data_7JLR # _entry.id 7JLR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7JLR pdb_00007jlr 10.2210/pdb7jlr/pdb WWPDB D_1000251012 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.details . _pdbx_database_related.db_id 7JLI _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7JLR _pdbx_database_status.recvd_initial_deposition_date 2020-07-30 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Workman, S.D.' 1 0000-0001-8807-4466 'Strynadka, N.C.J.' 2 0000-0002-4058-9425 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 64 _citation.language ? _citation.page_first 13540 _citation.page_last 13550 _citation.title 'Structural Insights into the Inhibition of Undecaprenyl Pyrophosphate Synthase from Gram-Positive Bacteria.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.1c00941 _citation.pdbx_database_id_PubMed 34473495 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Workman, S.D.' 1 ? primary 'Day, J.' 2 ? primary 'Farha, M.A.' 3 ? primary 'El Zahed, S.S.' 4 ? primary 'Bon, C.' 5 ? primary 'Brown, E.D.' 6 ? primary 'Organ, M.G.' 7 ? primary 'Strynadka, N.C.J.' 8 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7JLR _cell.details ? _cell.formula_units_Z ? _cell.length_a 60.115 _cell.length_a_esd ? _cell.length_b 60.115 _cell.length_b_esd ? _cell.length_c 161.067 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7JLR _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Isoprenyl transferase' 29814.117 1 2.5.1.- ? ? ? 2 non-polymer syn '7-(azepan-1-yl)-5-ethyl-3-(4-fluorophenyl)pyrazolo[1,5-a]pyrimidine' 338.422 1 ? ? ? ? 3 water nat water 18.015 53 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Undecaprenyl pyrophosphate synthase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MLNILKNWKNQQTAASNLERYTKEDILKGEIPEHIAIIMDGNGRWAKKRSLPRIAGHHEGMKVVKRTTKLANELGVKVLT LYAFSTENWKRPKMEVDFLMKLPEEFLNTYLPELVEENVQVRIIGDETALPAHTLRAIEKAVQDTAQNDGMILNFALNYG GRTEIVSAAKSLAEKVKEGSLNIEDIDESLFSTYLMTESLQDPELLIRTSGEIRLSNFMLWQVAYSEFVFTDVLWPDFKE DHFLQALGEFQQRGRRFGGI ; _entity_poly.pdbx_seq_one_letter_code_can ;MLNILKNWKNQQTAASNLERYTKEDILKGEIPEHIAIIMDGNGRWAKKRSLPRIAGHHEGMKVVKRTTKLANELGVKVLT LYAFSTENWKRPKMEVDFLMKLPEEFLNTYLPELVEENVQVRIIGDETALPAHTLRAIEKAVQDTAQNDGMILNFALNYG GRTEIVSAAKSLAEKVKEGSLNIEDIDESLFSTYLMTESLQDPELLIRTSGEIRLSNFMLWQVAYSEFVFTDVLWPDFKE DHFLQALGEFQQRGRRFGGI ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LEU n 1 3 ASN n 1 4 ILE n 1 5 LEU n 1 6 LYS n 1 7 ASN n 1 8 TRP n 1 9 LYS n 1 10 ASN n 1 11 GLN n 1 12 GLN n 1 13 THR n 1 14 ALA n 1 15 ALA n 1 16 SER n 1 17 ASN n 1 18 LEU n 1 19 GLU n 1 20 ARG n 1 21 TYR n 1 22 THR n 1 23 LYS n 1 24 GLU n 1 25 ASP n 1 26 ILE n 1 27 LEU n 1 28 LYS n 1 29 GLY n 1 30 GLU n 1 31 ILE n 1 32 PRO n 1 33 GLU n 1 34 HIS n 1 35 ILE n 1 36 ALA n 1 37 ILE n 1 38 ILE n 1 39 MET n 1 40 ASP n 1 41 GLY n 1 42 ASN n 1 43 GLY n 1 44 ARG n 1 45 TRP n 1 46 ALA n 1 47 LYS n 1 48 LYS n 1 49 ARG n 1 50 SER n 1 51 LEU n 1 52 PRO n 1 53 ARG n 1 54 ILE n 1 55 ALA n 1 56 GLY n 1 57 HIS n 1 58 HIS n 1 59 GLU n 1 60 GLY n 1 61 MET n 1 62 LYS n 1 63 VAL n 1 64 VAL n 1 65 LYS n 1 66 ARG n 1 67 THR n 1 68 THR n 1 69 LYS n 1 70 LEU n 1 71 ALA n 1 72 ASN n 1 73 GLU n 1 74 LEU n 1 75 GLY n 1 76 VAL n 1 77 LYS n 1 78 VAL n 1 79 LEU n 1 80 THR n 1 81 LEU n 1 82 TYR n 1 83 ALA n 1 84 PHE n 1 85 SER n 1 86 THR n 1 87 GLU n 1 88 ASN n 1 89 TRP n 1 90 LYS n 1 91 ARG n 1 92 PRO n 1 93 LYS n 1 94 MET n 1 95 GLU n 1 96 VAL n 1 97 ASP n 1 98 PHE n 1 99 LEU n 1 100 MET n 1 101 LYS n 1 102 LEU n 1 103 PRO n 1 104 GLU n 1 105 GLU n 1 106 PHE n 1 107 LEU n 1 108 ASN n 1 109 THR n 1 110 TYR n 1 111 LEU n 1 112 PRO n 1 113 GLU n 1 114 LEU n 1 115 VAL n 1 116 GLU n 1 117 GLU n 1 118 ASN n 1 119 VAL n 1 120 GLN n 1 121 VAL n 1 122 ARG n 1 123 ILE n 1 124 ILE n 1 125 GLY n 1 126 ASP n 1 127 GLU n 1 128 THR n 1 129 ALA n 1 130 LEU n 1 131 PRO n 1 132 ALA n 1 133 HIS n 1 134 THR n 1 135 LEU n 1 136 ARG n 1 137 ALA n 1 138 ILE n 1 139 GLU n 1 140 LYS n 1 141 ALA n 1 142 VAL n 1 143 GLN n 1 144 ASP n 1 145 THR n 1 146 ALA n 1 147 GLN n 1 148 ASN n 1 149 ASP n 1 150 GLY n 1 151 MET n 1 152 ILE n 1 153 LEU n 1 154 ASN n 1 155 PHE n 1 156 ALA n 1 157 LEU n 1 158 ASN n 1 159 TYR n 1 160 GLY n 1 161 GLY n 1 162 ARG n 1 163 THR n 1 164 GLU n 1 165 ILE n 1 166 VAL n 1 167 SER