22 sing N N 377 VAL CG2 HG23 sing N N 378 VAL OXT HXT sing N N 379 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Natural Science Foundation of China (NSFC)' China 31800627 1 'National Natural Science Foundation of China (NSFC)' China 31870053 2 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id H5J _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id H5J _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 5-nitro-1,2-benzoxazole H5J 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 7EPN _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'P 32 2 1' _space_group.name_Hall ;P 32 2" ; _space_group.IT_number 154 _space_group.crystal_system trigonal _space_group.id 1 #