data_7EQ4 # _entry.id 7EQ4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7EQ4 pdb_00007eq4 10.2210/pdb7eq4/pdb WWPDB D_1300022000 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7EQ4 _pdbx_database_status.recvd_initial_deposition_date 2021-04-29 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Liu, Y.' 1 0000-0002-5983-0151 'Ke, Z.' 2 ? 'Hu, H.' 3 ? 'Zhao, K.' 4 0000-0002-0261-1599 'Xiao, J.' 5 0000-0002-8074-5963 'Xia, Y.' 6 0000-0001-8460-3893 'Li, Y.' 7 0000-0003-1963-839X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Microbiol Spectr' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2165-0497 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 9 _citation.language ? _citation.page_first e0016921 _citation.page_last e0016921 _citation.title 'Structural Basis and Function of the N Terminus of SARS-CoV-2 Nonstructural Protein 1.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1128/Spectrum.00169-21 _citation.pdbx_database_id_PubMed 34132580 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhao, K.' 1 0000-0002-0261-1599 primary 'Ke, Z.' 2 ? primary 'Hu, H.' 3 ? primary 'Liu, Y.' 4 ? primary 'Li, A.' 5 ? primary 'Hua, R.' 6 ? primary 'Guo, F.' 7 ? primary 'Xiao, J.' 8 ? primary 'Zhang, Y.' 9 ? primary 'Duan, L.' 10 ? primary 'Yan, X.F.' 11 ? primary 'Gao, Y.G.' 12 ? primary 'Liu, B.' 13 ? primary 'Xia, Y.' 14 0000-0001-8460-3893 primary 'Li, Y.' 15 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7EQ4 _cell.details ? _cell.formula_units_Z ? _cell.length_a 36.605 _cell.length_a_esd ? _cell.length_b 36.605 _cell.length_b_esd ? _cell.length_c 140.546 _cell.length_c_esd ? _cell.volume 188321.243 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7EQ4 _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall 'P 4nw 2abw' _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Host translation inhibitor nsp1' 13852.975 1 ? ? ? ? 2 water nat water 18.015 85 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Leader protein,Non-structural protein 1,nsp1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MHHHHHHASKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGVLPQLEQPYVFIKRSDARTAPH GHVMVELVAELEGIQYGRSGETLGVLVPHVGEIPVAYRKVLLRK ; _entity_poly.pdbx_seq_one_letter_code_can ;MHHHHHHASKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGVLPQLEQPYVFIKRSDARTAPH GHVMVELVAELEGIQYGRSGETLGVLVPHVGEIPVAYRKVLLRK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 ALA n 1 9 SER n 1 10 LYS n 1 11 THR n 1 12 HIS n 1 13 VAL n 1 14 GLN n 1 15 LEU n 1 16 SER n 1 17 LEU n 1 18 PRO n 1 19 VAL n 1 20 LEU n 1 21 GLN n 1 22 VAL n 1 23 ARG n 1 24 ASP n 1 25 VAL n 1 26 LEU n 1 27 VAL n 1 28 ARG n 1 29 GLY n 1 30 PHE n 1 31 GLY n 1 32 ASP n 1 33 SER n 1 34 VAL n 1 35 GLU n 1 36 GLU n 1 37 VAL n 1 38 LEU n 1 39 SER n 1 40 GLU n 1 41 ALA n 1 42 ARG n 1 43 GLN n 1 44 HIS n 1 45 LEU n 1 46 LYS n 1 47 ASP n 1 48 GLY n 1 49 THR n 1 50 CYS n 1 51 GLY n 1 52 LEU n 1 53 VAL n 1 54 GLU n 1 55 VAL n 1 56 GLU n 1 57 LYS n 1 58 GLY n 1 59 VAL n 1 60 LEU n 1 61 PRO n 1 62 GLN n 1 63 LEU n 1 64 GLU n 1 65 GLN n 1 66 PRO n 1 67 TYR n 1 68 VAL n 1 69 PHE n 1 70 ILE n 1 71 LYS n 1 72 ARG n 1 73 SER n 1 74 ASP n 1 75 ALA n 1 76 ARG n 1 77 THR n 1 78 ALA n 1 79 PRO n 1 80 HIS n 1 81 GLY n 1 82 HIS n 1 83 VAL n 1 84 MET n 1 85 VAL n 1 86 GLU n 1 87 LEU n 1 88 VAL n 1 89 ALA n 1 90 GLU n 1 91 LEU n 1 92 GLU n 1 93 GLY n 1 94 ILE n 1 95 GLN n 1 96 TYR n 1 97 GLY n 1 98 ARG n 1 99 SER n 1 100 GLY n 1 101 GLU n 1 102 THR n 1 103 LEU n 1 104 GLY n 1 105 VAL n 1 106 LEU n 1 107 VAL n 1 108 PRO n 1 109 HIS n 1 110 VAL n 1 111 GLY n 1 112 GLU n 1 113 ILE n 1 114 PRO n 1 115 VAL n 1 116 ALA n 1 117 TYR n 1 118 ARG n 1 119 LYS n 1 120 VAL n 1 121 LEU n 1 122 LEU n 1 123 ARG n 1 124 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 124 _entity_src_gen.gene_src_common_name '2019-nCoV, SARS-CoV-2' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'rep, 1a-1b' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Severe acute respiratory syndrome coronavirus 2' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2697049 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 866768 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code R1AB_SARS2 _struct_ref.pdbx_db_accession P0DTD1 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGVLPQLEQPYVFIKRSDARTAPHGHVMVELVA ELEGIQYGRSGETLGVLVPHVGEIPVAYRKVLLRK ; _struct_ref.pdbx_align_begin 11 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7EQ4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 10 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 124 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0DTD1 _struct_ref_seq.db_align_beg 11 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 125 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 10 _struct_ref_seq.pdbx_auth_seq_align_end 124 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7EQ4 MET A 1 ? UNP P0DTD1 ? ? 'initiating methionine' 1 1 1 7EQ4 HIS A 2 ? UNP P0DTD1 ? ? 'expression tag' 2 2 1 7EQ4 HIS A 3 ? UNP P0DTD1 ? ? 'expression tag' 3 3 1 7EQ4 HIS A 4 ? UNP P0DTD1 ? ? 'expression tag' 4 4 1 7EQ4 HIS A 5 ? UNP P0DTD1 ? ? 'expression tag' 5 5 1 7EQ4 HIS A 6 ? UNP P0DTD1 ? ? 'expression tag' 6 6 1 7EQ4 HIS A 7 ? UNP P0DTD1 ? ? 'expression tag' 7 7 1 7EQ4 ALA A 8 ? UNP P0DTD1 ? ? 'expression tag' 8 8 1 7EQ4 SER A 9 ? UNP P0DTD1 ? ? 'expression tag' 9 9 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7EQ4 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.70 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 27.62 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 9.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M Lithium sulfate monohydrate, 0.1 M Glycine pH 9.5, 30% w/v Polyethylene glycol 4000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 298 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-08-16 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9822 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL17U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9822 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL17U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate 18.99 _reflns.entry_id 7EQ4 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.15 _reflns.d_resolution_low 36.31 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 50465 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.86 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 14 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 36.33 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.25 _reflns_shell.d_res_low 8 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 27553 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 1 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 27.13 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7EQ4 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.25 _refine.ls_d_res_low 25.46 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 50465 _refine.ls_number_reflns_R_free 2491 _refine.ls_number_reflns_R_work 47974 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.89 _refine.ls_percent_reflns_R_free 4.94 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1650 _refine.ls_R_factor_R_free 0.1972 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1633 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2HSX _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 19.5617 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.0925 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.25 _refine_hist.d_res_low 25.46 _refine_hist.number_atoms_solvent 85 _refine_hist.number_atoms_total 951 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 866 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0051 ? 885 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.8995 ? 1199 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0784 ? 143 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0047 ? 155 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 23.7415 ? 123 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.25 1.27 . . 162 2677 100.00 . . . 0.2409 . 0.2089 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.27 1.30 . . 109 2728 99.96 . . . 0.2139 . 0.1944 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.30 1.33 . . 102 2644 100.00 . . . 0.2436 . 0.1865 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.33 1.36 . . 142 2723 100.00 . . . 0.2193 . 0.1792 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.36 1.39 . . 154 2602 100.00 . . . 0.2672 . 0.1712 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.39 1.43 . . 145 2664 100.00 . . . 0.2133 . 0.1697 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.43 1.47 . . 128 2681 100.00 . . . 0.2104 . 0.1546 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.47 1.52 . . 147 2681 100.00 . . . 0.1744 . 0.1585 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.52 1.57 . . 161 2628 100.00 . . . 0.1899 . 0.1400 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.57 1.64 . . 135 2651 100.00 . . . 0.2242 . 0.1587 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.64 1.71 . . 133 2690 100.00 . . . 0.2091 . 0.1493 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.71 1.80 . . 131 2668 100.00 . . . 0.2118 . 0.1586 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.80 1.92 . . 164 2662 100.00 . . . 0.1878 . 0.1510 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.92 2.06 . . 121 2653 100.00 . . . 0.1734 . 0.1511 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.06 2.27 . . 140 2694 100.00 . . . 0.2222 . 0.1592 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.27 2.60 . . 138 2663 100.00 . . . 0.2133 . 0.1814 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.60 3.27 . . 130 2667 100.00 . . . 0.2058 . 0.1796 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.27 25.46 . . 149 2598 98.11 . . . 0.1761 . 0.1546 . . . . . . . . . . . # _struct.entry_id 7EQ4 _struct.title 'Crystal Structure of the N-terminus of Nonstructural protein 1 from SARS-CoV-2' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7EQ4 _struct_keywords.text 'SARS-CoV-2, Nsp1, protein translation, ribosome, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLN A 21 ? VAL A 25 ? GLN A 21 VAL A 25 5 ? 5 HELX_P HELX_P2 AA2 SER A 33 ? GLY A 48 ? SER A 33 GLY A 48 1 ? 16 HELX_P HELX_P3 AA3 VAL A 59 ? LEU A 63 ? VAL A 59 LEU A 63 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLN _struct_mon_prot_cis.label_seq_id 65 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLN _struct_mon_prot_cis.auth_seq_id 65 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 66 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 66 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -5.66 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 8 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA1 4 5 ? parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 94 ? TYR A 96 ? ILE A 94 TYR A 96 AA1 2 VAL A 83 ? LEU A 91 ? VAL A 83 LEU A 91 AA1 3 ALA A 116 ? ARG A 123 ? ALA A 116 ARG A 123 AA1 4 HIS A 12 ? VAL A 19 ? HIS A 12 VAL A 19 AA1 5 CYS A 50 ? VAL A 53 ? CYS A 50 VAL A 53 AA1 6 THR A 102 ? PRO A 108 ? THR A 102 PRO A 108 AA1 7 TYR A 67 ? ARG A 72 ? TYR A 67 ARG A 72 AA1 8 VAL A 83 ? LEU A 91 ? VAL A 83 LEU A 91 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O TYR A 96 ? O TYR A 96 N ALA A 89 ? N ALA A 89 AA1 2 3 N VAL A 83 ? N VAL A 83 O LEU A 121 ? O LEU A 121 AA1 3 4 O ALA A 116 ? O ALA A 116 N VAL A 19 ? N VAL A 19 AA1 4 5 N PRO A 18 ? N PRO A 18 O LEU A 52 ? O LEU A 52 AA1 5 6 N GLY A 51 ? N GLY A 51 O VAL A 107 ? O VAL A 107 AA1 6 7 O LEU A 106 ? O LEU A 106 N VAL A 68 ? N VAL A 68 AA1 7 8 N PHE A 69 ? N PHE A 69 O VAL A 88 ? O VAL A 88 # _atom_sites.entry_id 7EQ4 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.027319 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.027319 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007115 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 HIS 2 2 ? ? ? A . n A 1 3 HIS 3 3 ? ? ? A . n A 1 4 HIS 4 4 ? ? ? A . n A 1 5 HIS 5 5 ? ? ? A . n A 1 6 HIS 6 6 ? ? ? A . n A 1 7 HIS 7 7 ? ? ? A . n A 1 8 ALA 8 8 ? ? ? A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 HIS 12 12 12 HIS HIS A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 HIS 44 44 44 HIS HIS A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 CYS 50 50 50 CYS CYS A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 TYR 67 67 67 TYR TYR A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 PHE 69 69 69 PHE PHE A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 THR 77 77 ? ? ? A . n A 1 78 ALA 78 78 ? ? ? A . n A 1 79 PRO 79 79 ? ? ? A . n A 1 80 HIS 80 80 80 HIS HIS A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 HIS 82 82 82 HIS HIS A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 MET 84 84 84 MET MET A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 GLN 95 95 95 GLN GLN A . n A 1 96 TYR 96 96 96 TYR TYR A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 ARG 98 98 98 ARG ARG A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 PRO 108 108 108 PRO PRO A . n A 1 109 HIS 109 109 109 HIS HIS A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 ILE 113 113 113 ILE ILE A . n A 1 114 PRO 114 114 114 PRO PRO A . n A 1 115 VAL 115 115 115 VAL VAL A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 TYR 117 117 117 TYR TYR A . n A 1 118 ARG 118 118 118 ARG ARG A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 ARG 123 123 123 ARG ARG A . n A 1 124 LYS 124 124 124 LYS LYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 201 38 HOH HOH A . B 2 HOH 2 202 74 HOH HOH A . B 2 HOH 3 203 34 HOH HOH A . B 2 HOH 4 204 79 HOH HOH A . B 2 HOH 5 205 71 HOH HOH A . B 2 HOH 6 206 44 HOH HOH A . B 2 HOH 7 207 27 HOH HOH A . B 2 HOH 8 208 77 HOH HOH A . B 2 HOH 9 209 33 HOH HOH A . B 2 HOH 10 210 82 HOH HOH A . B 2 HOH 11 211 70 HOH HOH A . B 2 HOH 12 212 81 HOH HOH A . B 2 HOH 13 213 23 HOH HOH A . B 2 HOH 14 214 4 HOH HOH A . B 2 HOH 15 215 43 HOH HOH A . B 2 HOH 16 216 29 HOH HOH A . B 2 HOH 17 217 42 HOH HOH A . B 2 HOH 18 218 59 HOH HOH A . B 2 HOH 19 219 85 HOH HOH A . B 2 HOH 20 220 50 HOH HOH A . B 2 HOH 21 221 51 HOH HOH A . B 2 HOH 22 222 21 HOH HOH A . B 2 HOH 23 223 6 HOH HOH A . B 2 HOH 24 224 3 HOH HOH A . B 2 HOH 25 225 37 HOH HOH A . B 2 HOH 26 226 1 HOH HOH A . B 2 HOH 27 227 16 HOH HOH A . B 2 HOH 28 228 61 HOH HOH A . B 2 HOH 29 229 45 HOH HOH A . B 2 HOH 30 230 28 HOH HOH A . B 2 HOH 31 231 8 HOH HOH A . B 2 HOH 32 232 46 HOH HOH A . B 2 HOH 33 233 7 HOH HOH A . B 2 HOH 34 234 49 HOH HOH A . B 2 HOH 35 235 18 HOH HOH A . B 2 HOH 36 236 14 HOH HOH A . B 2 HOH 37 237 35 HOH HOH A . B 2 HOH 38 238 24 HOH HOH A . B 2 HOH 39 239 5 HOH HOH A . B 2 HOH 40 240 9 HOH HOH A . B 2 HOH 41 241 69 HOH HOH A . B 2 HOH 42 242 22 HOH HOH A . B 2 HOH 43 243 11 HOH HOH A . B 2 HOH 44 244 65 HOH HOH A . B 2 HOH 45 245 73 HOH HOH A . B 2 HOH 46 246 2 HOH HOH A . B 2 HOH 47 247 47 HOH HOH A . B 2 HOH 48 248 30 HOH HOH A . B 2 HOH 49 249 10 HOH HOH A . B 2 HOH 50 250 58 HOH HOH A . B 2 HOH 51 251 52 HOH HOH A . B 2 HOH 52 252 13 HOH HOH A . B 2 HOH 53 253 76 HOH HOH A . B 2 HOH 54 254 25 HOH HOH A . B 2 HOH 55 255 60 HOH HOH A . B 2 HOH 56 256 32 HOH HOH A . B 2 HOH 57 257 17 HOH HOH A . B 2 HOH 58 258 26 HOH HOH A . B 2 HOH 59 259 40 HOH HOH A . B 2 HOH 60 260 19 HOH HOH A . B 2 HOH 61 261 39 HOH HOH A . B 2 HOH 62 262 80 HOH HOH A . B 2 HOH 63 263 53 HOH HOH A . B 2 HOH 64 264 36 HOH HOH A . B 2 HOH 65 265 72 HOH HOH A . B 2 HOH 66 266 31 HOH HOH A . B 2 HOH 67 267 12 HOH HOH A . B 2 HOH 68 268 20 HOH HOH A . B 2 HOH 69 269 15 HOH HOH A . B 2 HOH 70 270 54 HOH HOH A . B 2 HOH 71 271 67 HOH HOH A . B 2 HOH 72 272 41 HOH HOH A . B 2 HOH 73 273 83 HOH HOH A . B 2 HOH 74 274 66 HOH HOH A . B 2 HOH 75 275 62 HOH HOH A . B 2 HOH 76 276 55 HOH HOH A . B 2 HOH 77 277 68 HOH HOH A . B 2 HOH 78 278 78 HOH HOH A . B 2 HOH 79 279 63 HOH HOH A . B 2 HOH 80 280 57 HOH HOH A . B 2 HOH 81 281 75 HOH HOH A . B 2 HOH 82 282 56 HOH HOH A . B 2 HOH 83 283 48 HOH HOH A . B 2 HOH 84 284 84 HOH HOH A . B 2 HOH 85 285 64 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 6570 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 281 ? B HOH . 2 1 A HOH 285 ? B HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-06-09 2 'Structure model' 1 1 2021-07-21 3 'Structure model' 1 2 2021-09-15 4 'Structure model' 1 3 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author 5 3 'Structure model' database_2 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond 8 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.journal_id_CSD' 3 2 'Structure model' '_citation.journal_id_ISSN' 4 2 'Structure model' '_citation.page_first' 5 2 'Structure model' '_citation.page_last' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 3 'Structure model' '_citation.journal_volume' 11 3 'Structure model' '_citation_author.identifier_ORCID' 12 3 'Structure model' '_database_2.pdbx_DOI' 13 3 'Structure model' '_database_2.pdbx_database_accession' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y+1/2,x+1/2,z+3/4 3 y+1/2,-x+1/2,z+1/4 4 x+1/2,-y+1/2,-z+1/4 5 -x+1/2,y+1/2,-z+3/4 6 -x,-y,z+1/2 7 y,x,-z 8 -y,-x,-z+1/2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 7.1.002 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.18.2_3874 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? iMOSFLM ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 72 ? CG ? A ARG 72 CG 2 1 Y 1 A ARG 72 ? CD ? A ARG 72 CD 3 1 Y 1 A ARG 72 ? NE ? A ARG 72 NE 4 1 Y 1 A ARG 72 ? CZ ? A ARG 72 CZ 5 1 Y 1 A ARG 72 ? NH1 ? A ARG 72 NH1 6 1 Y 1 A ARG 72 ? NH2 ? A ARG 72 NH2 7 1 Y 1 A ARG 76 ? CG ? A ARG 76 CG 8 1 Y 1 A ARG 76 ? CD ? A ARG 76 CD 9 1 Y 1 A ARG 76 ? NE ? A ARG 76 NE 10 1 Y 1 A ARG 76 ? CZ ? A ARG 76 CZ 11 1 Y 1 A ARG 76 ? NH1 ? A ARG 76 NH1 12 1 Y 1 A ARG 76 ? NH2 ? A ARG 76 NH2 13 1 Y 1 A HIS 80 ? CG ? A HIS 80 CG 14 1 Y 1 A HIS 80 ? ND1 ? A HIS 80 ND1 15 1 Y 1 A HIS 80 ? CD2 ? A HIS 80 CD2 16 1 Y 1 A HIS 80 ? CE1 ? A HIS 80 CE1 17 1 Y 1 A HIS 80 ? NE2 ? A HIS 80 NE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A HIS 2 ? A HIS 2 3 1 Y 1 A HIS 3 ? A HIS 3 4 1 Y 1 A HIS 4 ? A HIS 4 5 1 Y 1 A HIS 5 ? A HIS 5 6 1 Y 1 A HIS 6 ? A HIS 6 7 1 Y 1 A HIS 7 ? A HIS 7 8 1 Y 1 A ALA 8 ? A ALA 8 9 1 Y 1 A THR 77 ? A THR 77 10 1 Y 1 A ALA 78 ? A ALA 78 11 1 Y 1 A PRO 79 ? A PRO 79 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 CYS N N N N 57 CYS CA C N R 58 CYS C C N N 59 CYS O O N N 60 CYS CB C N N 61 CYS SG S N N 62 CYS OXT O N N 63 CYS H H N N 64 CYS H2 H N N 65 CYS HA H N N 66 CYS HB2 H N N 67 CYS HB3 H N N 68 CYS HG H N N 69 CYS HXT H N N 70 GLN N N N N 71 GLN CA C N S 72 GLN C C N N 73 GLN O O N N 74 GLN CB C N N 75 GLN CG C N N 76 GLN CD C N N 77 GLN OE1 O N N 78 GLN NE2 N N N 79 GLN OXT O N N 80 GLN H H N N 81 GLN H2 H N N 82 GLN HA H N N 83 GLN HB2 H N N 84 GLN HB3 H N N 85 GLN HG2 H N N 86 GLN HG3 H N N 87 GLN HE21 H N N 88 GLN HE22 H N N 89 GLN HXT H N N 90 GLU N N N N 91 GLU CA C N S 92 GLU C C N N 93 GLU O O N N 94 GLU CB C N N 95 GLU CG C N N 96 GLU CD C N N 97 GLU OE1 O N N 98 GLU OE2 O N N 99 GLU OXT O N N 100 GLU H H N N 101 GLU H2 H N N 102 GLU HA H N N 103 GLU HB2 H N N 104 GLU HB3 H N N 105 GLU HG2 H N N 106 GLU HG3 H N N 107 GLU HE2 H N N 108 GLU HXT H N N 109 GLY N N N N 110 GLY CA C N N 111 GLY C C N N 112 GLY O O N N 113 GLY OXT O N N 114 GLY H H N N 115 GLY H2 H N N 116 GLY HA2 H N N 117 GLY HA3 H N N 118 GLY HXT H N N 119 HIS N N N N 120 HIS CA C N S 121 HIS C C N N 122 HIS O O N N 123 HIS CB C N N 124 HIS CG C Y N 125 HIS ND1 N Y N 126 HIS CD2 C Y N 127 HIS CE1 C Y N 128 HIS NE2 N Y N 129 HIS OXT O N N 130 HIS H H N N 131 HIS H2 H N N 132 HIS HA H N N 133 HIS HB2 H N N 134 HIS HB3 H N N 135 HIS HD1 H N N 136 HIS HD2 H N N 137 HIS HE1 H N N 138 HIS HE2 H N N 139 HIS HXT H N N 140 HOH O O N N 141 HOH H1 H N N 142 HOH H2 H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TYR N N N N 304 TYR CA C N S 305 TYR C C N N 306 TYR O O N N 307 TYR CB C N N 308 TYR CG C Y N 309 TYR CD1 C Y N 310 TYR CD2 C Y N 311 TYR CE1 C Y N 312 TYR CE2 C Y N 313 TYR CZ C Y N 314 TYR OH O N N 315 TYR OXT O N N 316 TYR H H N N 317 TYR H2 H N N 318 TYR HA H N N 319 TYR HB2 H N N 320 TYR HB3 H N N 321 TYR HD1 H N N 322 TYR HD2 H N N 323 TYR HE1 H N N 324 TYR HE2 H N N 325 TYR HH H N N 326 TYR HXT H N N 327 VAL N N N N 328 VAL CA C N S 329 VAL C C N N 330 VAL O O N N 331 VAL CB C N N 332 VAL CG1 C N N 333 VAL CG2 C N N 334 VAL OXT O N N 335 VAL H H N N 336 VAL H2 H N N 337 VAL HA H N N 338 VAL HB H N N 339 VAL HG11 H N N 340 VAL HG12 H N N 341 VAL HG13 H N N 342 VAL HG21 H N N 343 VAL HG22 H N N 344 VAL HG23 H N N 345 VAL HXT H N N 346 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 CYS N CA sing N N 54 CYS N H sing N N 55 CYS N H2 sing N N 56 CYS CA C sing N N 57 CYS CA CB sing N N 58 CYS CA HA sing N N 59 CYS C O doub N N 60 CYS C OXT sing N N 61 CYS CB SG sing N N 62 CYS CB HB2 sing N N 63 CYS CB HB3 sing N N 64 CYS SG HG sing N N 65 CYS OXT HXT sing N N 66 GLN N CA sing N N 67 GLN N H sing N N 68 GLN N H2 sing N N 69 GLN CA C sing N N 70 GLN CA CB sing N N 71 GLN CA HA sing N N 72 GLN C O doub N N 73 GLN C OXT sing N N 74 GLN CB CG sing N N 75 GLN CB HB2 sing N N 76 GLN CB HB3 sing N N 77 GLN CG CD sing N N 78 GLN CG HG2 sing N N 79 GLN CG HG3 sing N N 80 GLN CD OE1 doub N N 81 GLN CD NE2 sing N N 82 GLN NE2 HE21 sing N N 83 GLN NE2 HE22 sing N N 84 GLN OXT HXT sing N N 85 GLU N CA sing N N 86 GLU N H sing N N 87 GLU N H2 sing N N 88 GLU CA C sing N N 89 GLU CA CB sing N N 90 GLU CA HA sing N N 91 GLU C O doub N N 92 GLU C OXT sing N N 93 GLU CB CG sing N N 94 GLU CB HB2 sing N N 95 GLU CB HB3 sing N N 96 GLU CG CD sing N N 97 GLU CG HG2 sing N N 98 GLU CG HG3 sing N N 99 GLU CD OE1 doub N N 100 GLU CD OE2 sing N N 101 GLU OE2 HE2 sing N N 102 GLU OXT HXT sing N N 103 GLY N CA sing N N 104 GLY N H sing N N 105 GLY N H2 sing N N 106 GLY CA C sing N N 107 GLY CA HA2 sing N N 108 GLY CA HA3 sing N N 109 GLY C O doub N N 110 GLY C OXT sing N N 111 GLY OXT HXT sing N N 112 HIS N CA sing N N 113 HIS N H sing N N 114 HIS N H2 sing N N 115 HIS CA C sing N N 116 HIS CA CB sing N N 117 HIS CA HA sing N N 118 HIS C O doub N N 119 HIS C OXT sing N N 120 HIS CB CG sing N N 121 HIS CB HB2 sing N N 122 HIS CB HB3 sing N N 123 HIS CG ND1 sing Y N 124 HIS CG CD2 doub Y N 125 HIS ND1 CE1 doub Y N 126 HIS ND1 HD1 sing N N 127 HIS CD2 NE2 sing Y N 128 HIS CD2 HD2 sing N N 129 HIS CE1 NE2 sing Y N 130 HIS CE1 HE1 sing N N 131 HIS NE2 HE2 sing N N 132 HIS OXT HXT sing N N 133 HOH O H1 sing N N 134 HOH O H2 sing N N 135 ILE N CA sing N N 136 ILE N H sing N N 137 ILE N H2 sing N N 138 ILE CA C sing N N 139 ILE CA CB sing N N 140 ILE CA HA sing N N 141 ILE C O doub N N 142 ILE C OXT sing N N 143 ILE CB CG1 sing N N 144 ILE CB CG2 sing N N 145 ILE CB HB sing N N 146 ILE CG1 CD1 sing N N 147 ILE CG1 HG12 sing N N 148 ILE CG1 HG13 sing N N 149 ILE CG2 HG21 sing N N 150 ILE CG2 HG22 sing N N 151 ILE CG2 HG23 sing N N 152 ILE CD1 HD11 sing N N 153 ILE CD1 HD12 sing N N 154 ILE CD1 HD13 sing N N 155 ILE OXT HXT sing N N 156 LEU N CA sing N N 157 LEU N H sing N N 158 LEU N H2 sing N N 159 LEU CA C sing N N 160 LEU CA CB sing N N 161 LEU CA HA sing N N 162 LEU C O doub N N 163 LEU C OXT sing N N 164 LEU CB CG sing N N 165 LEU CB HB2 sing N N 166 LEU CB HB3 sing N N 167 LEU CG CD1 sing N N 168 LEU CG CD2 sing N N 169 LEU CG HG sing N N 170 LEU CD1 HD11 sing N N 171 LEU CD1 HD12 sing N N 172 LEU CD1 HD13 sing N N 173 LEU CD2 HD21 sing N N 174 LEU CD2 HD22 sing N N 175 LEU CD2 HD23 sing N N 176 LEU OXT HXT sing N N 177 LYS N CA sing N N 178 LYS N H sing N N 179 LYS N H2 sing N N 180 LYS CA C sing N N 181 LYS CA CB sing N N 182 LYS CA HA sing N N 183 LYS C O doub N N 184 LYS C OXT sing N N 185 LYS CB CG sing N N 186 LYS CB HB2 sing N N 187 LYS CB HB3 sing N N 188 LYS CG CD sing N N 189 LYS CG HG2 sing N N 190 LYS CG HG3 sing N N 191 LYS CD CE sing N N 192 LYS CD HD2 sing N N 193 LYS CD HD3 sing N N 194 LYS CE NZ sing N N 195 LYS CE HE2 sing N N 196 LYS CE HE3 sing N N 197 LYS NZ HZ1 sing N N 198 LYS NZ HZ2 sing N N 199 LYS NZ HZ3 sing N N 200 LYS OXT HXT sing N N 201 MET N CA sing N N 202 MET N H sing N N 203 MET N H2 sing N N 204 MET CA C sing N N 205 MET CA CB sing N N 206 MET CA HA sing N N 207 MET C O doub N N 208 MET C OXT sing N N 209 MET CB CG sing N N 210 MET CB HB2 sing N N 211 MET CB HB3 sing N N 212 MET CG SD sing N N 213 MET CG HG2 sing N N 214 MET CG HG3 sing N N 215 MET SD CE sing N N 216 MET CE HE1 sing N N 217 MET CE HE2 sing N N 218 MET CE HE3 sing N N 219 MET OXT HXT sing N N 220 PHE N CA sing N N 221 PHE N H sing N N 222 PHE N H2 sing N N 223 PHE CA C sing N N 224 PHE CA CB sing N N 225 PHE CA HA sing N N 226 PHE C O doub N N 227 PHE C OXT sing N N 228 PHE CB CG sing N N 229 PHE CB HB2 sing N N 230 PHE CB HB3 sing N N 231 PHE CG CD1 doub Y N 232 PHE CG CD2 sing Y N 233 PHE CD1 CE1 sing Y N 234 PHE CD1 HD1 sing N N 235 PHE CD2 CE2 doub Y N 236 PHE CD2 HD2 sing N N 237 PHE CE1 CZ doub Y N 238 PHE CE1 HE1 sing N N 239 PHE CE2 CZ sing Y N 240 PHE CE2 HE2 sing N N 241 PHE CZ HZ sing N N 242 PHE OXT HXT sing N N 243 PRO N CA sing N N 244 PRO N CD sing N N 245 PRO N H sing N N 246 PRO CA C sing N N 247 PRO CA CB sing N N 248 PRO CA HA sing N N 249 PRO C O doub N N 250 PRO C OXT sing N N 251 PRO CB CG sing N N 252 PRO CB HB2 sing N N 253 PRO CB HB3 sing N N 254 PRO CG CD sing N N 255 PRO CG HG2 sing N N 256 PRO CG HG3 sing N N 257 PRO CD HD2 sing N N 258 PRO CD HD3 sing N N 259 PRO OXT HXT sing N N 260 SER N CA sing N N 261 SER N H sing N N 262 SER N H2 sing N N 263 SER CA C sing N N 264 SER CA CB sing N N 265 SER CA HA sing N N 266 SER C O doub N N 267 SER C OXT sing N N 268 SER CB OG sing N N 269 SER CB HB2 sing N N 270 SER CB HB3 sing N N 271 SER OG HG sing N N 272 SER OXT HXT sing N N 273 THR N CA sing N N 274 THR N H sing N N 275 THR N H2 sing N N 276 THR CA C sing N N 277 THR CA CB sing N N 278 THR CA HA sing N N 279 THR C O doub N N 280 THR C OXT sing N N 281 THR CB OG1 sing N N 282 THR CB CG2 sing N N 283 THR CB HB sing N N 284 THR OG1 HG1 sing N N 285 THR CG2 HG21 sing N N 286 THR CG2 HG22 sing N N 287 THR CG2 HG23 sing N N 288 THR OXT HXT sing N N 289 TYR N CA sing N N 290 TYR N H sing N N 291 TYR N H2 sing N N 292 TYR CA C sing N N 293 TYR CA CB sing N N 294 TYR CA HA sing N N 295 TYR C O doub N N 296 TYR C OXT sing N N 297 TYR CB CG sing N N 298 TYR CB HB2 sing N N 299 TYR CB HB3 sing N N 300 TYR CG CD1 doub Y N 301 TYR CG CD2 sing Y N 302 TYR CD1 CE1 sing Y N 303 TYR CD1 HD1 sing N N 304 TYR CD2 CE2 doub Y N 305 TYR CD2 HD2 sing N N 306 TYR CE1 CZ doub Y N 307 TYR CE1 HE1 sing N N 308 TYR CE2 CZ sing Y N 309 TYR CE2 HE2 sing N N 310 TYR CZ OH sing N N 311 TYR OH HH sing N N 312 TYR OXT HXT sing N N 313 VAL N CA sing N N 314 VAL N H sing N N 315 VAL N H2 sing N N 316 VAL CA C sing N N 317 VAL CA CB sing N N 318 VAL CA HA sing N N 319 VAL C O doub N N 320 VAL C OXT sing N N 321 VAL CB CG1 sing N N 322 VAL CB CG2 sing N N 323 VAL CB HB sing N N 324 VAL CG1 HG11 sing N N 325 VAL CG1 HG12 sing N N 326 VAL CG1 HG13 sing N N 327 VAL CG2 HG21 sing N N 328 VAL CG2 HG22 sing N N 329 VAL CG2 HG23 sing N N 330 VAL OXT HXT sing N N 331 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Natural Science Foundation of China (NSFC)' China 81971936 1 'National Natural Science Foundation of China (NSFC)' China 82041004 2 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2HSX _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'P 43 21 2' _space_group.name_Hall 'P 4nw 2abw' _space_group.IT_number 96 _space_group.crystal_system tetragonal _space_group.id 1 #