n 1 168 ALA n 1 169 ALA n 1 170 LYS n 1 171 SER n 1 172 LEU n 1 173 ALA n 1 174 GLU n 1 175 LYS n 1 176 VAL n 1 177 LYS n 1 178 GLU n 1 179 GLY n 1 180 SER n 1 181 LEU n 1 182 ASN n 1 183 ILE n 1 184 GLU n 1 185 ASP n 1 186 ILE n 1 187 ASP n 1 188 GLU n 1 189 SER n 1 190 LEU n 1 191 PHE n 1 192 SER n 1 193 THR n 1 194 TYR n 1 195 LEU n 1 196 MET n 1 197 THR n 1 198 GLU n 1 199 SER n 1 200 LEU n 1 201 GLN n 1 202 ASP n 1 203 PRO n 1 204 GLU n 1 205 LEU n 1 206 LEU n 1 207 ILE n 1 208 ARG n 1 209 THR n 1 210 SER n 1 211 GLY n 1 212 GLU n 1 213 ILE n 1 214 ARG n 1 215 LEU n 1 216 SER n 1 217 ASN n 1 218 PHE n 1 219 MET n 1 220 LEU n 1 221 TRP n 1 222 GLN n 1 223 VAL n 1 224 ALA n 1 225 TYR n 1 226 SER n 1 227 GLU n 1 228 PHE n 1 229 VAL n 1 230 PHE n 1 231 THR n 1 232 ASP n 1 233 VAL n 1 234 LEU n 1 235 TRP n 1 236 PRO n 1 237 ASP n 1 238 PHE n 1 239 LYS n 1 240 GLU n 1 241 ASP n 1 242 HIS n 1 243 PHE n 1 244 LEU n 1 245 GLN n 1 246 ALA n 1 247 LEU n 1 248 GLY n 1 249 GLU n 1 250 PHE n 1 251 GLN n 1 252 GLN n 1 253 ARG n 1 254 GLY n 1 255 ARG n 1 256 ARG n 1 257 PHE n 1 258 GLY n 1 259 GLY n 1 260 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 260 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'uppS, A3772_08985, B4122_2664, B4417_3501, BS16045_01759, ETA10_09020, ETK61_09295, GII79_08795, SC09_Contig19orf01203' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus subtilis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1423 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A063XDJ9_BACIU _struct_ref.pdbx_db_accession A0A063XDJ9 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MLNILKNWKNQQTAASNLERYTKEDILKGEIPEHIAIIMDGNGRWAKKRSLPRIAGHHEGMKVVKRTTKLANELGVKVLT LYAFSTENWKRPKMEVDFLMKLPEEFLNTYLPELVEENVQVRIIGDETALPAHTLRAIEKAVQDTAQNDGMILNFALNYG GRTEIVSAAKSLAEKVKEGSLNIEDIDESLFSTYLMTESLQDPELLIRTSGEIRLSNFMLWQVAYSEFVFTDVLWPDFKE DHFLQALGEFQQRGRRFGGI ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7JLR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 260 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A063XDJ9 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 260 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 260 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 V0D non-polymer . '7-(azepan-1-yl)-5-ethyl-3-(4-fluorophenyl)pyrazolo[1,5-a]pyrimidine' ? 'C20 H23 F N4' 338.422 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7JLR _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.44 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 49.60 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity 0.190 _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 294 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'PEG 3000, NaCitrate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 S 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-05-30 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97949 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'CLSI BEAMLINE 08ID-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97949 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 08ID-1 _diffrn_source.pdbx_synchrotron_site CLSI # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7JLR _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.200 _reflns.d_resolution_low 48.170 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 15845 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.400 _reflns.pdbx_Rmerge_I_obs 0.080 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 17.300 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects 1 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.084 _reflns.pdbx_Rpim_I_all 0.024 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 195859 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.000 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 2.200 2.270 ? ? 16993 ? ? ? 1332 100.000 ? ? ? ? 1.340 ? ? ? ? ? ? ? ? 12.800 ? ? ? 2.000 1.395 0.387 ? 1 1 0.920 ? ? 9.070 48.170 ? ? 2852 ? ? ? 296 99.700 ? ? ? ? 0.028 ? ? ? ? ? ? ? ? 9.600 ? ? ? 63.300 0.029 0.009 ? 2 1 1.000 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 143.370 _refine.B_iso_mean 70.6329 _refine.B_iso_min 33.090 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7JLR _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.2000 _refine.ls_d_res_low 42.51 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 15777 _refine.ls_number_reflns_R_free 786 _refine.ls_number_reflns_R_work 14913 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.4800 _refine.ls_percent_reflns_R_free 5.0100 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2038 _refine.ls_R_factor_R_free 0.2487 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2013 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 7JLI _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 34.4700 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2000 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.2000 _refine_hist.d_res_low 42.51 _refine_hist.number_atoms_solvent 53 _refine_hist.number_atoms_total 1983 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 237 _refine_hist.pdbx_B_iso_mean_ligand 79.98 _refine_hist.pdbx_B_iso_mean_solvent 61.96 _refine_hist.pdbx_number_atoms_protein 1905 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 25 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.2000 2.3400 2547 . 128 2419 99.0000 . . . 0.3591 0.0000 0.3299 . . . . . . . 6 . . . 'X-RAY DIFFRACTION' 2.3400 2.5200 2543 . 126 2417 99.0000 . . . 0.3193 0.0000 0.2716 . . . . . . . 6 . . . 'X-RAY DIFFRACTION' 2.5200 2.7700 2553 . 128 2425 99.0000 . . . 0.3352 0.0000 0.2580 . . . . . . . 6 . . . 'X-RAY DIFFRACTION' 2.7700 3.1700 2608 . 132 2476 100.0000 . . . 0.3661 0.0000 0.2454 . . . . . . . 6 . . . 'X-RAY DIFFRACTION' 3.1700 4.0000 2624 . 130 2494 100.0000 . . . 0.2791 0.0000 0.2021 . . . . . . . 6 . . . 'X-RAY DIFFRACTION' 4.0000 48.1700 2824 . 142 2682 100.0000 . . . 0.1776 0.0000 0.1600 . . . . . . . 6 . . . # _struct.entry_id 7JLR _struct.title 'Crystal structure of Bacillus subtilis UppS in complex with JPD447' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7JLR _struct_keywords.text 'undecaprenyl, cis-prenyltransferase, carrier lipid, JPD447, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 22 ? GLY A 29 ? THR A 22 GLY A 29 1 ? 8 HELX_P HELX_P2 AA2 GLY A 41 ? ARG A 49 ? GLY A 41 ARG A 49 1 ? 9 HELX_P HELX_P3 AA3 PRO A 52 ? LEU A 74 ? PRO A 52 LEU A 74 1 ? 23 HELX_P HELX_P4 AA4 PRO A 92 ? GLU A 117 ? PRO A 92 GLU A 117 1 ? 26 HELX_P HELX_P5 AA5 ASP A 126 ? LEU A 130 ? ASP A 126 LEU A 130 5 ? 5 HELX_P HELX_P6 AA6 PRO A 131 ? ALA A 146 ? PRO A 131 ALA A 146 1 ? 16 HELX_P HELX_P7 AA7 GLY A 160 ? GLY A 179 ? GLY A 160 GLY A 179 1 ? 20 HELX_P HELX_P8 AA8 ASN A 182 ? ILE A 186 ? ASN A 182 ILE A 186 5 ? 5 HELX_P HELX_P9 AA9 ASP A 187 ? TYR A 194 ? ASP A 187 TYR A 194 1 ? 8 HELX_P HELX_P10 AB1 LEU A 234 ? PHE A 238 ? LEU A 234 PHE A 238 5 ? 5 HELX_P HELX_P11 AB2 LYS A 239 ? ARG A 255 ? LYS A 239 ARG A 255 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLN A 120 ? ILE A 124 ? GLN A 120 ILE A 124 AA1 2 ILE A 152 ? ALA A 156 ? ILE A 152 ALA A 156 AA1 3 VAL A 78 ? TYR A 82 ? VAL A 78 TYR A 82 AA1 4 HIS A 34 ? ILE A 38 ? HIS A 34 ILE A 38 AA1 5 LEU A 205 ? ARG A 208 ? LEU A 205 ARG A 208 AA1 6 GLU A 227 ? PHE A 230 ? GLU A 227 PHE A 230 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLN A 120 ? N GLN A 120 O LEU A 153 ? O LEU A 153 AA1 2 3 O ILE A 152 ? O ILE A 152 N LEU A 79 ? N LEU A 79 AA1 3 4 O THR A 80 ? O THR A 80 N ILE A 35 ? N ILE A 35 AA1 4 5 N ILE A 38 ? N ILE A 38 O ILE A 207 ? O ILE A 207 AA1 5 6 N LEU A 206 ? N LEU A 206 O GLU A 227 ? O GLU A 227 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id V0D _struct_site.pdbx_auth_seq_id 301 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 15 _struct_site.details 'binding site for residue V0D A 301' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 15 MET A 39 ? MET A 39 . ? 1_555 ? 2 AC1 15 ASN A 42 ? ASN A 42 . ? 1_555 ? 3 AC1 15 HIS A 57 ? HIS A 57 . ? 1_555 ? 4 AC1 15 GLY A 60 ? GLY A 60 . ? 1_555 ? 5 AC1 15 MET A 61 ? MET A 61 . ? 1_555 ? 6 AC1 15 ALA A 83 ? ALA A 83 . ? 1_555 ? 7 AC1 15 LEU A 99 ? LEU A 99 . ? 1_555 ? 8 AC1 15 LEU A 102 ? LEU A 102 . ? 1_555 ? 9 AC1 15 PRO A 103 ? PRO A 103 . ? 1_555 ? 10 AC1 15 PHE A 106 ? PHE A 106 . ? 1_555 ? 11 AC1 15 LEU A 107 ? LEU A 107 . ? 1_555 ? 12 AC1 15 PHE A 155 ? PHE A 155 . ? 1_555 ? 13 AC1 15 LEU A 157 ? LEU A 157 . ? 1_555 ? 14 AC1 15 TRP A 235 ? TRP A 235 . ? 1_555 ? 