data_7KBQ # _entry.id 7KBQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7KBQ pdb_00007kbq 10.2210/pdb7kbq/pdb WWPDB D_1000252196 ? ? BMRB 30802 ? 10.13018/BMR30802 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-05-19 2 'Structure model' 1 1 2023-06-14 3 'Structure model' 1 2 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' Other 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7KBQ _pdbx_database_status.recvd_initial_deposition_date 2020-10-02 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details ;Solution NMR Structure of DE NOVO DESIGNED Rossmann 3x3 Fold Protein r3x3_bp3, Northeast Structural Genomics Consortium (NESG) Target OR689 ; _pdbx_database_related.db_id 30802 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Liu, G.' 1 0000-0002-4343-0356 'Montelione, G.T.' 2 0000-0002-9440-3059 'Northeast Structural Genomics Consortium (NESG)' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Role of backbone strain in de novo design of complex alpha/beta protein structures Accurate de novo design of asymetric alpha/beta proteins with ten or more secondary structure elements requires consideration of backbone strain Design principle proposed from designed larger alpha/beta-proteins not folded as designed: Consistency between local, non-local, and global structures ; _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Koga, N.' 1 ? primary 'Koga, R.' 2 ? primary 'Liu, G.' 3 ? primary 'Castellanos, J.' 4 ? primary 'Montelione, G.T.' 5 ? primary 'Baker, D.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'DE NOVO DESIGNED OR689' _entity.formula_weight 15823.438 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MRIIVIIVTDEQKIEDMWEILKEIGVDRIVIITSNKQLAERAKELGVDRIFLLTDDELIAEIVKKLGADIVFSENRDIAK KIIRKLKNIIILSNDEQLVKELQKEASDARVFNVQTKQDFKDLIEKILEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MRIIVIIVTDEQKIEDMWEILKEIGVDRIVIITSNKQLAERAKELGVDRIFLLTDDELIAEIVKKLGADIVFSENRDIAK KIIRKLKNIIILSNDEQLVKELQKEASDARVFNVQTKQDFKDLIEKILEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ARG n 1 3 ILE n 1 4 ILE n 1 5 VAL n 1 6 ILE n 1 7 ILE n 1 8 VAL n 1 9 THR n 1 10 ASP n 1 11 GLU n 1 12 GLN n 1 13 LYS n 1 14 ILE n 1 15 GLU n 1 16 ASP n 1 17 MET n 1 18 TRP n 1 19 GLU n 1 20 ILE n 1 21 LEU n 1 22 LYS n 1 23 GLU n 1 24 ILE n 1 25 GLY n 1 26 VAL n 1 27 ASP n 1 28 ARG n 1 29 ILE n 1 30 VAL n 1 31 ILE n 1 32 ILE n 1 33 THR n 1 34 SER n 1 35 ASN n 1 36 LYS n 1 37 GLN n 1 38 LEU n 1 39 ALA n 1 40 GLU n 1 41 ARG n 1 42 ALA n 1 43 LYS n 1 44 GLU n 1 45 LEU n 1 46 GLY n 1 47 VAL n 1 48 ASP n 1 49 ARG n 1 50 ILE n 1 51 PHE n 1 52 LEU n 1 53 LEU n 1 54 THR n 1 55 ASP n 1 56 ASP n 1 57 GLU n 1 58 LEU n 1 59 ILE n 1 60 ALA n 1 61 GLU n 1 62 ILE n 1 63 VAL n 1 64 LYS n 1 65 LYS n 1 66 LEU n 1 67 GLY n 1 68 ALA n 1 69 ASP n 1 70 ILE n 1 71 VAL n 1 72 PHE n 1 73 SER n 1 74 GLU n 1 75 ASN n 1 76 ARG n 1 77 ASP n 1 78 ILE n 1 79 ALA n 1 80 LYS n 1 81 LYS n 1 82 ILE n 1 83 ILE n 1 84 ARG n 1 85 LYS n 1 86 LEU n 1 87 LYS n 1 88 ASN n 1 89 ILE n 1 90 ILE n 1 91 ILE n 1 92 LEU n 1 93 SER n 1 94 ASN n 1 95 ASP n 1 96 GLU n 1 97 GLN n 1 98 LEU n 1 99 VAL n 1 100 LYS n 1 101 GLU n 1 102 LEU n 1 103 GLN n 1 104 LYS n 1 105 GLU n 1 106 ALA n 1 107 SER n 1 108 ASP n 1 109 ALA n 1 110 ARG n 1 111 VAL n 1 112 PHE n 1 113 ASN n 1 114 VAL n 1 115 GLN n 1 116 THR n 1 117 LYS n 1 118 GLN n 1 119 ASP n 1 120 PHE n 1 121 LYS n 1 122 ASP n 1 123 LEU n 1 124 ILE n 1 125 GLU n 1 126 LYS n 1 127 ILE n 1 128 LEU n 1 129 GLU n 1 130 HIS n 1 131 HIS n 1 132 HIS n 1 133 HIS n 1 134 HIS n 1 135 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 135 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ARG 2 2 2 ARG ARG A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 MET 17 17 17 MET MET A . n A 1 18 TRP 18 18 18 TRP TRP A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 ASN 88 88 88 ASN ASN A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 ASN 94 94 94 ASN ASN A . n A 1 95 ASP 95 95 95 ASP ASP A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 GLN 97 97 97 GLN GLN A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 GLN 103 103 103 GLN GLN A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 ASP 108 108 108 ASP ASP A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 ARG 110 110 110 ARG ARG A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 PHE 112 112 112 PHE PHE A . n A 1 113 ASN 113 113 113 ASN ASN A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 GLN 115 115 115 GLN GLN A . n A 1 116 THR 116 116 116 THR THR A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 GLN 118 118 118 GLN GLN A . n A 1 119 ASP 119 119 119 ASP ASP A . n A 1 120 PHE 120 120 120 PHE PHE A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 ASP 122 122 122 ASP ASP A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 ILE 124 124 124 ILE ILE A . n A 1 125 GLU 125 125 125 GLU GLU A . n A 1 126 LYS 126 126 126 LYS LYS A . n A 1 127 ILE 127 127 127 ILE ILE A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 GLU 129 129 129 GLU GLU A . n A 1 130 HIS 130 130 130 HIS HIS A . n A 1 131 HIS 131 131 131 HIS HIS A . n A 1 132 HIS 132 132 132 HIS HIS A . n A 1 133 HIS 133 133 133 HIS HIS A . n A 1 134 HIS 134 134 134 HIS HIS A . n A 1 135 HIS 135 135 135 HIS HIS A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7KBQ _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7KBQ _struct.title ;Solution NMR Structure of DE NOVO DESIGNED Rossmann 3x3 Fold Protein r3x3_bp3, Northeast Structural Genomics Consortium (NESG) Target OR689 ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7KBQ _struct_keywords.text 'Rossmann 3x3 fold, Structural Genomics, PSI-Biology, Northeast Structural Genomics Consortium, NESG, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 7KBQ _struct_ref.pdbx_db_accession 7KBQ _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7KBQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 135 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 7KBQ _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 135 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 135 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ILE A 24 ? ARG A 28 ? ILE A 24 ARG A 28 1 ? 5 HELX_P HELX_P2 AA2 ASN A 35 ? GLY A 46 ? ASN A 35 GLY A 46 1 ? 12 HELX_P HELX_P3 AA3 LEU A 58 ? GLY A 67 ? LEU A 58 GLY A 67 1 ? 10 HELX_P HELX_P4 AA4 ARG A 76 ? ARG A 84 ? ARG A 76 ARG A 84 1 ? 9 HELX_P HELX_P5 AA5 ASP A 95 ? ALA A 106 ? ASP A 95 ALA A 106 1 ? 12 HELX_P HELX_P6 AA6 THR A 116 ? ILE A 127 ? THR A 116 ILE A 127 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 50 ? LEU A 52 ? ILE A 50 LEU A 52 AA1 2 ILE A 29 ? THR A 33 ? ILE A 29 THR A 33 AA1 3 ILE A 4 ? ILE A 6 ? ILE A 4 ILE A 6 AA1 4 ILE A 70 ? PHE A 72 ? ILE A 70 PHE A 72 AA1 5 ILE A 90 ? SER A 93 ? ILE A 90 SER A 93 AA1 6 ARG A 110 ? ASN A 113 ? ARG A 110 ASN A 113 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O PHE A 51 ? O PHE A 51 N ILE A 31 ? N ILE A 31 AA1 2 3 O VAL A 30 ? O VAL A 30 N ILE A 6 ? N ILE A 6 AA1 3 4 N VAL A 5 ? N VAL A 5 O PHE A 72 ? O PHE A 72 AA1 4 5 N VAL A 71 ? N VAL A 71 O LEU A 92 ? O LEU A 92 AA1 5 6 N ILE A 91 ? N ILE A 91 O PHE A 112 ? O PHE A 112 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 2 ? ? -158.68 30.97 2 1 GLU A 11 ? ? -128.46 -143.02 3 1 GLU A 23 ? ? -90.47 -65.20 4 1 GLN A 115 ? ? -133.81 -54.07 5 2 ASP A 10 ? ? -144.57 -157.13 6 2 LYS A 13 ? ? 73.61 -43.38 7 2 ILE A 14 ? ? -62.96 90.49 8 2 ASP A 16 ? ? 49.22 16.26 9 2 GLU A 23 ? ? -91.96 -65.63 10 2 GLN A 115 ? ? -130.24 -39.82 11 2 LYS A 126 ? ? -108.66 -67.32 12 3 THR A 9 ? ? -154.90 -49.58 13 3 GLU A 15 ? ? -59.41 -77.65 14 3 ASN A 75 ? ? 167.65 140.33 15 3 SER A 107 ? ? -141.68 -57.68 16 3 HIS A 131 ? ? 83.34 147.18 17 4 ASP A 10 ? ? 75.77 -26.95 18 4 GLU A 23 ? ? -90.99 -65.07 19 4 THR A 54 ? ? -91.58 42.17 20 4 ASN A 75 ? ? 97.02 104.63 21 4 GLN A 115 ? ? -119.13 -71.26 22 5 ARG A 2 ? ? -153.38 -69.01 23 5 ASP A 10 ? ? -170.74 -42.71 24 5 LYS A 13 ? ? 71.03 -10.84 25 5 GLU A 23 ? ? -90.03 -65.78 26 5 THR A 54 ? ? -94.29 36.50 27 5 ASP A 56 ? ? -86.37 -77.23 28 5 ASN A 75 ? ? 178.74 94.72 29 5 SER A 107 ? ? -136.43 -53.33 30 5 GLN A 115 ? ? -123.42 -57.10 31 5 LEU A 128 ? ? -68.92 95.67 32 5 HIS A 134 ? ? -131.54 -54.64 33 6 THR A 9 ? ? 87.77 -45.56 34 6 ILE A 14 ? ? 71.65 -52.90 35 6 GLU A 15 ? ? 51.92 -93.31 36 6 MET A 17 ? ? -168.47 29.45 37 6 ASN A 75 ? ? -171.21 107.04 38 6 HIS A 134 ? ? 170.39 103.96 39 7 LYS A 13 ? ? -165.08 -165.52 40 7 ILE A 14 ? ? 80.99 -42.28 41 7 ASN A 75 ? ? -178.78 111.40 42 7 HIS A 132 ? ? -142.99 57.61 43 7 HIS A 133 ? ? 48.28 -89.13 44 7 HIS A 134 ? ? 67.85 -73.88 45 8 THR A 9 ? ? -152.60 -56.06 46 8 LYS A 13 ? ? -69.51 87.87 47 8 GLU A 23 ? ? -91.11 -64.98 48 8 ARG A 28 ? ? -143.30 18.37 49 8 ASN A 75 ? ? -170.30 94.68 50 8 SER A 107 ? ? -81.64 -75.08 51 8 GLN A 115 ? ? -107.22 -66.13 52 8 HIS A 130 ? ? -139.18 -59.49 53 8 HIS A 132 ? ? 171.12 -15.00 54 8 HIS A 133 ? ? -64.92 85.75 55 8 HIS A 134 ? ? -173.94 120.18 56 9 ASP A 10 ? ? -175.47 137.49 57 9 GLN A 12 ? ? -168.24 26.18 58 9 MET A 17 ? ? 64.61 93.97 59 9 ASN A 75 ? ? 172.69 108.12 60 9 LEU A 128 ? ? -65.35 97.86 61 9 HIS A 133 ? ? -66.66 89.85 62 10 GLU A 15 ? ? -92.02 46.90 63 10 ASP A 16 ? ? 68.26 -8.67 64 10 ARG A 28 ? ? -145.62 16.39 65 10 ASN A 75 ? ? 69.78 124.81 66 10 SER A 107 ? ? -120.04 -55.92 67 10 LYS A 126 ? ? -93.30 -65.45 68 10 HIS A 131 ? ? -53.82 94.20 69 11 THR A 9 ? ? -153.90 -69.11 70 11 LYS A 13 ? ? -154.15 15.08 71 11 ARG A 28 ? ? -133.33 -40.31 72 11 ASN A 75 ? ? 75.85 124.63 73 11 SER A 107 ? ? -139.01 -53.36 74 12 GLN A 12 ? ? 65.73 90.49 75 12 THR A 54 ? ? -89.80 48.86 76 12 ASN A 75 ? ? 176.55 128.62 77 12 HIS A 130 ? ? -63.82 82.74 78 13 THR A 9 ? ? -133.42 -70.99 79 13 MET A 17 ? ? -99.30 31.36 80 13 ASN A 75 ? ? 174.44 106.09 81 13 SER A 107 ? ? -78.19 -72.93 82 13 GLN A 115 ? ? -151.14 -33.96 83 13 LEU A 128 ? ? -51.06 104.63 84 13 HIS A 132 ? ? 60.42 -157.37 85 14 THR A 9 ? ? -142.46 -25.26 86 14 ASP A 16 ? ? -177.04 88.95 87 14 GLU A 23 ? ? -90.20 -66.47 88 14 ARG A 28 ? ? -161.09 29.57 89 14 ASN A 75 ? ? -170.97 144.03 90 14 HIS A 130 ? ? 73.56 97.45 91 14 HIS A 132 ? ? -114.39 79.52 92 14 HIS A 133 ? ? 42.78 75.63 93 15 ASP A 10 ? ? -68.08 -172.15 94 15 GLU A 11 ? ? -57.38 108.18 95 15 GLU A 23 ? ? -90.31 -66.27 96 15 ASN A 75 ? ? 96.06 145.95 97 15 LEU A 128 ? ? 69.78 -76.44 98 15 GLU A 129 ? ? 62.10 -80.51 99 16 THR A 9 ? ? -138.97 -58.23 100 16 ASP A 10 ? ? -116.09 -128.23 101 16 LYS A 13 ? ? -153.93 27.93 102 16 ARG A 28 ? ? -141.38 13.85 103 16 ASN A 75 ? ? -173.50 144.23 104 16 GLN A 115 ? ? -109.72 -64.48 105 17 THR A 9 ? ? -106.41 -63.59 106 17 ASP A 10 ? ? -132.71 -32.86 107 17 GLN A 12 ? ? -69.10 88.05 108 17 ASP A 16 ? ? 56.13 82.40 109 17 MET A 17 ? ? -154.44 17.13 110 17 ASN A 75 ? ? -179.41 144.27 111 17 GLN A 115 ? ? -134.25 -33.05 112 17 LEU A 128 ? ? 74.80 -44.22 113 17 GLU A 129 ? ? 62.90 -82.42 114 17 HIS A 134 ? ? -118.06 73.53 115 18 ASP A 10 ? ? 62.16 79.99 116 18 GLU A 15 ? ? -66.27 79.95 117 18 ASN A 75 ? ? 99.52 138.01 118 19 THR A 9 ? ? -165.36 -71.92 119 19 ASN A 75 ? ? -161.47 105.19 120 19 HIS A 134 ? ? -158.21 -95.18 121 20 ASP A 10 ? ? -130.09 -76.63 122 20 GLU A 11 ? ? -79.51 -167.65 123 20 LYS A 13 ? ? -158.16 -18.09 124 20 GLU A 15 ? ? -151.68 -58.07 125 20 MET A 17 ? ? -88.52 40.39 126 20 GLU A 23 ? ? -92.05 -62.72 127 20 ASN A 75 ? ? 86.25 141.04 128 20 ASP A 95 ? ? -58.44 107.69 129 20 SER A 107 ? ? -83.71 -78.50 130 20 HIS A 134 ? ? 50.98 -171.50 # _pdbx_nmr_ensemble.entry_id 7KBQ _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7KBQ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria medoid # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.6 mM [U-100% 13C; U-100% 15N] OR689, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label NC _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component OR689 _pdbx_nmr_exptl_sample.concentration 0.6 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-100% 13C; U-100% 15N]' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label condition_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '2D 1H-13C HSQC aliphatic' 1 isotropic 3 1 1 '3D HNCO' 1 isotropic 4 1 1 '3D HNCACB' 1 isotropic 5 1 1 '3D CBCA(CO)NH' 1 isotropic 6 1 1 '3D SIMUTANEOUS 1H, 15N, 13C NOESY' 1 isotropic 7 1 1 '3D HCCH-TOCSY' 1 isotropic # _pdbx_nmr_refine.entry_id 7KBQ _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CNS ? 'Brunger, Adams, Clore, Gros, Nilges and Read' 2 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 3 'chemical shift assignment' AutoAssign ? 'Zimmerman, Moseley, Kulikowski and Montelione' 4 'peak picking' XEASY ? 'Bartels et al.' 6 'structure calculation' ASDP ? 'Huang, Montelione' 5 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 SER N N N N 256 SER CA C N S 257 SER C C N N 258 SER O O N N 259 SER CB C N N 260 SER OG O N N 261 SER OXT O N N 262 SER H H N N 263 SER H2 H N N 264 SER HA H N N 265 SER HB2 H N N 266 SER HB3 H N N 267 SER HG H N N 268 SER HXT H N N 269 THR N N N N 270 THR CA C N S 271 THR C C N N 272 THR O O N N 273 THR CB C N R 274 THR OG1 O N N 275 THR CG2 C N N 276 THR OXT O N N 277 THR H H N N 278 THR H2 H N N 279 THR HA H N N 280 THR HB H N N 281 THR HG1 H N N 282 THR HG21 H N N 283 THR HG22 H N N 284 THR HG23 H N N 285 THR HXT H N N 286 TRP N N N N 287 TRP CA C N S 288 TRP C C N N 289 TRP O O N N 290 TRP CB C N N 291 TRP CG C Y N 292 TRP CD1 C Y N 293 TRP CD2 C Y N 294 TRP NE1 N Y N 295 TRP CE2 C Y N 296 TRP CE3 C Y N 297 TRP CZ2 C Y N 298 TRP CZ3 C Y N 299 TRP CH2 C Y N 300 TRP OXT O N N 301 TRP H H N N 302 TRP H2 H N N 303 TRP HA H N N 304 TRP HB2 H N N 305 TRP HB3 H N N 306 TRP HD1 H N N 307 TRP HE1 H N N 308 TRP HE3 H N N 309 TRP HZ2 H N N 310 TRP HZ3 H N N 311 TRP HH2 H N N 312 TRP HXT H N N 313 VAL N N N N 314 VAL CA C N S 315 VAL C C N N 316 VAL O O N N 317 VAL CB C N N 318 VAL CG1 C N N 319 VAL CG2 C N N 320 VAL OXT O N N 321 VAL H H N N 322 VAL H2 H N N 323 VAL HA H N N 324 VAL HB H N N 325 VAL HG11 H N N 326 VAL HG12 H N N 327 VAL HG13 H N N 328 VAL HG21 H N N 329 VAL HG22 H N N 330 VAL HG23 H N N 331 VAL HXT H N N 332 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 SER N CA sing N N 245 SER N H sing N N 246 SER N H2 sing N N 247 SER CA C sing N N 248 SER CA CB sing N N 249 SER CA HA sing N N 250 SER C O doub N N 251 SER C OXT sing N N 252 SER CB OG sing N N 253 SER CB HB2 sing N N 254 SER CB HB3 sing N N 255 SER OG HG sing N N 256 SER OXT HXT sing N N 257 THR N CA sing N N 258 THR N H sing N N 259 THR N H2 sing N N 260 THR CA C sing N N 261 THR CA CB sing N N 262 THR CA HA sing N N 263 THR C O doub N N 264 THR C OXT sing N N 265 THR CB OG1 sing N N 266 THR CB CG2 sing N N 267 THR CB HB sing N N 268 THR OG1 HG1 sing N N 269 THR CG2 HG21 sing N N 270 THR CG2 HG22 sing N N 271 THR CG2 HG23 sing N N 272 THR OXT HXT sing N N 273 TRP N CA sing N N 274 TRP N H sing N N 275 TRP N H2 sing N N 276 TRP CA C sing N N 277 TRP CA CB sing N N 278 TRP CA HA sing N N 279 TRP C O doub N N 280 TRP C OXT sing N N 281 TRP CB CG sing N N 282 TRP CB HB2 sing N N 283 TRP CB HB3 sing N N 284 TRP CG CD1 doub Y N 285 TRP CG CD2 sing Y N 286 TRP CD1 NE1 sing Y N 287 TRP CD1 HD1 sing N N 288 TRP CD2 CE2 doub Y N 289 TRP CD2 CE3 sing Y N 290 TRP NE1 CE2 sing Y N 291 TRP NE1 HE1 sing N N 292 TRP CE2 CZ2 sing Y N 293 TRP CE3 CZ3 doub Y N 294 TRP CE3 HE3 sing N N 295 TRP CZ2 CH2 doub Y N 296 TRP CZ2 HZ2 sing N N 297 TRP CZ3 CH2 sing Y N 298 TRP CZ3 HZ3 sing N N 299 TRP CH2 HH2 sing N N 300 TRP OXT HXT sing N N 301 VAL N CA sing N N 302 VAL N H sing N N 303 VAL N H2 sing N N 304 VAL CA C sing N N 305 VAL CA CB sing N N 306 VAL CA HA sing N N 307 VAL C O doub N N 308 VAL C OXT sing N N 309 VAL CB CG1 sing N N 310 VAL CB CG2 sing N N 311 VAL CB HB sing N N 312 VAL CG1 HG11 sing N N 313 VAL CG1 HG12 sing N N 314 VAL CG1 HG13 sing N N 315 VAL CG2 HG21 sing N N 316 VAL CG2 HG22 sing N N 317 VAL CG2 HG23 sing N N 318 VAL OXT HXT sing N N 319 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 7KBQ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #