data_7FIC # _entry.id 7FIC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7FIC pdb_00007fic 10.2210/pdb7fic/pdb WWPDB D_1300023587 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7FIC _pdbx_database_status.recvd_initial_deposition_date 2021-07-31 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Craven, G.B.' 1 0000-0003-3414-8348 'Wan, X.B.' 2 0000-0003-4288-9074 'Taunton, J.' 3 0000-0002-9627-5898 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Nat.Chem.Biol. _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1552-4469 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 18 _citation.language ? _citation.page_first 934 _citation.page_last 941 _citation.title 'Reversible lysine-targeted probes reveal residence time-based kinase selectivity.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41589-022-01019-1 _citation.pdbx_database_id_PubMed 35590003 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yang, T.' 1 ? primary 'Cuesta, A.' 2 ? primary 'Wan, X.' 3 ? primary 'Craven, G.B.' 4 ? primary 'Hirakawa, B.' 5 ? primary 'Khamphavong, P.' 6 ? primary 'May, J.R.' 7 ? primary 'Kath, J.C.' 8 ? primary 'Lapek Jr., J.D.' 9 ? primary 'Niessen, S.' 10 ? primary 'Burlingame, A.L.' 11 ? primary 'Carelli, J.D.' 12 ? primary 'Taunton, J.' 13 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7FIC _cell.details ? _cell.formula_units_Z ? _cell.length_a 87.950 _cell.length_a_esd ? _cell.length_b 87.950 _cell.length_b_esd ? _cell.length_c 76.824 _cell.length_c_esd ? _cell.volume 514634.901 _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7FIC _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ;P 32 2" ; _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Aurora kinase A' 30718.256 1 2.7.11.1 C290A ? ? 2 non-polymer syn ;6-[(5-cyclopropyl-1~{H}-pyrazol-3-yl)amino]-2-[4-[(3-methyl-4-oxidanyl-phenyl)methyl]piperazin-1-yl]-~{N}-prop-2-ynyl-pyrimidine-4-carboxamide ; 486.569 1 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 3 ? ? ? ? 4 water nat water 18.015 6 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Aurora 2,Aurora/IPL1-related kinase 1,ARK-1,Aurora-related kinase 1,hARK1,Breast tumor-amplified kinase,Serine/threonine-protein kinase 15,Serine/threonine-protein kinase 6,Serine/threonine-protein kinase aurora-A ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;QWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRV YLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRR TTLAGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRLLKH NPSQRPMLREVLEHPWITANSSKPS ; _entity_poly.pdbx_seq_one_letter_code_can ;QWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRV YLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRR TTLAGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRLLKH NPSQRPMLREVLEHPWITANSSKPS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLN n 1 2 TRP n 1 3 ALA n 1 4 LEU n 1 5 GLU n 1 6 ASP n 1 7 PHE n 1 8 GLU n 1 9 ILE n 1 10 GLY n 1 11 ARG n 1 12 PRO n 1 13 LEU n 1 14 GLY n 1 15 LYS n 1 16 GLY n 1 17 LYS n 1 18 PHE n 1 19 GLY n 1 20 ASN n 1 21 VAL n 1 22 TYR n 1 23 LEU n 1 24 ALA n 1 25 ARG n 1 26 GLU n 1 27 LYS n 1 28 GLN n 1 29 SER n 1 30 LYS n 1 31 PHE n 1 32 ILE n 1 33 LEU n 1 34 ALA n 1 35 LEU n 1 36 LYS n 1 37 VAL n 1 38 LEU n 1 39 PHE n 1 40 LYS n 1 41 ALA n 1 42 GLN n 1 43 LEU n 1 44 GLU n 1 45 LYS n 1 46 ALA n 1 47 GLY n 1 48 VAL n 1 49 GLU n 1 50 HIS n 1 51 GLN n 1 52 LEU n 1 53 ARG n 1 54 ARG n 1 55 GLU n 1 56 VAL n 1 57 GLU n 1 58 ILE n 1 59 GLN n 1 60 SER n 1 61 HIS n 1 62 LEU n 1 63 ARG n 1 64 HIS n 1 65 PRO n 1 66 ASN n 1 67 ILE n 1 68 LEU n 1 69 ARG n 1 70 LEU n 1 71 TYR n 1 72 GLY n 1 73 TYR n 1 74 PHE n 1 75 HIS n 1 76 ASP n 1 77 ALA n 1 78 THR n 1 79 ARG n 1 80 VAL n 1 81 TYR n 1 82 LEU n 1 83 ILE n 1 84 LEU n 1 85 GLU n 1 86 TYR n 1 87 ALA n 1 88 PRO n 1 89 LEU n 1 90 GLY n 1 91 THR n 1 92 VAL n 1 93 TYR n 1 94 ARG n 1 95 GLU n 1 96 LEU n 1 97 GLN n 1 98 LYS n 1 99 LEU n 1 100 SER n 1 101 LYS n 1 102 PHE n 1 103 ASP n 1 104 GLU n 1 105 GLN n 1 106 ARG n 1 107 THR n 1 108 ALA n 1 109 THR n 1 110 TYR n 1 111 ILE n 1 112 THR n 1 113 GLU n 1 114 LEU n 1 115 ALA n 1 116 ASN n 1 117 ALA n 1 118 LEU n 1 119 SER n 1 120 TYR n 1 121 CYS n 1 122 HIS n 1 123 SER n 1 124 LYS n 1 125 ARG n 1 126 VAL n 1 127 ILE n 1 128 HIS n 1 129 ARG n 1 130 ASP n 1 131 ILE n 1 132 LYS n 1 133 PRO n 1 134 GLU n 1 135 ASN n 1 136 LEU n 1 137 LEU n 1 138 LEU n 1 139 GLY n 1 140 SER n 1 141 ALA n 1 142 GLY n 1 143 GLU n 1 144 LEU n 1 145 LYS n 1 146 ILE n 1 147 ALA n 1 148 ASP n 1 149 PHE n 1 150 GLY n 1 151 TRP n 1 152 SER n 1 153 VAL n 1 154 HIS n 1 155 ALA n 1 156 PRO n 1 157 SER n 1 158 SER n 1 159 ARG n 1 160 ARG n 1 161 THR n 1 162 THR n 1 163 LEU n 1 164 ALA n 1 165 GLY n 1 166 THR n 1 167 LEU n 1 168 ASP n 1 169 TYR n 1 170 LEU n 1 171 PRO n 1 172 PRO n 1 173 GLU n 1 174 MET n 1 175 ILE n 1 176 GLU n 1 177 GLY n 1 178 ARG n 1 179 MET n 1 180 HIS n 1 181 ASP n 1 182 GLU n 1 183 LYS n 1 184 VAL n 1 185 ASP n 1 186 LEU n 1 187 TRP n 1 188 SER n 1 189 LEU n 1 190 GLY n 1 191 VAL n 1 192 LEU n 1 193 CYS n 1 194 TYR n 1 195 GLU n 1 196 PHE n 1 197 LEU n 1 198 VAL n 1 199 GLY n 1 200 LYS n 1 201 PRO n 1 202 PRO n 1 203 PHE n 1 204 GLU n 1 205 ALA n 1 206 ASN n 1 207 THR n 1 208 TYR n 1 209 GLN n 1 210 GLU n 1 211 THR n 1 212 TYR n 1 213 LYS n 1 214 ARG n 1 215 ILE n 1 216 SER n 1 217 ARG n 1 218 VAL n 1 219 GLU n 1 220 PHE n 1 221 THR n 1 222 PHE n 1 223 PRO n 1 224 ASP n 1 225 PHE n 1 226 VAL n 1 227 THR n 1 228 GLU n 1 229 GLY n 1 230 ALA n 1 231 ARG n 1 232 ASP n 1 233 LEU n 1 234 ILE n 1 235 SER n 1 236 ARG n 1 237 LEU n 1 238 LEU n 1 239 LYS n 1 240 HIS n 1 241 ASN n 1 242 PRO n 1 243 SER n 1 244 GLN n 1 245 ARG n 1 246 PRO n 1 247 MET n 1 248 LEU n 1 249 ARG n 1 250 GLU n 1 251 VAL n 1 252 LEU n 1 253 GLU n 1 254 HIS n 1 255 PRO n 1 256 TRP n 1 257 ILE n 1 258 THR n 1 259 ALA n 1 260 ASN n 1 261 SER n 1 262 SER n 1 263 LYS n 1 264 PRO n 1 265 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 265 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'AURKA, AIK, AIRK1, ARK1, AURA, AYK1, BTAK, IAK1, STK15, STK6' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code AURKA_HUMAN _struct_ref.pdbx_db_accession O14965 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;QWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRV YLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRR TTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRLLKH NPSQRPMLREVLEHPWITANSSKPS ; _struct_ref.pdbx_align_begin 127 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7FIC _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 265 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O14965 _struct_ref_seq.db_align_beg 127 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 391 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 127 _struct_ref_seq.pdbx_auth_seq_align_end 391 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 7FIC _struct_ref_seq_dif.mon_id ALA _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 164 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code O14965 _struct_ref_seq_dif.db_mon_id CYS _struct_ref_seq_dif.pdbx_seq_db_seq_num 290 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 290 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 5YZ non-polymer . ;6-[(5-cyclopropyl-1~{H}-pyrazol-3-yl)amino]-2-[4-[(3-methyl-4-oxidanyl-phenyl)methyl]piperazin-1-yl]-~{N}-prop-2-ynyl-pyrimidine-4-carboxamide ; ? 'C26 H30 N8 O2' 486.569 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7FIC _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.88 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 57.34 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M lithium sulfate, 0.1 M BIS-TRIS pH 5.5, 25% w/v PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 80 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 S 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-03-27 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.11685 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 8.3.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.11685 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 8.3.1 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate 85.49 _reflns.entry_id 7FIC _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.32 _reflns.d_resolution_low 76.21 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 15223 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 19.5 _reflns.pdbx_Rmerge_I_obs 0.049 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 25.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.050 _reflns.pdbx_Rpim_I_all 0.011 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.0 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.32 _reflns_shell.d_res_low 2.403 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1516 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 2.109 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 2.163 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.642 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 90.24 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7FIC _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.32 _refine.ls_d_res_low 76.17 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 15219 _refine.ls_number_reflns_R_free 779 _refine.ls_number_reflns_R_work 27281 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.84 _refine.ls_percent_reflns_R_free 5.13 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2375 _refine.ls_R_factor_R_free 0.2740 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2356 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4CEG _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 43.6528 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4137 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.32 _refine_hist.d_res_low 76.17 _refine_hist.number_atoms_solvent 6 _refine_hist.number_atoms_total 2024 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1979 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 39 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0098 ? 2081 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.3049 ? 2832 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0678 ? 310 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0114 ? 361 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 17.5148 ? 746 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.32 2.40 . . 116 2509 99.51 . . . 0.3294 . 0.3601 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.40 2.48 . . 116 2485 99.69 . . . 0.3582 . 0.3417 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.48 2.58 . . 94 2558 100.00 . . . 0.4989 . 0.4149 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.58 2.70 . . 110 2453 99.84 . . . 0.3882 . 0.3744 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.70 2.84 . . 164 2486 100.00 . . . 0.3910 . 0.3391 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.84 3.02 . . 190 2396 99.61 . . . 0.3275 . 0.3331 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.02 3.25 . . 150 2469 100.00 . . . 0.3473 . 0.3448 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.25 3.57 . . 154 2420 99.69 . . . 0.3197 . 0.2967 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.58 4.10 . . 142 2502 100.00 . . . 0.2950 . 0.2383 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.10 5.16 . . 132 2498 100.00 . . . 0.2086 . 0.1876 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.16 76.17 . . 107 2505 99.89 . . . 0.2312 . 0.1820 . . . . . . . . . . . # _struct.entry_id 7FIC _struct.title 'Reversible lysine-targeted probes reveal residence time-based kinase selectivity in vivo' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7FIC _struct_keywords.text 'Reversible lysine-targeted inhibitors; kinase, CELL CYCLE' _struct_keywords.pdbx_keywords 'CELL CYCLE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 3 ? GLU A 5 ? ALA A 129 GLU A 131 5 ? 3 HELX_P HELX_P2 AA2 LYS A 40 ? ALA A 46 ? LYS A 166 ALA A 172 1 ? 7 HELX_P HELX_P3 AA3 VAL A 48 ? HIS A 61 ? VAL A 174 HIS A 187 1 ? 14 HELX_P HELX_P4 AA4 THR A 91 ? SER A 100 ? THR A 217 SER A 226 1 ? 10 HELX_P HELX_P5 AA5 ASP A 103 ? LYS A 124 ? ASP A 229 LYS A 250 1 ? 22 HELX_P HELX_P6 AA6 LYS A 132 ? GLU A 134 ? LYS A 258 GLU A 260 5 ? 3 HELX_P HELX_P7 AA7 THR A 166 ? LEU A 170 ? THR A 292 LEU A 296 5 ? 5 HELX_P HELX_P8 AA8 PRO A 171 ? GLU A 176 ? PRO A 297 GLU A 302 1 ? 6 HELX_P HELX_P9 AA9 LYS A 183 ? GLY A 199 ? LYS A 309 GLY A 325 1 ? 17 HELX_P HELX_P10 AB1 THR A 207 ? ARG A 217 ? THR A 333 ARG A 343 1 ? 11 HELX_P HELX_P11 AB2 THR A 227 ? LEU A 238 ? THR A 353 LEU A 364 1 ? 12 HELX_P HELX_P12 AB3 ASN A 241 ? ARG A 245 ? ASN A 367 ARG A 371 5 ? 5 HELX_P HELX_P13 AB4 MET A 247 ? GLU A 253 ? MET A 373 GLU A 379 1 ? 7 HELX_P HELX_P14 AB5 HIS A 254 ? SER A 261 ? HIS A 380 SER A 387 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag none _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id LYS _struct_conn.ptnr1_label_seq_id 36 _struct_conn.ptnr1_label_atom_id NZ _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id 5YZ _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C26 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id LYS _struct_conn.ptnr1_auth_seq_id 162 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id 5YZ _struct_conn.ptnr2_auth_seq_id 401 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.484 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 7 ? LYS A 15 ? PHE A 133 LYS A 141 AA1 2 GLY A 19 ? GLU A 26 ? GLY A 145 GLU A 152 AA1 3 ILE A 32 ? PHE A 39 ? ILE A 158 PHE A 165 AA1 4 ARG A 79 ? LEU A 84 ? ARG A 205 LEU A 210 AA1 5 LEU A 70 ? HIS A 75 ? LEU A 196 HIS A 201 AA2 1 LEU A 136 ? LEU A 138 ? LEU A 262 LEU A 264 AA2 2 LEU A 144 ? ILE A 146 ? LEU A 270 ILE A 272 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 10 ? N GLY A 136 O LEU A 23 ? O LEU A 149 AA1 2 3 N ALA A 24 ? N ALA A 150 O LEU A 33 ? O LEU A 159 AA1 3 4 N LEU A 38 ? N LEU A 164 O VAL A 80 ? O VAL A 206 AA1 4 5 O ILE A 83 ? O ILE A 209 N GLY A 72 ? N GLY A 198 AA2 1 2 N LEU A 137 ? N LEU A 263 O LYS A 145 ? O LYS A 271 # _atom_sites.entry_id 7FIC _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.011370 _atom_sites.fract_transf_matrix[1][2] 0.006565 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013129 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013017 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? CL ? ? 9.50761 7.44341 ? ? 1.04373 23.83732 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLN 1 127 127 GLN GLN A . n A 1 2 TRP 2 128 128 TRP TRP A . n A 1 3 ALA 3 129 129 ALA ALA A . n A 1 4 LEU 4 130 130 LEU LEU A . n A 1 5 GLU 5 131 131 GLU GLU A . n A 1 6 ASP 6 132 132 ASP ASP A . n A 1 7 PHE 7 133 133 PHE PHE A . n A 1 8 GLU 8 134 134 GLU GLU A . n A 1 9 ILE 9 135 135 ILE ILE A . n A 1 10 GLY 10 136 136 GLY GLY A . n A 1 11 ARG 11 137 137 ARG ARG A . n A 1 12 PRO 12 138 138 PRO PRO A . n A 1 13 LEU 13 139 139 LEU LEU A . n A 1 14 GLY 14 140 140 GLY GLY A . n A 1 15 LYS 15 141 141 LYS LYS A . n A 1 16 GLY 16 142 142 GLY GLY A . n A 1 17 LYS 17 143 143 LYS LYS A . n A 1 18 PHE 18 144 144 PHE PHE A . n A 1 19 GLY 19 145 145 GLY GLY A . n A 1 20 ASN 20 146 146 ASN ASN A . n A 1 21 VAL 21 147 147 VAL VAL A . n A 1 22 TYR 22 148 148 TYR TYR A . n A 1 23 LEU 23 149 149 LEU LEU A . n A 1 24 ALA 24 150 150 ALA ALA A . n A 1 25 ARG 25 151 151 ARG ARG A . n A 1 26 GLU 26 152 152 GLU GLU A . n A 1 27 LYS 27 153 153 LYS LYS A . n A 1 28 GLN 28 154 154 GLN GLN A . n A 1 29 SER 29 155 155 SER SER A . n A 1 30 LYS 30 156 156 LYS LYS A . n A 1 31 PHE 31 157 157 PHE PHE A . n A 1 32 ILE 32 158 158 ILE ILE A . n A 1 33 LEU 33 159 159 LEU LEU A . n A 1 34 ALA 34 160 160 ALA ALA A . n A 1 35 LEU 35 161 161 LEU LEU A . n A 1 36 LYS 36 162 162 LYS LYS A . n A 1 37 VAL 37 163 163 VAL VAL A . n A 1 38 LEU 38 164 164 LEU LEU A . n A 1 39 PHE 39 165 165 PHE PHE A . n A 1 40 LYS 40 166 166 LYS LYS A . n A 1 41 ALA 41 167 167 ALA ALA A . n A 1 42 GLN 42 168 168 GLN GLN A . n A 1 43 LEU 43 169 169 LEU LEU A . n A 1 44 GLU 44 170 170 GLU GLU A . n A 1 45 LYS 45 171 171 LYS LYS A . n A 1 46 ALA 46 172 172 ALA ALA A . n A 1 47 GLY 47 173 173 GLY GLY A . n A 1 48 VAL 48 174 174 VAL VAL A . n A 1 49 GLU 49 175 175 GLU GLU A . n A 1 50 HIS 50 176 176 HIS HIS A . n A 1 51 GLN 51 177 177 GLN GLN A . n A 1 52 LEU 52 178 178 LEU LEU A . n A 1 53 ARG 53 179 179 ARG ARG A . n A 1 54 ARG 54 180 180 ARG ARG A . n A 1 55 GLU 55 181 181 GLU GLU A . n A 1 56 VAL 56 182 182 VAL VAL A . n A 1 57 GLU 57 183 183 GLU GLU A . n A 1 58 ILE 58 184 184 ILE ILE A . n A 1 59 GLN 59 185 185 GLN GLN A . n A 1 60 SER 60 186 186 SER SER A . n A 1 61 HIS 61 187 187 HIS HIS A . n A 1 62 LEU 62 188 188 LEU LEU A . n A 1 63 ARG 63 189 189 ARG ARG A . n A 1 64 HIS 64 190 190 HIS HIS A . n A 1 65 PRO 65 191 191 PRO PRO A . n A 1 66 ASN 66 192 192 ASN ASN A . n A 1 67 ILE 67 193 193 ILE ILE A . n A 1 68 LEU 68 194 194 LEU LEU A . n A 1 69 ARG 69 195 195 ARG ARG A . n A 1 70 LEU 70 196 196 LEU LEU A . n A 1 71 TYR 71 197 197 TYR TYR A . n A 1 72 GLY 72 198 198 GLY GLY A . n A 1 73 TYR 73 199 199 TYR TYR A . n A 1 74 PHE 74 200 200 PHE PHE A . n A 1 75 HIS 75 201 201 HIS HIS A . n A 1 76 ASP 76 202 202 ASP ASP A . n A 1 77 ALA 77 203 203 ALA ALA A . n A 1 78 THR 78 204 204 THR THR A . n A 1 79 ARG 79 205 205 ARG ARG A . n A 1 80 VAL 80 206 206 VAL VAL A . n A 1 81 TYR 81 207 207 TYR TYR A . n A 1 82 LEU 82 208 208 LEU LEU A . n A 1 83 ILE 83 209 209 ILE ILE A . n A 1 84 LEU 84 210 210 LEU LEU A . n A 1 85 GLU 85 211 211 GLU GLU A . n A 1 86 TYR 86 212 212 TYR TYR A . n A 1 87 ALA 87 213 213 ALA ALA A . n A 1 88 PRO 88 214 214 PRO PRO A . n A 1 89 LEU 89 215 215 LEU LEU A . n A 1 90 GLY 90 216 216 GLY GLY A . n A 1 91 THR 91 217 217 THR THR A . n A 1 92 VAL 92 218 218 VAL VAL A . n A 1 93 TYR 93 219 219 TYR TYR A . n A 1 94 ARG 94 220 220 ARG ARG A . n A 1 95 GLU 95 221 221 GLU GLU A . n A 1 96 LEU 96 222 222 LEU LEU A . n A 1 97 GLN 97 223 223 GLN GLN A . n A 1 98 LYS 98 224 224 LYS LYS A . n A 1 99 LEU 99 225 225 LEU LEU A . n A 1 100 SER 100 226 226 SER SER A . n A 1 101 LYS 101 227 227 LYS LYS A . n A 1 102 PHE 102 228 228 PHE PHE A . n A 1 103 ASP 103 229 229 ASP ASP A . n A 1 104 GLU 104 230 230 GLU GLU A . n A 1 105 GLN 105 231 231 GLN GLN A . n A 1 106 ARG 106 232 232 ARG ARG A . n A 1 107 THR 107 233 233 THR THR A . n A 1 108 ALA 108 234 234 ALA ALA A . n A 1 109 THR 109 235 235 THR THR A . n A 1 110 TYR 110 236 236 TYR TYR A . n A 1 111 ILE 111 237 237 ILE ILE A . n A 1 112 THR 112 238 238 THR THR A . n A 1 113 GLU 113 239 239 GLU GLU A . n A 1 114 LEU 114 240 240 LEU LEU A . n A 1 115 ALA 115 241 241 ALA ALA A . n A 1 116 ASN 116 242 242 ASN ASN A . n A 1 117 ALA 117 243 243 ALA ALA A . n A 1 118 LEU 118 244 244 LEU LEU A . n A 1 119 SER 119 245 245 SER SER A . n A 1 120 TYR 120 246 246 TYR TYR A . n A 1 121 CYS 121 247 247 CYS CYS A . n A 1 122 HIS 122 248 248 HIS HIS A . n A 1 123 SER 123 249 249 SER SER A . n A 1 124 LYS 124 250 250 LYS LYS A . n A 1 125 ARG 125 251 251 ARG ARG A . n A 1 126 VAL 126 252 252 VAL VAL A . n A 1 127 ILE 127 253 253 ILE ILE A . n A 1 128 HIS 128 254 254 HIS HIS A . n A 1 129 ARG 129 255 255 ARG ARG A . n A 1 130 ASP 130 256 256 ASP ASP A . n A 1 131 ILE 131 257 257 ILE ILE A . n A 1 132 LYS 132 258 258 LYS LYS A . n A 1 133 PRO 133 259 259 PRO PRO A . n A 1 134 GLU 134 260 260 GLU GLU A . n A 1 135 ASN 135 261 261 ASN ASN A . n A 1 136 LEU 136 262 262 LEU LEU A . n A 1 137 LEU 137 263 263 LEU LEU A . n A 1 138 LEU 138 264 264 LEU LEU A . n A 1 139 GLY 139 265 265 GLY GLY A . n A 1 140 SER 140 266 266 SER SER A . n A 1 141 ALA 141 267 267 ALA ALA A . n A 1 142 GLY 142 268 268 GLY GLY A . n A 1 143 GLU 143 269 269 GLU GLU A . n A 1 144 LEU 144 270 270 LEU LEU A . n A 1 145 LYS 145 271 271 LYS LYS A . n A 1 146 ILE 146 272 272 ILE ILE A . n A 1 147 ALA 147 273 273 ALA ALA A . n A 1 148 ASP 148 274 274 ASP ASP A . n A 1 149 PHE 149 275 275 PHE PHE A . n A 1 150 GLY 150 276 276 GLY GLY A . n A 1 151 TRP 151 277 277 TRP TRP A . n A 1 152 SER 152 278 278 SER SER A . n A 1 153 VAL 153 279 ? ? ? A . n A 1 154 HIS 154 280 ? ? ? A . n A 1 155 ALA 155 281 ? ? ? A . n A 1 156 PRO 156 282 ? ? ? A . n A 1 157 SER 157 283 ? ? ? A . n A 1 158 SER 158 284 ? ? ? A . n A 1 159 ARG 159 285 ? ? ? A . n A 1 160 ARG 160 286 ? ? ? A . n A 1 161 THR 161 287 ? ? ? A . n A 1 162 THR 162 288 ? ? ? A . n A 1 163 LEU 163 289 ? ? ? A . n A 1 164 ALA 164 290 290 ALA ALA A . n A 1 165 GLY 165 291 291 GLY GLY A . n A 1 166 THR 166 292 292 THR THR A . n A 1 167 LEU 167 293 293 LEU LEU A . n A 1 168 ASP 168 294 294 ASP ASP A . n A 1 169 TYR 169 295 295 TYR TYR A . n A 1 170 LEU 170 296 296 LEU LEU A . n A 1 171 PRO 171 297 297 PRO PRO A . n A 1 172 PRO 172 298 298 PRO PRO A . n A 1 173 GLU 173 299 299 GLU GLU A . n A 1 174 MET 174 300 300 MET MET A . n A 1 175 ILE 175 301 301 ILE ILE A . n A 1 176 GLU 176 302 302 GLU GLU A . n A 1 177 GLY 177 303 303 GLY GLY A . n A 1 178 ARG 178 304 304 ARG ARG A . n A 1 179 MET 179 305 305 MET MET A . n A 1 180 HIS 180 306 306 HIS HIS A . n A 1 181 ASP 181 307 307 ASP ASP A . n A 1 182 GLU 182 308 308 GLU GLU A . n A 1 183 LYS 183 309 309 LYS LYS A . n A 1 184 VAL 184 310 310 VAL VAL A . n A 1 185 ASP 185 311 311 ASP ASP A . n A 1 186 LEU 186 312 312 LEU LEU A . n A 1 187 TRP 187 313 313 TRP TRP A . n A 1 188 SER 188 314 314 SER SER A . n A 1 189 LEU 189 315 315 LEU LEU A . n A 1 190 GLY 190 316 316 GLY GLY A . n A 1 191 VAL 191 317 317 VAL VAL A . n A 1 192 LEU 192 318 318 LEU LEU A . n A 1 193 CYS 193 319 319 CYS CYS A . n A 1 194 TYR 194 320 320 TYR TYR A . n A 1 195 GLU 195 321 321 GLU GLU A . n A 1 196 PHE 196 322 322 PHE PHE A . n A 1 197 LEU 197 323 323 LEU LEU A . n A 1 198 VAL 198 324 324 VAL VAL A . n A 1 199 GLY 199 325 325 GLY GLY A . n A 1 200 LYS 200 326 326 LYS LYS A . n A 1 201 PRO 201 327 327 PRO PRO A . n A 1 202 PRO 202 328 328 PRO PRO A . n A 1 203 PHE 203 329 329 PHE PHE A . n A 1 204 GLU 204 330 330 GLU GLU A . n A 1 205 ALA 205 331 331 ALA ALA A . n A 1 206 ASN 206 332 332 ASN ASN A . n A 1 207 THR 207 333 333 THR THR A . n A 1 208 TYR 208 334 334 TYR TYR A . n A 1 209 GLN 209 335 335 GLN GLN A . n A 1 210 GLU 210 336 336 GLU GLU A . n A 1 211 THR 211 337 337 THR THR A . n A 1 212 TYR 212 338 338 TYR TYR A . n A 1 213 LYS 213 339 339 LYS LYS A . n A 1 214 ARG 214 340 340 ARG ARG A . n A 1 215 ILE 215 341 341 ILE ILE A . n A 1 216 SER 216 342 342 SER SER A . n A 1 217 ARG 217 343 343 ARG ARG A . n A 1 218 VAL 218 344 344 VAL VAL A . n A 1 219 GLU 219 345 345 GLU GLU A . n A 1 220 PHE 220 346 346 PHE PHE A . n A 1 221 THR 221 347 347 THR THR A . n A 1 222 PHE 222 348 348 PHE PHE A . n A 1 223 PRO 223 349 349 PRO PRO A . n A 1 224 ASP 224 350 350 ASP ASP A . n A 1 225 PHE 225 351 351 PHE PHE A . n A 1 226 VAL 226 352 352 VAL VAL A . n A 1 227 THR 227 353 353 THR THR A . n A 1 228 GLU 228 354 354 GLU GLU A . n A 1 229 GLY 229 355 355 GLY GLY A . n A 1 230 ALA 230 356 356 ALA ALA A . n A 1 231 ARG 231 357 357 ARG ARG A . n A 1 232 ASP 232 358 358 ASP ASP A . n A 1 233 LEU 233 359 359 LEU LEU A . n A 1 234 ILE 234 360 360 ILE ILE A . n A 1 235 SER 235 361 361 SER SER A . n A 1 236 ARG 236 362 362 ARG ARG A . n A 1 237 LEU 237 363 363 LEU LEU A . n A 1 238 LEU 238 364 364 LEU LEU A . n A 1 239 LYS 239 365 365 LYS LYS A . n A 1 240 HIS 240 366 366 HIS HIS A . n A 1 241 ASN 241 367 367 ASN ASN A . n A 1 242 PRO 242 368 368 PRO PRO A . n A 1 243 SER 243 369 369 SER SER A . n A 1 244 GLN 244 370 370 GLN GLN A . n A 1 245 ARG 245 371 371 ARG ARG A . n A 1 246 PRO 246 372 372 PRO PRO A . n A 1 247 MET 247 373 373 MET MET A . n A 1 248 LEU 248 374 374 LEU LEU A . n A 1 249 ARG 249 375 375 ARG ARG A . n A 1 250 GLU 250 376 376 GLU GLU A . n A 1 251 VAL 251 377 377 VAL VAL A . n A 1 252 LEU 252 378 378 LEU LEU A . n A 1 253 GLU 253 379 379 GLU GLU A . n A 1 254 HIS 254 380 380 HIS HIS A . n A 1 255 PRO 255 381 381 PRO PRO A . n A 1 256 TRP 256 382 382 TRP TRP A . n A 1 257 ILE 257 383 383 ILE ILE A . n A 1 258 THR 258 384 384 THR THR A . n A 1 259 ALA 259 385 385 ALA ALA A . n A 1 260 ASN 260 386 386 ASN ASN A . n A 1 261 SER 261 387 387 SER SER A . n A 1 262 SER 262 388 388 SER SER A . n A 1 263 LYS 263 389 389 LYS LYS A . n A 1 264 PRO 264 390 390 PRO PRO A . n A 1 265 SER 265 391 391 SER SER A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 5YZ 1 401 392 5YZ SD3 A . C 3 CL 1 402 1 CL CL A . D 3 CL 1 403 2 CL CL A . E 3 CL 1 404 3 CL CL A . F 4 HOH 1 501 10 HOH HOH A . F 4 HOH 2 502 15 HOH HOH A . F 4 HOH 3 503 3 HOH HOH A . F 4 HOH 4 504 4 HOH HOH A . F 4 HOH 5 505 8 HOH HOH A . F 4 HOH 6 506 14 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 120 ? 1 MORE -8 ? 1 'SSA (A^2)' 11970 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id CL _pdbx_struct_special_symmetry.auth_seq_id 404 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id E _pdbx_struct_special_symmetry.label_comp_id CL _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-06-08 2 'Structure model' 1 1 2022-09-07 3 'Structure model' 1 2 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation_author.identifier_ORCID' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x-y,z+2/3 3 -x+y,-x,z+1/3 4 x-y,-y,-z+1/3 5 -x,-x+y,-z+2/3 6 y,x,-z # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.7.0032 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.1 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_entry_details.entry_id 7FIC _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OH _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 TYR _pdbx_validate_close_contact.auth_seq_id_1 236 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 501 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.14 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 156 ? ? 56.37 11.43 2 1 SER A 226 ? ? 70.86 -62.41 3 1 ILE A 257 ? ? 49.26 28.62 4 1 ARG A 304 ? ? -127.87 -156.04 5 1 ASP A 307 ? ? -112.59 -152.44 6 1 VAL A 344 ? ? 39.39 62.50 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 131 ? CG ? A GLU 5 CG 2 1 Y 1 A GLU 131 ? CD ? A GLU 5 CD 3 1 Y 1 A GLU 131 ? OE1 ? A GLU 5 OE1 4 1 Y 1 A GLU 131 ? OE2 ? A GLU 5 OE2 5 1 Y 1 A LYS 141 ? CG ? A LYS 15 CG 6 1 Y 1 A LYS 141 ? CD ? A LYS 15 CD 7 1 Y 1 A LYS 141 ? CE ? A LYS 15 CE 8 1 Y 1 A LYS 141 ? NZ ? A LYS 15 NZ 9 1 Y 1 A LYS 143 ? CG ? A LYS 17 CG 10 1 Y 1 A LYS 143 ? CD ? A LYS 17 CD 11 1 Y 1 A LYS 143 ? CE ? A LYS 17 CE 12 1 Y 1 A LYS 143 ? NZ ? A LYS 17 NZ 13 1 Y 1 A LYS 156 ? CG ? A LYS 30 CG 14 1 Y 1 A LYS 156 ? CD ? A LYS 30 CD 15 1 Y 1 A LYS 156 ? CE ? A LYS 30 CE 16 1 Y 1 A LYS 156 ? NZ ? A LYS 30 NZ 17 1 Y 1 A LEU 169 ? CG ? A LEU 43 CG 18 1 Y 1 A LEU 169 ? CD1 ? A LEU 43 CD1 19 1 Y 1 A LEU 169 ? CD2 ? A LEU 43 CD2 20 1 Y 1 A GLU 170 ? CG ? A GLU 44 CG 21 1 Y 1 A GLU 170 ? CD ? A GLU 44 CD 22 1 Y 1 A GLU 170 ? OE1 ? A GLU 44 OE1 23 1 Y 1 A GLU 170 ? OE2 ? A GLU 44 OE2 24 1 Y 1 A LYS 171 ? CG ? A LYS 45 CG 25 1 Y 1 A LYS 171 ? CD ? A LYS 45 CD 26 1 Y 1 A LYS 171 ? CE ? A LYS 45 CE 27 1 Y 1 A LYS 171 ? NZ ? A LYS 45 NZ 28 1 Y 1 A GLU 175 ? CG ? A GLU 49 CG 29 1 Y 1 A GLU 175 ? CD ? A GLU 49 CD 30 1 Y 1 A GLU 175 ? OE1 ? A GLU 49 OE1 31 1 Y 1 A GLU 175 ? OE2 ? A GLU 49 OE2 32 1 Y 1 A GLN 177 ? CG ? A GLN 51 CG 33 1 Y 1 A GLN 177 ? CD ? A GLN 51 CD 34 1 Y 1 A GLN 177 ? OE1 ? A GLN 51 OE1 35 1 Y 1 A GLN 177 ? NE2 ? A GLN 51 NE2 36 1 Y 1 A ARG 179 ? CG ? A ARG 53 CG 37 1 Y 1 A ARG 179 ? CD ? A ARG 53 CD 38 1 Y 1 A ARG 179 ? NE ? A ARG 53 NE 39 1 Y 1 A ARG 179 ? CZ ? A ARG 53 CZ 40 1 Y 1 A ARG 179 ? NH1 ? A ARG 53 NH1 41 1 Y 1 A ARG 179 ? NH2 ? A ARG 53 NH2 42 1 Y 1 A ARG 180 ? CG ? A ARG 54 CG 43 1 Y 1 A ARG 180 ? CD ? A ARG 54 CD 44 1 Y 1 A ARG 180 ? NE ? A ARG 54 NE 45 1 Y 1 A ARG 180 ? CZ ? A ARG 54 CZ 46 1 Y 1 A ARG 180 ? NH1 ? A ARG 54 NH1 47 1 Y 1 A ARG 180 ? NH2 ? A ARG 54 NH2 48 1 Y 1 A GLU 181 ? CG ? A GLU 55 CG 49 1 Y 1 A GLU 181 ? CD ? A GLU 55 CD 50 1 Y 1 A GLU 181 ? OE1 ? A GLU 55 OE1 51 1 Y 1 A GLU 181 ? OE2 ? A GLU 55 OE2 52 1 Y 1 A GLU 183 ? CG ? A GLU 57 CG 53 1 Y 1 A GLU 183 ? CD ? A GLU 57 CD 54 1 Y 1 A GLU 183 ? OE1 ? A GLU 57 OE1 55 1 Y 1 A GLU 183 ? OE2 ? A GLU 57 OE2 56 1 Y 1 A HIS 187 ? CG ? A HIS 61 CG 57 1 Y 1 A HIS 187 ? ND1 ? A HIS 61 ND1 58 1 Y 1 A HIS 187 ? CD2 ? A HIS 61 CD2 59 1 Y 1 A HIS 187 ? CE1 ? A HIS 61 CE1 60 1 Y 1 A HIS 187 ? NE2 ? A HIS 61 NE2 61 1 Y 1 A ARG 189 ? CG ? A ARG 63 CG 62 1 Y 1 A ARG 189 ? CD ? A ARG 63 CD 63 1 Y 1 A ARG 189 ? NE ? A ARG 63 NE 64 1 Y 1 A ARG 189 ? CZ ? A ARG 63 CZ 65 1 Y 1 A ARG 189 ? NH1 ? A ARG 63 NH1 66 1 Y 1 A ARG 189 ? NH2 ? A ARG 63 NH2 67 1 Y 1 A HIS 201 ? CG ? A HIS 75 CG 68 1 Y 1 A HIS 201 ? ND1 ? A HIS 75 ND1 69 1 Y 1 A HIS 201 ? CD2 ? A HIS 75 CD2 70 1 Y 1 A HIS 201 ? CE1 ? A HIS 75 CE1 71 1 Y 1 A HIS 201 ? NE2 ? A HIS 75 NE2 72 1 Y 1 A ARG 205 ? CG ? A ARG 79 CG 73 1 Y 1 A ARG 205 ? CD ? A ARG 79 CD 74 1 Y 1 A ARG 205 ? NE ? A ARG 79 NE 75 1 Y 1 A ARG 205 ? CZ ? A ARG 79 CZ 76 1 Y 1 A ARG 205 ? NH1 ? A ARG 79 NH1 77 1 Y 1 A ARG 205 ? NH2 ? A ARG 79 NH2 78 1 Y 1 A SER 226 ? OG ? A SER 100 OG 79 1 Y 1 A LYS 250 ? CG ? A LYS 124 CG 80 1 Y 1 A LYS 250 ? CD ? A LYS 124 CD 81 1 Y 1 A LYS 250 ? CE ? A LYS 124 CE 82 1 Y 1 A LYS 250 ? NZ ? A LYS 124 NZ 83 1 Y 1 A ARG 251 ? CG ? A ARG 125 CG 84 1 Y 1 A ARG 251 ? CD ? A ARG 125 CD 85 1 Y 1 A ARG 251 ? NE ? A ARG 125 NE 86 1 Y 1 A ARG 251 ? CZ ? A ARG 125 CZ 87 1 Y 1 A ARG 251 ? NH1 ? A ARG 125 NH1 88 1 Y 1 A ARG 251 ? NH2 ? A ARG 125 NH2 89 1 Y 1 A ILE 253 ? CG1 ? A ILE 127 CG1 90 1 Y 1 A ILE 253 ? CG2 ? A ILE 127 CG2 91 1 Y 1 A ILE 253 ? CD1 ? A ILE 127 CD1 92 1 Y 1 A MET 305 ? CG ? A MET 179 CG 93 1 Y 1 A MET 305 ? SD ? A MET 179 SD 94 1 Y 1 A MET 305 ? CE ? A MET 179 CE 95 1 Y 1 A GLU 308 ? CG ? A GLU 182 CG 96 1 Y 1 A GLU 308 ? CD ? A GLU 182 CD 97 1 Y 1 A GLU 308 ? OE1 ? A GLU 182 OE1 98 1 Y 1 A GLU 308 ? OE2 ? A GLU 182 OE2 99 1 Y 1 A ASN 332 ? CG ? A ASN 206 CG 100 1 Y 1 A ASN 332 ? OD1 ? A ASN 206 OD1 101 1 Y 1 A ASN 332 ? ND2 ? A ASN 206 ND2 102 1 Y 1 A GLU 354 ? CG ? A GLU 228 CG 103 1 Y 1 A GLU 354 ? CD ? A GLU 228 CD 104 1 Y 1 A GLU 354 ? OE1 ? A GLU 228 OE1 105 1 Y 1 A GLU 354 ? OE2 ? A GLU 228 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A VAL 279 ? A VAL 153 2 1 Y 1 A HIS 280 ? A HIS 154 3 1 Y 1 A ALA 281 ? A ALA 155 4 1 Y 1 A PRO 282 ? A PRO 156 5 1 Y 1 A SER 283 ? A SER 157 6 1 Y 1 A SER 284 ? A SER 158 7 1 Y 1 A ARG 285 ? A ARG 159 8 1 Y 1 A ARG 286 ? A ARG 160 9 1 Y 1 A THR 287 ? A THR 161 10 1 Y 1 A THR 288 ? A THR 162 11 1 Y 1 A LEU 289 ? A LEU 163 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 5YZ C1 C N N 1 5YZ C10 C N N 2 5YZ C11 C Y N 3 5YZ C12 C N N 4 5YZ C13 C N N 5 5YZ C14 C Y N 6 5YZ C15 C Y N 7 5YZ C16 C N N 8 5YZ C17 C N N 9 5YZ C18 C Y N 10 5YZ C19 C N N 11 5YZ C2 C Y N 12 5YZ C20 C N N 13 5YZ C21 C Y N 14 5YZ C22 C Y N 15 5YZ C23 C Y N 16 5YZ C24 C Y N 17 5YZ C25 C Y N 18 5YZ C26 C N N 19 5YZ C3 C N N 20 5YZ C4 C Y N 21 5YZ C5 C N N 22 5YZ C6 C Y N 23 5YZ C7 C Y N 24 5YZ C8 C N N 25 5YZ C9 C N N 26 5YZ N1 N N N 27 5YZ N2 N Y N 28 5YZ N3 N Y N 29 5YZ N4 N N N 30 5YZ N5 N N N 31 5YZ N6 N Y N 32 5YZ N7 N N N 33 5YZ N8 N Y N 34 5YZ O1 O N N 35 5YZ O2 O N N 36 5YZ H1 H N N 37 5YZ H2 H N N 38 5YZ H3 H N N 39 5YZ H4 H N N 40 5YZ H5 H N N 41 5YZ H6 H N N 42 5YZ H7 H N N 43 5YZ H8 H N N 44 5YZ H9 H N N 45 5YZ H10 H N N 46 5YZ H11 H N N 47 5YZ H12 H N N 48 5YZ H13 H N N 49 5YZ H14 H N N 50 5YZ H15 H N N 51 5YZ H16 H N N 52 5YZ H17 H N N 53 5YZ H18 H N N 54 5YZ H19 H N N 55 5YZ H20 H N N 56 5YZ H21 H N N 57 5YZ H22 H N N 58 5YZ H23 H N N 59 5YZ H24 H N N 60 5YZ H25 H N N 61 5YZ H26 H N N 62 5YZ H27 H N N 63 5YZ H28 H N N 64 5YZ H31 H N N 65 5YZ H29 H N N 66 ALA N N N N 67 ALA CA C N S 68 ALA C C N N 69 ALA O O N N 70 ALA CB C N N 71 ALA OXT O N N 72 ALA H H N N 73 ALA H2 H N N 74 ALA HA H N N 75 ALA HB1 H N N 76 ALA HB2 H N N 77 ALA HB3 H N N 78 ALA HXT H N N 79 ARG N N N N 80 ARG CA C N S 81 ARG C C N N 82 ARG O O N N 83 ARG CB C N N 84 ARG CG C N N 85 ARG CD C N N 86 ARG NE N N N 87 ARG CZ C N N 88 ARG NH1 N N N 89 ARG NH2 N N N 90 ARG OXT O N N 91 ARG H H N N 92 ARG H2 H N N 93 ARG HA H N N 94 ARG HB2 H N N 95 ARG HB3 H N N 96 ARG HG2 H N N 97 ARG HG3 H N N 98 ARG HD2 H N N 99 ARG HD3 H N N 100 ARG HE H N N 101 ARG HH11 H N N 102 ARG HH12 H N N 103 ARG HH21 H N N 104 ARG HH22 H N N 105 ARG HXT H N N 106 ASN N N N N 107 ASN CA C N S 108 ASN C C N N 109 ASN O O N N 110 ASN CB C N N 111 ASN CG C N N 112 ASN OD1 O N N 113 ASN ND2 N N N 114 ASN OXT O N N 115 ASN H H N N 116 ASN H2 H N N 117 ASN HA H N N 118 ASN HB2 H N N 119 ASN HB3 H N N 120 ASN HD21 H N N 121 ASN HD22 H N N 122 ASN HXT H N N 123 ASP N N N N 124 ASP CA C N S 125 ASP C C N N 126 ASP O O N N 127 ASP CB C N N 128 ASP CG C N N 129 ASP OD1 O N N 130 ASP OD2 O N N 131 ASP OXT O N N 132 ASP H H N N 133 ASP H2 H N N 134 ASP HA H N N 135 ASP HB2 H N N 136 ASP HB3 H N N 137 ASP HD2 H N N 138 ASP HXT H N N 139 CL CL CL N N 140 CYS N N N N 141 CYS CA C N R 142 CYS C C N N 143 CYS O O N N 144 CYS CB C N N 145 CYS SG S N N 146 CYS OXT O N N 147 CYS H H N N 148 CYS H2 H N N 149 CYS HA H N N 150 CYS HB2 H N N 151 CYS HB3 H N N 152 CYS HG H N N 153 CYS HXT H N N 154 GLN N N N N 155 GLN CA C N S 156 GLN C C N N 157 GLN O O N N 158 GLN CB C N N 159 GLN CG C N N 160 GLN CD C N N 161 GLN OE1 O N N 162 GLN NE2 N N N 163 GLN OXT O N N 164 GLN H H N N 165 GLN H2 H N N 166 GLN HA H N N 167 GLN HB2 H N N 168 GLN HB3 H N N 169 GLN HG2 H N N 170 GLN HG3 H N N 171 GLN HE21 H N N 172 GLN HE22 H N N 173 GLN HXT H N N 174 GLU N N N N 175 GLU CA C N S 176 GLU C C N N 177 GLU O O N N 178 GLU CB C N N 179 GLU CG C N N 180 GLU CD C N N 181 GLU OE1 O N N 182 GLU OE2 O N N 183 GLU OXT O N N 184 GLU H H N N 185 GLU H2 H N N 186 GLU HA H N N 187 GLU HB2 H N N 188 GLU HB3 H N N 189 GLU HG2 H N N 190 GLU HG3 H N N 191 GLU HE2 H N N 192 GLU HXT H N N 193 GLY N N N N 194 GLY CA C N N 195 GLY C C N N 196 GLY O O N N 197 GLY OXT O N N 198 GLY H H N N 199 GLY H2 H N N 200 GLY HA2 H N N 201 GLY HA3 H N N 202 GLY HXT H N N 203 HIS N N N N 204 HIS CA C N S 205 HIS C C N N 206 HIS O O N N 207 HIS CB C N N 208 HIS CG C Y N 209 HIS ND1 N Y N 210 HIS CD2 C Y N 211 HIS CE1 C Y N 212 HIS NE2 N Y N 213 HIS OXT O N N 214 HIS H H N N 215 HIS H2 H N N 216 HIS HA H N N 217 HIS HB2 H N N 218 HIS HB3 H N N 219 HIS HD1 H N N 220 HIS HD2 H N N 221 HIS HE1 H N N 222 HIS HE2 H N N 223 HIS HXT H N N 224 HOH O O N N 225 HOH H1 H N N 226 HOH H2 H N N 227 ILE N N N N 228 ILE CA C N S 229 ILE C C N N 230 ILE O O N N 231 ILE CB C N S 232 ILE CG1 C N N 233 ILE CG2 C N N 234 ILE CD1 C N N 235 ILE OXT O N N 236 ILE H H N N 237 ILE H2 H N N 238 ILE HA H N N 239 ILE HB H N N 240 ILE HG12 H N N 241 ILE HG13 H N N 242 ILE HG21 H N N 243 ILE HG22 H N N 244 ILE HG23 H N N 245 ILE HD11 H N N 246 ILE HD12 H N N 247 ILE HD13 H N N 248 ILE HXT H N N 249 LEU N N N N 250 LEU CA C N S 251 LEU C C N N 252 LEU O O N N 253 LEU CB C N N 254 LEU CG C N N 255 LEU CD1 C N N 256 LEU CD2 C N N 257 LEU OXT O N N 258 LEU H H N N 259 LEU H2 H N N 260 LEU HA H N N 261 LEU HB2 H N N 262 LEU HB3 H N N 263 LEU HG H N N 264 LEU HD11 H N N 265 LEU HD12 H N N 266 LEU HD13 H N N 267 LEU HD21 H N N 268 LEU HD22 H N N 269 LEU HD23 H N N 270 LEU HXT H N N 271 LYS N N N N 272 LYS CA C N S 273 LYS C C N N 274 LYS O O N N 275 LYS CB C N N 276 LYS CG C N N 277 LYS CD C N N 278 LYS CE C N N 279 LYS NZ N N N 280 LYS OXT O N N 281 LYS H H N N 282 LYS H2 H N N 283 LYS HA H N N 284 LYS HB2 H N N 285 LYS HB3 H N N 286 LYS HG2 H N N 287 LYS HG3 H N N 288 LYS HD2 H N N 289 LYS HD3 H N N 290 LYS HE2 H N N 291 LYS HE3 H N N 292 LYS HZ1 H N N 293 LYS HZ2 H N N 294 LYS HZ3 H N N 295 LYS HXT H N N 296 MET N N N N 297 MET CA C N S 298 MET C C N N 299 MET O O N N 300 MET CB C N N 301 MET CG C N N 302 MET SD S N N 303 MET CE C N N 304 MET OXT O N N 305 MET H H N N 306 MET H2 H N N 307 MET HA H N N 308 MET HB2 H N N 309 MET HB3 H N N 310 MET HG2 H N N 311 MET HG3 H N N 312 MET HE1 H N N 313 MET HE2 H N N 314 MET HE3 H N N 315 MET HXT H N N 316 PHE N N N N 317 PHE CA C N S 318 PHE C C N N 319 PHE O O N N 320 PHE CB C N N 321 PHE CG C Y N 322 PHE CD1 C Y N 323 PHE CD2 C Y N 324 PHE CE1 C Y N 325 PHE CE2 C Y N 326 PHE CZ C Y N 327 PHE OXT O N N 328 PHE H H N N 329 PHE H2 H N N 330 PHE HA H N N 331 PHE HB2 H N N 332 PHE HB3 H N N 333 PHE HD1 H N N 334 PHE HD2 H N N 335 PHE HE1 H N N 336 PHE HE2 H N N 337 PHE HZ H N N 338 PHE HXT H N N 339 PRO N N N N 340 PRO CA C N S 341 PRO C C N N 342 PRO O O N N 343 PRO CB C N N 344 PRO CG C N N 345 PRO CD C N N 346 PRO OXT O N N 347 PRO H H N N 348 PRO HA H N N 349 PRO HB2 H N N 350 PRO HB3 H N N 351 PRO HG2 H N N 352 PRO HG3 H N N 353 PRO HD2 H N N 354 PRO HD3 H N N 355 PRO HXT H N N 356 SER N N N N 357 SER CA C N S 358 SER C C N N 359 SER O O N N 360 SER CB C N N 361 SER OG O N N 362 SER OXT O N N 363 SER H H N N 364 SER H2 H N N 365 SER HA H N N 366 SER HB2 H N N 367 SER HB3 H N N 368 SER HG H N N 369 SER HXT H N N 370 THR N N N N 371 THR CA C N S 372 THR C C N N 373 THR O O N N 374 THR CB C N R 375 THR OG1 O N N 376 THR CG2 C N N 377 THR OXT O N N 378 THR H H N N 379 THR H2 H N N 380 THR HA H N N 381 THR HB H N N 382 THR HG1 H N N 383 THR HG21 H N N 384 THR HG22 H N N 385 THR HG23 H N N 386 THR HXT H N N 387 TRP N N N N 388 TRP CA C N S 389 TRP C C N N 390 TRP O O N N 391 TRP CB C N N 392 TRP CG C Y N 393 TRP CD1 C Y N 394 TRP CD2 C Y N 395 TRP NE1 N Y N 396 TRP CE2 C Y N 397 TRP CE3 C Y N 398 TRP CZ2 C Y N 399 TRP CZ3 C Y N 400 TRP CH2 C Y N 401 TRP OXT O N N 402 TRP H H N N 403 TRP H2 H N N 404 TRP HA H N N 405 TRP HB2 H N N 406 TRP HB3 H N N 407 TRP HD1 H N N 408 TRP HE1 H N N 409 TRP HE3 H N N 410 TRP HZ2 H N N 411 TRP HZ3 H N N 412 TRP HH2 H N N 413 TRP HXT H N N 414 TYR N N N N 415 TYR CA C N S 416 TYR C C N N 417 TYR O O N N 418 TYR CB C N N 419 TYR CG C Y N 420 TYR CD1 C Y N 421 TYR CD2 C Y N 422 TYR CE1 C Y N 423 TYR CE2 C Y N 424 TYR CZ C Y N 425 TYR OH O N N 426 TYR OXT O N N 427 TYR H H N N 428 TYR H2 H N N 429 TYR HA H N N 430 TYR HB2 H N N 431 TYR HB3 H N N 432 TYR HD1 H N N 433 TYR HD2 H N N 434 TYR HE1 H N N 435 TYR HE2 H N N 436 TYR HH H N N 437 TYR HXT H N N 438 VAL N N N N 439 VAL CA C N S 440 VAL C C N N 441 VAL O O N N 442 VAL CB C N N 443 VAL CG1 C N N 444 VAL CG2 C N N 445 VAL OXT O N N 446 VAL H H N N 447 VAL H2 H N N 448 VAL HA H N N 449 VAL HB H N N 450 VAL HG11 H N N 451 VAL HG12 H N N 452 VAL HG13 H N N 453 VAL HG21 H N N 454 VAL HG22 H N N 455 VAL HG23 H N N 456 VAL HXT H N N 457 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 5YZ O2 C25 sing N N 1 5YZ C24 C25 doub Y N 2 5YZ C24 C22 sing Y N 3 5YZ C25 C23 sing Y N 4 5YZ C22 C18 doub Y N 5 5YZ C23 C26 sing N N 6 5YZ C23 C21 doub Y N 7 5YZ C18 C21 sing Y N 8 5YZ C18 C16 sing N N 9 5YZ C16 N7 sing N N 10 5YZ N7 C13 sing N N 11 5YZ N7 C12 sing N N 12 5YZ C13 C10 sing N N 13 5YZ C12 C9 sing N N 14 5YZ C10 N4 sing N N 15 5YZ C9 N4 sing N N 16 5YZ C19 C20 sing N N 17 5YZ C19 C17 sing N N 18 5YZ N4 C6 sing N N 19 5YZ C20 C17 sing N N 20 5YZ C6 N3 sing Y N 21 5YZ C6 N2 doub Y N 22 5YZ C17 C15 sing N N 23 5YZ N3 C7 doub Y N 24 5YZ N2 C2 sing Y N 25 5YZ C14 C15 doub Y N 26 5YZ C14 C11 sing Y N 27 5YZ C15 N8 sing Y N 28 5YZ C7 N5 sing N N 29 5YZ C7 C4 sing Y N 30 5YZ C2 C4 doub Y N 31 5YZ C2 C1 sing N N 32 5YZ O1 C1 doub N N 33 5YZ C11 N5 sing N N 34 5YZ C11 N6 doub Y N 35 5YZ N8 N6 sing Y N 36 5YZ C1 N1 sing N N 37 5YZ N1 C3 sing N N 38 5YZ C8 C5 trip N N 39 5YZ C5 C3 sing N N 40 5YZ C10 H1 sing N N 41 5YZ C10 H2 sing N N 42 5YZ C12 H3 sing N N 43 5YZ C12 H4 sing N N 44 5YZ C13 H5 sing N N 45 5YZ C13 H6 sing N N 46 5YZ C14 H7 sing N N 47 5YZ C16 H8 sing N N 48 5YZ C16 H9 sing N N 49 5YZ C17 H10 sing N N 50 5YZ C19 H11 sing N N 51 5YZ C19 H12 sing N N 52 5YZ C20 H13 sing N N 53 5YZ C20 H14 sing N N 54 5YZ C21 H15 sing N N 55 5YZ C22 H16 sing N N 56 5YZ C24 H17 sing N N 57 5YZ C26 H18 sing N N 58 5YZ C26 H19 sing N N 59 5YZ C26 H20 sing N N 60 5YZ C3 H21 sing N N 61 5YZ C3 H22 sing N N 62 5YZ C4 H23 sing N N 63 5YZ C8 H24 sing N N 64 5YZ C9 H25 sing N N 65 5YZ C9 H26 sing N N 66 5YZ N1 H27 sing N N 67 5YZ N5 H28 sing N N 68 5YZ O2 H31 sing N N 69 5YZ N8 H29 sing N N 70 ALA N CA sing N N 71 ALA N H sing N N 72 ALA N H2 sing N N 73 ALA CA C sing N N 74 ALA CA CB sing N N 75 ALA CA HA sing N N 76 ALA C O doub N N 77 ALA C OXT sing N N 78 ALA CB HB1 sing N N 79 ALA CB HB2 sing N N 80 ALA CB HB3 sing N N 81 ALA OXT HXT sing N N 82 ARG N CA sing N N 83 ARG N H sing N N 84 ARG N H2 sing N N 85 ARG CA C sing N N 86 ARG CA CB sing N N 87 ARG CA HA sing N N 88 ARG C O doub N N 89 ARG C OXT sing N N 90 ARG CB CG sing N N 91 ARG CB HB2 sing N N 92 ARG CB HB3 sing N N 93 ARG CG CD sing N N 94 ARG CG HG2 sing N N 95 ARG CG HG3 sing N N 96 ARG CD NE sing N N 97 ARG CD HD2 sing N N 98 ARG CD HD3 sing N N 99 ARG NE CZ sing N N 100 ARG NE HE sing N N 101 ARG CZ NH1 sing N N 102 ARG CZ NH2 doub N N 103 ARG NH1 HH11 sing N N 104 ARG NH1 HH12 sing N N 105 ARG NH2 HH21 sing N N 106 ARG NH2 HH22 sing N N 107 ARG OXT HXT sing N N 108 ASN N CA sing N N 109 ASN N H sing N N 110 ASN N H2 sing N N 111 ASN CA C sing N N 112 ASN CA CB sing N N 113 ASN CA HA sing N N 114 ASN C O doub N N 115 ASN C OXT sing N N 116 ASN CB CG sing N N 117 ASN CB HB2 sing N N 118 ASN CB HB3 sing N N 119 ASN CG OD1 doub N N 120 ASN CG ND2 sing N N 121 ASN ND2 HD21 sing N N 122 ASN ND2 HD22 sing N N 123 ASN OXT HXT sing N N 124 ASP N CA sing N N 125 ASP N H sing N N 126 ASP N H2 sing N N 127 ASP CA C sing N N 128 ASP CA CB sing N N 129 ASP CA HA sing N N 130 ASP C O doub N N 131 ASP C OXT sing N N 132 ASP CB CG sing N N 133 ASP CB HB2 sing N N 134 ASP CB HB3 sing N N 135 ASP CG OD1 doub N N 136 ASP CG OD2 sing N N 137 ASP OD2 HD2 sing N N 138 ASP OXT HXT sing N N 139 CYS N CA sing N N 140 CYS N H sing N N 141 CYS N H2 sing N N 142 CYS CA C sing N N 143 CYS CA CB sing N N 144 CYS CA HA sing N N 145 CYS C O doub N N 146 CYS C OXT sing N N 147 CYS CB SG sing N N 148 CYS CB HB2 sing N N 149 CYS CB HB3 sing N N 150 CYS SG HG sing N N 151 CYS OXT HXT sing N N 152 GLN N CA sing N N 153 GLN N H sing N N 154 GLN N H2 sing N N 155 GLN CA C sing N N 156 GLN CA CB sing N N 157 GLN CA HA sing N N 158 GLN C O doub N N 159 GLN C OXT sing N N 160 GLN CB CG sing N N 161 GLN CB HB2 sing N N 162 GLN CB HB3 sing N N 163 GLN CG CD sing N N 164 GLN CG HG2 sing N N 165 GLN CG HG3 sing N N 166 GLN CD OE1 doub N N 167 GLN CD NE2 sing N N 168 GLN NE2 HE21 sing N N 169 GLN NE2 HE22 sing N N 170 GLN OXT HXT sing N N 171 GLU N CA sing N N 172 GLU N H sing N N 173 GLU N H2 sing N N 174 GLU CA C sing N N 175 GLU CA CB sing N N 176 GLU CA HA sing N N 177 GLU C O doub N N 178 GLU C OXT sing N N 179 GLU CB CG sing N N 180 GLU CB HB2 sing N N 181 GLU CB HB3 sing N N 182 GLU CG CD sing N N 183 GLU CG HG2 sing N N 184 GLU CG HG3 sing N N 185 GLU CD OE1 doub N N 186 GLU CD OE2 sing N N 187 GLU OE2 HE2 sing N N 188 GLU OXT HXT sing N N 189 GLY N CA sing N N 190 GLY N H sing N N 191 GLY N H2 sing N N 192 GLY CA C sing N N 193 GLY CA HA2 sing N N 194 GLY CA HA3 sing N N 195 GLY C O doub N N 196 GLY C OXT sing N N 197 GLY OXT HXT sing N N 198 HIS N CA sing N N 199 HIS N H sing N N 200 HIS N H2 sing N N 201 HIS CA C sing N N 202 HIS CA CB sing N N 203 HIS CA HA sing N N 204 HIS C O doub N N 205 HIS C OXT sing N N 206 HIS CB CG sing N N 207 HIS CB HB2 sing N N 208 HIS CB HB3 sing N N 209 HIS CG ND1 sing Y N 210 HIS CG CD2 doub Y N 211 HIS ND1 CE1 doub Y N 212 HIS ND1 HD1 sing N N 213 HIS CD2 NE2 sing Y N 214 HIS CD2 HD2 sing N N 215 HIS CE1 NE2 sing Y N 216 HIS CE1 HE1 sing N N 217 HIS NE2 HE2 sing N N 218 HIS OXT HXT sing N N 219 HOH O H1 sing N N 220 HOH O H2 sing N N 221 ILE N CA sing N N 222 ILE N H sing N N 223 ILE N H2 sing N N 224 ILE CA C sing N N 225 ILE CA CB sing N N 226 ILE CA HA sing N N 227 ILE C O doub N N 228 ILE C OXT sing N N 229 ILE CB CG1 sing N N 230 ILE CB CG2 sing N N 231 ILE CB HB sing N N 232 ILE CG1 CD1 sing N N 233 ILE CG1 HG12 sing N N 234 ILE CG1 HG13 sing N N 235 ILE CG2 HG21 sing N N 236 ILE CG2 HG22 sing N N 237 ILE CG2 HG23 sing N N 238 ILE CD1 HD11 sing N N 239 ILE CD1 HD12 sing N N 240 ILE CD1 HD13 sing N N 241 ILE OXT HXT sing N N 242 LEU N CA sing N N 243 LEU N H sing N N 244 LEU N H2 sing N N 245 LEU CA C sing N N 246 LEU CA CB sing N N 247 LEU CA HA sing N N 248 LEU C O doub N N 249 LEU C OXT sing N N 250 LEU CB CG sing N N 251 LEU CB HB2 sing N N 252 LEU CB HB3 sing N N 253 LEU CG CD1 sing N N 254 LEU CG CD2 sing N N 255 LEU CG HG sing N N 256 LEU CD1 HD11 sing N N 257 LEU CD1 HD12 sing N N 258 LEU CD1 HD13 sing N N 259 LEU CD2 HD21 sing N N 260 LEU CD2 HD22 sing N N 261 LEU CD2 HD23 sing N N 262 LEU OXT HXT sing N N 263 LYS N CA sing N N 264 LYS N H sing N N 265 LYS N H2 sing N N 266 LYS CA C sing N N 267 LYS CA CB sing N N 268 LYS CA HA sing N N 269 LYS C O doub N N 270 LYS C OXT sing N N 271 LYS CB CG sing N N 272 LYS CB HB2 sing N N 273 LYS CB HB3 sing N N 274 LYS CG CD sing N N 275 LYS CG HG2 sing N N 276 LYS CG HG3 sing N N 277 LYS CD CE sing N N 278 LYS CD HD2 sing N N 279 LYS CD HD3 sing N N 280 LYS CE NZ sing N N 281 LYS CE HE2 sing N N 282 LYS CE HE3 sing N N 283 LYS NZ HZ1 sing N N 284 LYS NZ HZ2 sing N N 285 LYS NZ HZ3 sing N N 286 LYS OXT HXT sing N N 287 MET N CA sing N N 288 MET N H sing N N 289 MET N H2 sing N N 290 MET CA C sing N N 291 MET CA CB sing N N 292 MET CA HA sing N N 293 MET C O doub N N 294 MET C OXT sing N N 295 MET CB CG sing N N 296 MET CB HB2 sing N N 297 MET CB HB3 sing N N 298 MET CG SD sing N N 299 MET CG HG2 sing N N 300 MET CG HG3 sing N N 301 MET SD CE sing N N 302 MET CE HE1 sing N N 303 MET CE HE2 sing N N 304 MET CE HE3 sing N N 305 MET OXT HXT sing N N 306 PHE N CA sing N N 307 PHE N H sing N N 308 PHE N H2 sing N N 309 PHE CA C sing N N 310 PHE CA CB sing N N 311 PHE CA HA sing N N 312 PHE C O doub N N 313 PHE C OXT sing N N 314 PHE CB CG sing N N 315 PHE CB HB2 sing N N 316 PHE CB HB3 sing N N 317 PHE CG CD1 doub Y N 318 PHE CG CD2 sing Y N 319 PHE CD1 CE1 sing Y N 320 PHE CD1 HD1 sing N N 321 PHE CD2 CE2 doub Y N 322 PHE CD2 HD2 sing N N 323 PHE CE1 CZ doub Y N 324 PHE CE1 HE1 sing N N 325 PHE CE2 CZ sing Y N 326 PHE CE2 HE2 sing N N 327 PHE CZ HZ sing N N 328 PHE OXT HXT sing N N 329 PRO N CA sing N N 330 PRO N CD sing N N 331 PRO N H sing N N 332 PRO CA C sing N N 333 PRO CA CB sing N N 334 PRO CA HA sing N N 335 PRO C O doub N N 336 PRO C OXT sing N N 337 PRO CB CG sing N N 338 PRO CB HB2 sing N N 339 PRO CB HB3 sing N N 340 PRO CG CD sing N N 341 PRO CG HG2 sing N N 342 PRO CG HG3 sing N N 343 PRO CD HD2 sing N N 344 PRO CD HD3 sing N N 345 PRO OXT HXT sing N N 346 SER N CA sing N N 347 SER N H sing N N 348 SER N H2 sing N N 349 SER CA C sing N N 350 SER CA CB sing N N 351 SER CA HA sing N N 352 SER C O doub N N 353 SER C OXT sing N N 354 SER CB OG sing N N 355 SER CB HB2 sing N N 356 SER CB HB3 sing N N 357 SER OG HG sing N N 358 SER OXT HXT sing N N 359 THR N CA sing N N 360 THR N H sing N N 361 THR N H2 sing N N 362 THR CA C sing N N 363 THR CA CB sing N N 364 THR CA HA sing N N 365 THR C O doub N N 366 THR C OXT sing N N 367 THR CB OG1 sing N N 368 THR CB CG2 sing N N 369 THR CB HB sing N N 370 THR OG1 HG1 sing N N 371 THR CG2 HG21 sing N N 372 THR CG2 HG22 sing N N 373 THR CG2 HG23 sing N N 374 THR OXT HXT sing N N 375 TRP N CA sing N N 376 TRP N H sing N N 377 TRP N H2 sing N N 378 TRP CA C sing N N 379 TRP CA CB sing N N 380 TRP CA HA sing N N 381 TRP C O doub N N 382 TRP C OXT sing N N 383 TRP CB CG sing N N 384 TRP CB HB2 sing N N 385 TRP CB HB3 sing N N 386 TRP CG CD1 doub Y N 387 TRP CG CD2 sing Y N 388 TRP CD1 NE1 sing Y N 389 TRP CD1 HD1 sing N N 390 TRP CD2 CE2 doub Y N 391 TRP CD2 CE3 sing Y N 392 TRP NE1 CE2 sing Y N 393 TRP NE1 HE1 sing N N 394 TRP CE2 CZ2 sing Y N 395 TRP CE3 CZ3 doub Y N 396 TRP CE3 HE3 sing N N 397 TRP CZ2 CH2 doub Y N 398 TRP CZ2 HZ2 sing N N 399 TRP CZ3 CH2 sing Y N 400 TRP CZ3 HZ3 sing N N 401 TRP CH2 HH2 sing N N 402 TRP OXT HXT sing N N 403 TYR N CA sing N N 404 TYR N H sing N N 405 TYR N H2 sing N N 406 TYR CA C sing N N 407 TYR CA CB sing N N 408 TYR CA HA sing N N 409 TYR C O doub N N 410 TYR C OXT sing N N 411 TYR CB CG sing N N 412 TYR CB HB2 sing N N 413 TYR CB HB3 sing N N 414 TYR CG CD1 doub Y N 415 TYR CG CD2 sing Y N 416 TYR CD1 CE1 sing Y N 417 TYR CD1 HD1 sing N N 418 TYR CD2 CE2 doub Y N 419 TYR CD2 HD2 sing N N 420 TYR CE1 CZ doub Y N 421 TYR CE1 HE1 sing N N 422 TYR CE2 CZ sing Y N 423 TYR CE2 HE2 sing N N 424 TYR CZ OH sing N N 425 TYR OH HH sing N N 426 TYR OXT HXT sing N N 427 VAL N CA sing N N 428 VAL N H sing N N 429 VAL N H2 sing N N 430 VAL CA C sing N N 431 VAL CA CB sing N N 432 VAL CA HA sing N N 433 VAL C O doub N N 434 VAL C OXT sing N N 435 VAL CB CG1 sing N N 436 VAL CB CG2 sing N N 437 VAL CB HB sing N N 438 VAL CG1 HG11 sing N N 439 VAL CG1 HG12 sing N N 440 VAL CG1 HG13 sing N N 441 VAL CG2 HG21 sing N N 442 VAL CG2 HG22 sing N N 443 VAL CG2 HG23 sing N N 444 VAL OXT HXT sing N N 445 # _pdbx_audit_support.funding_organization 'Other private' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number Pfizer _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id 5YZ _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id 5YZ _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;6-[(5-cyclopropyl-1~{H}-pyrazol-3-yl)amino]-2-[4-[(3-methyl-4-oxidanyl-phenyl)methyl]piperazin-1-yl]-~{N}-prop-2-ynyl-pyrimidine-4-carboxamide ; 5YZ 3 'CHLORIDE ION' CL 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4CEG _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 32 2 1' _space_group.name_Hall ;P 32 2" ; _space_group.IT_number 154 _space_group.crystal_system trigonal _space_group.id 1 #