15 AC1 15 HOH C . ? HOH A 402 . ? 1_555 ? # _atom_sites.entry_id 7JLR _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.016635 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016635 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006209 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C F N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 LEU 2 2 ? ? ? A . n A 1 3 ASN 3 3 ? ? ? A . n A 1 4 ILE 4 4 ? ? ? A . n A 1 5 LEU 5 5 ? ? ? A . n A 1 6 LYS 6 6 ? ? ? A . n A 1 7 ASN 7 7 ? ? ? A . n A 1 8 TRP 8 8 ? ? ? A . n A 1 9 LYS 9 9 ? ? ? A . n A 1 10 ASN 10 10 ? ? ? A . n A 1 11 GLN 11 11 ? ? ? A . n A 1 12 GLN 12 12 ? ? ? A . n A 1 13 THR 13 13 ? ? ? A . n A 1 14 ALA 14 14 ? ? ? A . n A 1 15 ALA 15 15 ? ? ? A . n A 1 16 SER 16 16 ? ? ? A . n A 1 17 ASN 17 17 ? ? ? A . n A 1 18 LEU 18 18 ? ? ? A . n A 1 19 GLU 19 19 ? ? ? A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 HIS 34 34 34 HIS HIS A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 MET 39 39 39 MET MET A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 TRP 45 45 45 TRP TRP A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 HIS 57 57 57 HIS HIS A . n A 1 58 HIS 58 58 58 HIS HIS A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 MET 61 61 61 MET MET A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 ASN 72 72 72 ASN ASN A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 TYR 82 82 82 TYR TYR A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 PHE 84 84 84 PHE PHE A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 THR 86 86 ? ? ? A . n A 1 87 GLU 87 87 ? ? ? A . n A 1 88 ASN 88 88 ? ? ? A . n A 1 89 TRP 89 89 ? ? ? A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 MET 94 94 94 MET MET A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 ASP 97 97 97 ASP ASP A . n A 1 98 PHE 98 98 98 PHE PHE A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 MET 100 100 100 MET MET A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 PRO 103 103 103 PRO PRO A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 PHE 106 106 106 PHE PHE A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 ASN 108 108 108 ASN ASN A . n A 1 109 THR 109 109 109 THR THR A . n A 1 110 TYR 110 110 110 TYR TYR A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 PRO 112 112 112 PRO PRO A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 VAL 115 115 115 VAL VAL A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 GLU 117 117 117 GLU GLU A . n A 1 118 ASN 118 118 118 ASN ASN A . n A 1 119 VAL 119 119 119 VAL VAL A . n A 1 120 GLN 120 120 120 GLN GLN A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 ARG 122 122 122 ARG ARG A . n A 1 123 ILE 123 123 123 ILE ILE A . n A 1 124 ILE 124 124 124 ILE ILE A . n A 1 125 GLY 125 125 125 GLY GLY A . n A 1 126 ASP 126 126 126 ASP ASP A . n A 1 127 GLU 127 127 127 GLU GLU A . n A 1 128 THR 128 128 128 THR THR A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 PRO 131 131 131 PRO PRO A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 HIS 133 133 133 HIS HIS A . n A 1 134 THR 134 134 134 THR THR A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 ARG 136 136 136 ARG ARG A . n A 1 137 ALA 137 137 137 ALA ALA A . n A 1 138 ILE 138 138 138 ILE ILE A . n A 1 139 GLU 139 139 139 GLU GLU A . n A 1 140 LYS 140 140 140 LYS LYS A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 GLN 143 143 143 GLN GLN A . n A 1 144 ASP 144 144 144 ASP ASP A . n A 1 145 THR 145 145 145 THR THR A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 GLN 147 147 147 GLN GLN A . n A 1 148 ASN 148 148 148 ASN ASN A . n A 1 149 ASP 149 149 149 ASP ASP A . n A 1 150 GLY 150 150 150 GLY GLY A . n A 1 151 MET 151 151 151 MET MET A . n A 1 152 ILE 152 152 152 ILE ILE A . n A 1 153 LEU 153 153 153 LEU LEU A . n A 1 154 ASN 154 154 154 ASN ASN A . n A 1 155 PHE 155 155 155 PHE PHE A . n A 1 156 ALA 156 156 156 ALA ALA A . n A 1 157 LEU 157 157 157 LEU LEU A . n A 1 158 ASN 158 158 158 ASN ASN A . n A 1 159 TYR 159 159 159 TYR TYR A . n A 1 160 GLY 160 160 160 GLY GLY A . n A 1 161 GLY 161 161 161 GLY GLY A . n A 1 162 ARG 162 162 162 ARG ARG A . n A 1 163 THR 163 163 163 THR THR A . n A 1 164 GLU 164 164 164 GLU GLU A . n A 1 165 ILE 165 165 165 ILE ILE A . n A 1 166 VAL 166 166 166 VAL VAL A . n A 1 167 SER 167 167 167 SER SER A . n A 1 168 ALA 168 168 168 ALA ALA A . n A 1 169 ALA 169 169 169 ALA ALA A . n A 1 170 LYS 170 170 170 LYS LYS A . n A 1 171 SER 171 171 171 SER SER A . n A 1 172 LEU 172 172 172 LEU LEU A . n A 1 173 ALA 173 173 173 ALA ALA A . n A 1 174 GLU 174 174 174 GLU GLU A . n A 1 175 LYS 175 175 175 LYS LYS A . n A 1 176 VAL 176 176 176 VAL VAL A . n A 1 177 LYS 177 177 177 LYS LYS A . n A 1 178 GLU 178 178 178 GLU GLU A . n A 1 179 GLY 179 179 179 GLY GLY A . n A 1 180 SER 180 180 180 SER SER A . n A 1 181 LEU 181 181 181 LEU LEU A . n A 1 182 ASN 182 182 182 ASN ASN A . n A 1 183 ILE 183 183 183 ILE ILE A . n A 1 184 GLU 184 184 184 GLU GLU A . n A 1 185 ASP 185 185 185 ASP ASP A . n A 1 186 ILE 186 186 186 ILE ILE A . n A 1 187 ASP 187 187 187 ASP ASP A . n A 1 188 GLU 188 188 188 GLU GLU A . n A 1 189 SER 189 189 189 SER SER A . n A 1 190 LEU 190 190 190 LEU LEU A . n A 1 191 PHE 191 191 191 PHE PHE A . n A 1 192 SER 192 192 192 SER SER A . n A 1 193 THR 193 193 193 THR THR A . n A 1 194 TYR 194 194 194 TYR TYR A . n A 1 195 LEU 195 195 195 LEU LEU A . n A 1 196 MET 196 196 196 MET MET A . n A 1 197 THR 197 197 197 THR THR A . n A 1 198 GLU 198 198 198 GLU GLU A . n A 1 199 SER 199 199 199 SER SER A . n A 1 200 LEU 200 200 200 LEU LEU A . n A 1 201 GLN 201 201 201 GLN GLN A . n A 1 202 ASP 202 202 202 ASP ASP A . n A 1 203 PRO 203 203 203 PRO PRO A . n A 1 204 GLU 204 204 204 GLU GLU A . n A 1 205 LEU 205 205 205 LEU LEU A . n A 1 206 LEU 206 206 206 LEU LEU A . n A 1 207 ILE 207 207 207 ILE ILE A . n A 1 208 ARG 208 208 208 ARG ARG A . n A 1 209 THR 209 209 209 THR THR A . n A 1 210 SER 210 210 210 SER SER A . n A 1 211 GLY 211 211 211 GLY GLY A . n A 1 212 GLU 212 212 212 GLU GLU A . n A 1 213 ILE 213 213 213 ILE ILE A . n A 1 214 ARG 214 214 214 ARG ARG A . n A 1 215 LEU 215 215 215 LEU LEU A . n A 1 216 SER 216 216 216 SER SER A . n A 1 217 ASN 217 217 217 ASN ASN A . n A 1 218 PHE 218 218 218 PHE PHE A . n A 1 219 MET 219 219 219 MET MET A . n A 1 220 LEU 220 220 220 LEU LEU A . n A 1 221 TRP 221 221 221 TRP TRP A . n A 1 222 GLN 222 222 222 GLN GLN A . n A 1 223 VAL 223 223 223 VAL VAL A . n A 1 224 ALA 224 224 224 ALA ALA A . n A 1 225 TYR 225 225 225 TYR TYR A . n A 1 226 SER 226 226 226 SER SER A . n A 1 227 GLU 227 227 227 GLU GLU A . n A 1 228 PHE 228 228 228 PHE PHE A . n A 1 229 VAL 229 229 229 VAL VAL A . n A 1 230 PHE 230 230 230 PHE PHE A . n A 1 231 THR 231 231 231 THR THR A . n A 1 232 ASP 232 232 232 ASP ASP A . n A 1 233 VAL 233 233 233 VAL VAL A . n A 1 234 LEU 234 234 234 LEU LEU A . n A 1 235 TRP 235 235 235 TRP TRP A . n A 1 236 PRO 236 236 236 PRO PRO A . n A 1 237 ASP 237 237 237 ASP ASP A . n A 1 238 PHE 238 238 238 PHE PHE A . n A 1 239 LYS 239 239 239 LYS LYS A . n A 1 240 GLU 240 240 240 GLU GLU A . n A 1 241 ASP 241 241 241 ASP ASP A . n A 1 242 HIS 242 242 242 HIS HIS A . n A 1 243 PHE 243 243 243 PHE PHE A . n A 1 244 LEU 244 244 244 LEU LEU A . n A 1 245 GLN 245 245 245 GLN GLN A . n A 1 246 ALA 246 246 246 ALA ALA A . n A 1 247 LEU 247 247 247 LEU LEU A . n A 1 248 GLY 248 248 248 GLY GLY A . n A 1 249 GLU 249 249 249 GLU GLU A . n A 1 250 PHE 250 250 250 PHE PHE A . n A 1 251 GLN 251 251 251 GLN GLN A . n A 1 252 GLN 252 252 252 GLN GLN A . n A 1 253 ARG 253 253 253 ARG ARG A . n A 1 254 GLY 254 254 254 GLY GLY A . n A 1 255 ARG 255 255 255 ARG ARG A . n A 1 256 ARG 256 256 256 ARG ARG A . n A 1 257 PHE 257 257 257 PHE PHE A . n A 1 258 GLY 258 258 258 GLY GLY A . n A 1 259 GLY 259 259 259 GLY GLY A . n A 1 260 ILE 260 260 260 ILE ILE A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 V0D 1 301 301 V0D JPD A . C 3 HOH 1 401 26 HOH HOH A . C 3 HOH 2 402 40 HOH HOH A . C 3 HOH 3 403 46 HOH HOH A . C 3 HOH 4 404 14 HOH HOH A . C 3 HOH 5 405 32 HOH HOH A . C 3 HOH 6 406 22 HOH HOH A . C 3 HOH 7 407 17 HOH HOH A . C 3 HOH 8 408 30 HOH HOH A . C 3 HOH 9 409 21 HOH HOH A . C 3 HOH 10 410 31 HOH HOH A . C 3 HOH 11 411 13 HOH HOH A . C 3 HOH 12 412 3 HOH HOH A . C 3 HOH 13 413 39 HOH HOH A . C 3 HOH 14 414 36 HOH HOH A . C 3 HOH 15 415 11 HOH HOH A . C 3 HOH 16 416 15 HOH HOH A . C 3 HOH 17 417 25 HOH HOH A . C 3 HOH 18 418 38 HOH HOH A . C 3 HOH 19 419 16 HOH HOH A . C 3 HOH 20 420 56 HOH HOH A . C 3 HOH 21 421 37 HOH HOH A . C 3 HOH 22 422 4 HOH HOH A . C 3 HOH 23 423 20 HOH HOH A . C 3 HOH 24 424 55 HOH HOH A . C 3 HOH 25 425 44 HOH HOH A . C 3 HOH 26 426 23 HOH HOH A . C 3 HOH 27 427 2 HOH HOH A . C 3 HOH 28 428 5 HOH HOH A . C 3 HOH 29 429 52 HOH HOH A . C 3 HOH 30 430 47 HOH HOH A . C 3 HOH 31 431 45 HOH HOH A . C 3 HOH 32 432 1 HOH HOH A . C 3 HOH 33 433 6 HOH HOH A . C 3 HOH 34 434 18 HOH HOH A . C 3 HOH 35 435 54 HOH HOH A . C 3 HOH 36 436 58 HOH HOH A . C 3 HOH 37 437 10 HOH HOH A . C 3 HOH 38 438 41 HOH HOH A . C 3 HOH 39 439 12 HOH HOH A . C 3 HOH 40 440 35 HOH HOH A . C 3 HOH 41 441 48 HOH HOH A . C 3 HOH 42 442 9 HOH HOH A . C 3 HOH 43 443 50 HOH HOH A . C 3 HOH 44 444 27 HOH HOH A . C 3 HOH 45 445 51 HOH HOH A . C 3 HOH 46 446 33 HOH HOH A . C 3 HOH 47 447 28 HOH HOH A . C 3 HOH 48 448 49 HOH HOH A . C 3 HOH 49 449 19 HOH HOH A . C 3 HOH 50 450 8 HOH HOH A . C 3 HOH 51 451 43 HOH HOH A . C 3 HOH 52 452 57 HOH HOH A . C 3 HOH 53 453 53 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3920 ? 1 MORE -12 ? 1 'SSA (A^2)' 21950 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_554 -y,-x,-z-1/2 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -80.5335000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-08-04 2 'Structure model' 1 1 2021-09-15 3 'Structure model' 1 2 2021-10-06 4 'Structure model' 1 3 2023-10-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' database_2 4 3 'Structure model' citation 5 3 'Structure model' citation_author 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond 8 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 2 'Structure model' '_database_2.pdbx_DOI' 11 2 'Structure model' '_database_2.pdbx_database_accession' 12 3 'Structure model' '_citation.journal_volume' 13 3 'Structure model' '_citation.page_first' 14 3 'Structure model' '_citation.page_last' 15 3 'Structure model' '_citation_author.identifier_ORCID' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 9.6088 11.8618 -32.9907 0.4619 ? -0.0791 ? -0.1340 ? 0.8451 ? 0.0329 ? 0.4304 ? 7.2900 ? 0.2911 ? -1.8925 ? 8.4110 ? -1.0094 ? 5.8648 ? 0.1227 ? 0.0130 ? 0.3636 ? 0.1578 ? 0.0049 ? -1.1421 ? 0.2602 ? 1.2757 ? -0.1195 ? 2 'X-RAY DIFFRACTION' ? refined 1.7360 4.4067 -17.8702 0.6254 ? 0.0431 ? -0.0960 ? 0.6743 ? 0.0288 ? 0.3444 ? 2.2374 ? 2.8936 ? -4.0131 ? 8.0929 ? -7.0923 ? 8.3420 ? -0.0009 ? -0.4599 ? -0.1484 ? 0.5345 ? -0.0967 ? -0.2360 ? 0.2328 ? 0.4875 ? 0.0901 ? 3 'X-RAY DIFFRACTION' ? refined -4.8574 11.6117 -24.9795 0.5481 ? -0.1312 ? -0.0754 ? 0.7317 ? 0.0557 ? 0.4024 ? 4.3623 ? -1.4545 ? -2.3393 ? 5.3461 ? -0.5215 ? 3.4643 ? 0.1256 ? -0.4258 ? -0.5763 ? 1.0762 ? 0.0134 ? 0.3472 ? -0.1919 ? -0.4419 ? -0.0777 ? 4 'X-RAY DIFFRACTION' ? refined -4.2456 13.7532 -12.0415 0.8919 ? 0.0717 ? -0.1571 ? 0.7119 ? 0.0461 ? 0.4512 ? 7.4372 ? 5.0029 ? -0.6347 ? 8.6850 ? -0.0421 ? 9.5917 ? 0.4604 ? -1.1168 ? -0.5097 ? 1.0077 ? -0.5429 ? -0.3228 ? -0.4290 ? 0.0430 ? 0.0892 ? 5 'X-RAY DIFFRACTION' ? refined -6.4094 22.4394 -19.2265 0.7184 ? -0.0846 ? -0.0511 ? 0.7201 ? -0.0459 ? 0.3822 ? 7.8114 ? 2.2355 ? -2.6483 ? 4.9129 ? -0.2495 ? 8.3240 ? 0.2522 ? -1.2760 ? 1.0175 ? 0.5041 ? -0.3558 ? 0.4084 ? -1.1447 ? -0.2205 ? 0.0980 ? 6 'X-RAY DIFFRACTION' ? refined -10.5648 17.2543 -35.7387 0.4798 ? -0.1677 ? 0.0014 ? 0.4391 ? -0.0079 ? 0.2448 ? 4.0708 ? -3.3735 ? 1.6269 ? 4.4279 ? -1.1464 ? 3.2395 ? -0.2531 ? -0.1256 ? 0.2993 ? 0.0937 ? 0.0387 ? -0.2451 ? -0.2719 ? 0.1001 ? 0.2374 ? 7 'X-RAY DIFFRACTION' ? refined 10.1945 8.2813 -39.3230 0.4250 ? 0.0817 ? -0.0153 ? 0.8998 ? 0.1698 ? 0.5346 ? 6.7709 ? 1.5029 ? -0.3836 ? 7.8845 ? -1.7514 ? 1.2832 ? -0.4766 ? 0.8354 ? -0.8433 ? -1.1273 ? -0.7281 ? -0.8130 ? 0.8549 ? 1.4922 ? 0.8411 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 20 ? ? ? A 41 ? ? ;chain 'A' and (resid 20 through 41 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? A 42 ? ? ? A 73 ? ? ;chain 'A' and (resid 42 through 73 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? A 74 ? ? ? A 92 ? ? ;chain 'A' and (resid 74 through 92 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? A 93 ? ? ? A 116 ? ? ;chain 'A' and (resid 93 through 116 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? A 117 ? ? ? A 160 ? ? ;chain 'A' and (resid 117 through 160 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? A 161 ? ? ? A 239 ? ? ;chain 'A' and (resid 161 through 239 ) ; 7 'X-RAY DIFFRACTION' 7 ? ? A 240 ? ? ? A 260 ? ? ;chain 'A' and (resid 240 through 260 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.7.4 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.17.1_3660 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_entry_details.entry_id 7JLR _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 158 ? ? 39.70 51.87 2 1 SER A 199 ? ? -99.26 34.06 3 1 ILE A 213 ? ? -107.41 72.53 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A LEU 2 ? A LEU 2 3 1 Y 1 A ASN 3 ? A ASN 3 4 1 Y 1 A ILE 4 ? A ILE 4 5 1 Y 1 A LEU 5 ? A LEU 5 6 1 Y 1 A LYS 6 ? A LYS 6 7 1 Y 1 A ASN 7 ? A ASN 7 8 1 Y 1 A TRP 8 ? A TRP 8 9 1 Y 1 A LYS 9 ? A LYS 9 10 1 Y 1 A ASN 10 ? A ASN 10 11 1 Y 1 A GLN 11 ? A GLN 11 12 1 Y 1 A GLN 12 ? A GLN 12 13 1 Y 1 A THR 13 ? A THR 13 14 1 Y 1 A ALA 14 ? A ALA 14 15 1 Y 1 A ALA 15 ? A ALA 15 16 1 Y 1 A SER 16 ? A SER 16 17 1 Y 1 A ASN 17 ? A ASN 17 18 1 Y 1 A LEU 18 ? A LEU 18 19 1 Y 1 A GLU 19 ? A GLU 19 20 1 Y 1 A THR 86 ? A THR 86 21 1 Y 1 A GLU 87 ? A GLU 87 22 1 Y 1 A ASN 88 ? A ASN 88 23 1 Y 1 A TRP 89 ? A TRP 89 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 PHE N N N N 236 PHE CA C N S 237 PHE C C N N 238 PHE O O N N 239 PHE CB C N N 240 PHE CG C Y N 241 PHE CD1 C Y N 242 PHE CD2 C Y N 243 PHE CE1 C Y N 244 PHE CE2 C Y N 245 PHE CZ C Y N 246 PHE OXT O N N 247 PHE H H N N 248 PHE H2 H N N 249 PHE HA H N N 250 PHE HB2 H N N 251 PHE HB3 H N N 252 PHE HD1 H N N 253 PHE HD2 H N N 254 PHE HE1 H N N 255 PHE HE2 H N N 256 PHE HZ H N N 257 PHE HXT H N N 258 PRO N N N N 259 PRO CA C N S 260 PRO C C N N 261 PRO O O N N 262 PRO CB C N N 263 PRO CG C N N 264 PRO CD C N N 265 PRO OXT O N N 266 PRO H H N N 267 PRO HA H N N 268 PRO HB2 H N N 269 PRO HB3 H N N 270 PRO HG2 H N N 271 PRO HG3 H N N 272 PRO HD2 H N N 273 PRO HD3 H N N 274 PRO HXT H N N 275 SER N N N N 276 SER CA C N S 277 SER C C N N 278 SER O O N N 279 SER CB C N N 280 SER OG O N N 281 SER OXT O N N 282 SER H H N N 283 SER H2 H N N 284 SER HA H N N 285 SER HB2 H N N 286 SER HB3 H N N 287 SER HG H N N 288 SER HXT H N N 289 THR N N N N 290 THR CA C N S 291 THR C C N N 292 THR O O N N 293 THR CB C N R 294 THR OG1 O N N 295 THR CG2 C N N 296 THR OXT O N N 297 THR H H N N 298 THR H2 H N N 299 THR HA H N N 300 THR HB H N N 301 THR HG1 H N N 302 THR HG21 H N N 303 THR HG22 H N N 304 THR HG23 H N N 305 THR HXT H N N 306 TRP N N N N 307 TRP CA C N S 308 TRP C C N N 309 TRP O O N N 310 TRP CB C N N 311 TRP CG C Y N 312 TRP CD1 C Y N 313 TRP CD2 C Y N 314 TRP NE1 N Y N 315 TRP CE2 C Y N 316 TRP CE3 C Y N 317 TRP CZ2 C Y N 318 TRP CZ3 C Y N 319 TRP CH2 C Y N 320 TRP OXT O N N 321 TRP H H N N 322 TRP H2 H N N 323 TRP HA H N N 324 TRP HB2 H N N 325 TRP HB3 H N N 326 TRP HD1 H N N 327 TRP HE1 H N N 328 TRP HE3 H N N 329 TRP HZ2 H N N 330 TRP HZ3 H N N 331 TRP HH2 H N N 332 TRP HXT H N N 333 TYR N N N N 334 TYR CA C N S 335 TYR C C N N 336 TYR O O N N 337 TYR CB C N N 338 TYR CG C Y N 339 TYR CD1 C Y N 340 TYR CD2 C Y N 341 TYR CE1 C Y N 342 TYR CE2 C Y N 343 TYR CZ C Y N 344 TYR OH O N N 345 TYR OXT O N N 346 TYR H H N N 347 TYR H2 H N N 348 TYR HA H N N 349 TYR HB2 H N N 350 TYR HB3 H N N 351 TYR HD1 H N N 352 TYR HD2 H N N 353 TYR HE1 H N N 354 TYR HE2 H N N 355 TYR HH H N N 356 TYR HXT H N N 357 V0D C10 C N N 358 V0D C13 C N N 359 V0D C17 C Y N 360 V0D C12 C N N 361 V0D C14 C N N 362 V0D C1 C N N 363 V0D C11 C N N 364 V0D C15 C N N 365 V0D C18 C Y N 366 V0D C19 C Y N 367 V0D C2 C Y N 368 V0D C20 C Y N 369 V0D C21 C Y N 370 V0D C22 C Y N 371 V0D C23 C Y N 372 V0D C24 C Y N 373 V0D C4 C Y N 374 V0D C6 C Y N 375 V0D C7 C Y N 376 V0D C8 C N N 377 V0D F25 F N N 378 V0D N16 N Y N 379 V0D N3 N Y N 380 V0D N5 N Y N 381 V0D N9 N N N 382 V0D H102 H N N 383 V0D H101 H N N 384 V0D H131 H N N 385 V0D H132 H N N 386 V0D H17 H N N 387 V0D H122 H N N 388 V0D H121 H N N 389 V0D H141 H N N 390 V0D H142 H N N 391 V0D H1 H N N 392 V0D H11 H N N 393 V0D H12 H N N 394 V0D H111 H N N 395 V0D H112 H N N 396 V0D H151 H N N 397 V0D H152 H N N 398 V0D H20 H N N 399 V0D H21 H N N 400 V0D H23 H N N 401 V0D H24 H N N 402 V0D H7 H N N 403 V0D H81 H N N 404 V0D H82 H N N 405 VAL N N N N 406 VAL CA C N S 407 VAL C C N N 408 VAL O O N N 409 VAL CB C N N 410 VAL CG1 C N N 411 VAL CG2 C N N 412 VAL OXT O N N 413 VAL H H N N 414 VAL H2 H N N 415 VAL HA H N N 416 VAL HB H N N 417 VAL HG11 H N N 418 VAL HG12 H N N 419 VAL HG13 H N N 420 VAL HG21 H N N 421 VAL HG22 H N N 422 VAL HG23 H N N 423 VAL HXT H N N 424 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 THR N CA sing N N 277 THR N H sing N N 278 THR N H2 sing N N 279 THR CA C sing N N 280 THR CA CB sing N N 281 THR CA HA sing N N 282 THR C O doub N N 283 THR C OXT sing N N 284 THR CB OG1 sing N N 285 THR CB CG2 sing N N 286 THR CB HB sing N N 287 THR OG1 HG1 sing N N 288 THR CG2 HG21 sing N N 289 THR CG2 HG22 sing N N 290 THR CG2 HG23 sing N N 291 THR OXT HXT sing N N 292 TRP N CA sing N N 293 TRP N H sing N N 294 TRP N H2 sing N N 295 TRP CA C sing N N 296 TRP CA CB sing N N 297 TRP CA HA sing N N 298 TRP C O doub N N 299 TRP C OXT sing N N 300 TRP CB CG sing N N 301 TRP CB HB2 sing N N 302 TRP CB HB3 sing N N 303 TRP CG CD1 doub Y N 304 TRP CG CD2 sing Y N 305 TRP CD1 NE1 sing Y N 306 TRP CD1 HD1 sing N N 307 TRP CD2 CE2 doub Y N 308 TRP CD2 CE3 sing Y N 309 TRP NE1 CE2 sing Y N 310 TRP NE1 HE1 sing N N 311 TRP CE2 CZ2 sing Y N 312 TRP CE3 CZ3 doub Y N 313 TRP CE3 HE3 sing N N 314 TRP CZ2 CH2 doub Y N 315 TRP CZ2 HZ2 sing N N 316 TRP CZ3 CH2 sing Y N 317 TRP CZ3 HZ3 sing N N 318 TRP CH2 HH2 sing N N 319 TRP OXT HXT sing N N 320 TYR N CA sing N N 321 TYR N H sing N N 322 TYR N H2 sing N N 323 TYR CA C sing N N 324 TYR CA CB sing N N 325 TYR CA HA sing N N 326 TYR C O doub N N 327 TYR C OXT sing N N 328 TYR CB CG sing N N 329 TYR CB HB2 sing N N 330 TYR CB HB3 sing N N 331 TYR CG CD1 doub Y N 332 TYR CG CD2 sing Y N 333 TYR CD1 CE1 sing Y N 334 TYR CD1 HD1 sing N N 335 TYR CD2 CE2 doub Y N 336 TYR CD2 HD2 sing N N 337 TYR CE1 CZ doub Y N 338 TYR CE1 HE1 sing N N 339 TYR CE2 CZ sing Y N 340 TYR CE2 HE2 sing N N 341 TYR CZ OH sing N N 342 TYR OH HH sing N N 343 TYR OXT HXT sing N N 344 V0D C13 C12 sing N N 345 V0D C13 C14 sing N N 346 V0D C12 C11 sing N N 347 V0D C11 C10 sing N N 348 V0D C14 C15 sing N N 349 V0D C15 N9 sing N N 350 V0D C10 N9 sing N N 351 V0D C8 C6 sing N N 352 V0D C8 C1 sing N N 353 V0D C7 C6 sing Y N 354 V0D C7 C2 doub Y N 355 V0D C6 N5 doub Y N 356 V0D N9 C2 sing N N 357 V0D C20 C21 doub Y N 358 V0D C20 C19 sing Y N 359 V0D C2 N3 sing Y N 360 V0D N5 C4 sing Y N 361 V0D C21 C22 sing Y N 362 V0D N3 C4 sing Y N 363 V0D N3 N16 sing Y N 364 V0D C4 C18 doub Y N 365 V0D C18 C19 sing N N 366 V0D C18 C17 sing Y N 367 V0D N16 C17 doub Y N 368 V0D C19 C24 doub Y N 369 V0D C22 F25 sing N N 370 V0D C22 C23 doub Y N 371 V0D C24 C23 sing Y N 372 V0D C10 H102 sing N N 373 V0D C10 H101 sing N N 374 V0D C13 H131 sing N N 375 V0D C13 H132 sing N N 376 V0D C17 H17 sing N N 377 V0D C12 H122 sing N N 378 V0D C12 H121 sing N N 379 V0D C14 H141 sing N N 380 V0D C14 H142 sing N N 381 V0D C1 H1 sing N N 382 V0D C1 H11 sing N N 383 V0D C1 H12 sing N N 384 V0D C11 H111 sing N N 385 V0D C11 H112 sing N N 386 V0D C15 H151 sing N N 387 V0D C15 H152 sing N N 388 V0D C20 H20 sing N N 389 V0D C21 H21 sing N N 390 V0D C23 H23 sing N N 391 V0D C24 H24 sing N N 392 V0D C7 H7 sing N N 393 V0D C8 H81 sing N N 394 V0D C8 H82 sing N N 395 VAL N CA sing N N 396 VAL N H sing N N 397 VAL N H2 sing N N 398 VAL CA C sing N N 399 VAL CA CB sing N N 400 VAL CA HA sing N N 401 VAL C O doub N N 402 VAL C OXT sing N N 403 VAL CB CG1 sing N N 404 VAL CB CG2 sing N N 405 VAL CB HB sing N N 406 VAL CG1 HG11 sing N N 407 VAL CG1 HG12 sing N N 408 VAL CG1 HG13 sing N N 409 VAL CG2 HG21 sing N N 410 VAL CG2 HG22 sing N N 411 VAL CG2 HG23 sing N N 412 VAL OXT HXT sing N N 413 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Canadian Institutes of Health Research (CIHR)' Canada ? 1 'Natural Sciences and Engineering Research Council (NSERC, Canada)' Canada ? 2 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id V0D _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id V0D _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '7-(azepan-1-yl)-5-ethyl-3-(4-fluorophenyl)pyrazolo[1,5-a]pyrimidine' V0D 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 7JLI _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #