data_7KCG # _entry.id 7KCG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7KCG pdb_00007kcg 10.2210/pdb7kcg/pdb WWPDB D_1000252220 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-06-02 2 'Structure model' 1 1 2024-04-03 3 'Structure model' 1 2 2024-11-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' 4 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model 5 3 'Structure model' pdbx_entry_details 6 3 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7KCG _pdbx_database_status.recvd_initial_deposition_date 2020-10-05 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Garboczi, N.D.' 1 0000-0002-2545-854X 'Gittis, A.G.' 2 0000-0002-8823-9440 'Kern, O.' 3 0000-0003-3577-5423 'Martin-Martin, I.' 4 0000-0002-0956-7324 'Calvo, E.' 5 0000-0001-7880-2730 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Curr Res Struct Biol' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2665-928X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 3 _citation.language ? _citation.page_first 95 _citation.page_last 105 _citation.title ;The structures of two salivary proteins from the West Nile vector Culex quinquefasciatus reveal a beta-trefoil fold with putative sugar binding properties ; _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.crstbi.2021.03.001 _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kern, O.' 1 ? primary 'Valenzuela Leon, P.C.' 2 ? primary 'Gittis, A.G.' 3 ? primary 'Bonilla, B.' 4 ? primary 'Cruz, P.' 5 ? primary 'Chagas, A.C.' 6 ? primary 'Ganesan, S.' 7 ? primary 'Ribeiro, J.M.' 8 ? primary 'Garboczi, D.N.' 9 ? primary 'Martin-Martin, I.' 10 ? primary 'Calvo, E.' 11 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man '16 kDa salivary peptide' 16467.473 1 ? ? ? ? 2 non-polymer syn 'FORMIC ACID' 46.025 3 ? ? ? ? 3 water nat water 18.015 30 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;HMLAADVPTGCVTIKNRHEGRYLAHSISTHDADRRHVSFCTDPQRWTITAEGTNFRIRNNKHGEELFESQQKFNGNYVFL WIKKSLINDGGASWKITESGNPGYFHIKNVKFSHCLFTQGGTDWVAAYESCDTAKYEWRIVKC ; _entity_poly.pdbx_seq_one_letter_code_can ;HMLAADVPTGCVTIKNRHEGRYLAHSISTHDADRRHVSFCTDPQRWTITAEGTNFRIRNNKHGEELFESQQKFNGNYVFL WIKKSLINDGGASWKITESGNPGYFHIKNVKFSHCLFTQGGTDWVAAYESCDTAKYEWRIVKC ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'FORMIC ACID' FMT 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 HIS n 1 2 MET n 1 3 LEU n 1 4 ALA n 1 5 ALA n 1 6 ASP n 1 7 VAL n 1 8 PRO n 1 9 THR n 1 10 GLY n 1 11 CYS n 1 12 VAL n 1 13 THR n 1 14 ILE n 1 15 LYS n 1 16 ASN n 1 17 ARG n 1 18 HIS n 1 19 GLU n 1 20 GLY n 1 21 ARG n 1 22 TYR n 1 23 LEU n 1 24 ALA n 1 25 HIS n 1 26 SER n 1 27 ILE n 1 28 SER n 1 29 THR n 1 30 HIS n 1 31 ASP n 1 32 ALA n 1 33 ASP n 1 34 ARG n 1 35 ARG n 1 36 HIS n 1 37 VAL n 1 38 SER n 1 39 PHE n 1 40 CYS n 1 41 THR n 1 42 ASP n 1 43 PRO n 1 44 GLN n 1 45 ARG n 1 46 TRP n 1 47 THR n 1 48 ILE n 1 49 THR n 1 50 ALA n 1 51 GLU n 1 52 GLY n 1 53 THR n 1 54 ASN n 1 55 PHE n 1 56 ARG n 1 57 ILE n 1 58 ARG n 1 59 ASN n 1 60 ASN n 1 61 LYS n 1 62 HIS n 1 63 GLY n 1 64 GLU n 1 65 GLU n 1 66 LEU n 1 67 PHE n 1 68 GLU n 1 69 SER n 1 70 GLN n 1 71 GLN n 1 72 LYS n 1 73 PHE n 1 74 ASN n 1 75 GLY n 1 76 ASN n 1 77 TYR n 1 78 VAL n 1 79 PHE n 1 80 LEU n 1 81 TRP n 1 82 ILE n 1 83 LYS n 1 84 LYS n 1 85 SER n 1 86 LEU n 1 87 ILE n 1 88 ASN n 1 89 ASP n 1 90 GLY n 1 91 GLY n 1 92 ALA n 1 93 SER n 1 94 TRP n 1 95 LYS n 1 96 ILE n 1 97 THR n 1 98 GLU n 1 99 SER n 1 100 GLY n 1 101 ASN n 1 102 PRO n 1 103 GLY n 1 104 TYR n 1 105 PHE n 1 106 HIS n 1 107 ILE n 1 108 LYS n 1 109 ASN n 1 110 VAL n 1 111 LYS n 1 112 PHE n 1 113 SER n 1 114 HIS n 1 115 CYS n 1 116 LEU n 1 117 PHE n 1 118 THR n 1 119 GLN n 1 120 GLY n 1 121 GLY n 1 122 THR n 1 123 ASP n 1 124 TRP n 1 125 VAL n 1 126 ALA n 1 127 ALA n 1 128 TYR n 1 129 GLU n 1 130 SER n 1 131 CYS n 1 132 ASP n 1 133 THR n 1 134 ALA n 1 135 LYS n 1 136 TYR n 1 137 GLU n 1 138 TRP n 1 139 ARG n 1 140 ILE n 1 141 VAL n 1 142 LYS n 1 143 CYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 143 _entity_src_gen.gene_src_common_name 'Southern house mosquito' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Culex quinquefasciatus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 7176 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FMT non-polymer . 'FORMIC ACID' ? 'C H2 O2' 46.025 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 HIS 1 -1 -1 HIS HIS A . n A 1 2 MET 2 0 0 MET MET A . n A 1 3 LEU 3 1 1 LEU LEU A . n A 1 4 ALA 4 2 2 ALA ALA A . n A 1 5 ALA 5 3 3 ALA ALA A . n A 1 6 ASP 6 4 4 ASP ASP A . n A 1 7 VAL 7 5 5 VAL VAL A . n A 1 8 PRO 8 6 6 PRO PRO A . n A 1 9 THR 9 7 7 THR THR A . n A 1 10 GLY 10 8 8 GLY GLY A . n A 1 11 CYS 11 9 9 CYS CYS A . n A 1 12 VAL 12 10 10 VAL VAL A . n A 1 13 THR 13 11 11 THR THR A . n A 1 14 ILE 14 12 12 ILE ILE A . n A 1 15 LYS 15 13 13 LYS LYS A . n A 1 16 ASN 16 14 14 ASN ASN A . n A 1 17 ARG 17 15 15 ARG ARG A . n A 1 18 HIS 18 16 16 HIS HIS A . n A 1 19 GLU 19 17 17 GLU GLU A . n A 1 20 GLY 20 18 18 GLY GLY A . n A 1 21 ARG 21 19 19 ARG ARG A . n A 1 22 TYR 22 20 20 TYR TYR A . n A 1 23 LEU 23 21 21 LEU LEU A . n A 1 24 ALA 24 22 22 ALA ALA A . n A 1 25 HIS 25 23 23 HIS HIS A . n A 1 26 SER 26 24 24 SER SER A . n A 1 27 ILE 27 25 25 ILE ILE A . n A 1 28 SER 28 26 26 SER SER A . n A 1 29 THR 29 27 27 THR THR A . n A 1 30 HIS 30 28 28 HIS HIS A . n A 1 31 ASP 31 29 29 ASP ASP A . n A 1 32 ALA 32 30 30 ALA ALA A . n A 1 33 ASP 33 31 31 ASP ASP A . n A 1 34 ARG 34 32 32 ARG ARG A . n A 1 35 ARG 35 33 33 ARG ARG A . n A 1 36 HIS 36 34 34 HIS HIS A . n A 1 37 VAL 37 35 35 VAL VAL A . n A 1 38 SER 38 36 36 SER SER A . n A 1 39 PHE 39 37 37 PHE PHE A . n A 1 40 CYS 40 38 38 CYS CYS A . n A 1 41 THR 41 39 39 THR THR A . n A 1 42 ASP 42 40 40 ASP ASP A . n A 1 43 PRO 43 41 41 PRO PRO A . n A 1 44 GLN 44 42 42 GLN GLN A . n A 1 45 ARG 45 43 43 ARG ARG A . n A 1 46 TRP 46 44 44 TRP TRP A . n A 1 47 THR 47 45 45 THR THR A . n A 1 48 ILE 48 46 46 ILE ILE A . n A 1 49 THR 49 47 47 THR THR A . n A 1 50 ALA 50 48 48 ALA ALA A . n A 1 51 GLU 51 49 49 GLU GLU A . n A 1 52 GLY 52 50 50 GLY GLY A . n A 1 53 THR 53 51 51 THR THR A . n A 1 54 ASN 54 52 52 ASN ASN A . n A 1 55 PHE 55 53 53 PHE PHE A . n A 1 56 ARG 56 54 54 ARG ARG A . n A 1 57 ILE 57 55 55 ILE ILE A . n A 1 58 ARG 58 56 56 ARG ARG A . n A 1 59 ASN 59 57 57 ASN ASN A . n A 1 60 ASN 60 58 58 ASN ASN A . n A 1 61 LYS 61 59 59 LYS LYS A . n A 1 62 HIS 62 60 60 HIS HIS A . n A 1 63 GLY 63 61 61 GLY GLY A . n A 1 64 GLU 64 62 62 GLU GLU A . n A 1 65 GLU 65 63 63 GLU GLU A . n A 1 66 LEU 66 64 64 LEU LEU A . n A 1 67 PHE 67 65 65 PHE PHE A . n A 1 68 GLU 68 66 66 GLU GLU A . n A 1 69 SER 69 67 67 SER SER A . n A 1 70 GLN 70 68 68 GLN GLN A . n A 1 71 GLN 71 69 69 GLN GLN A . n A 1 72 LYS 72 70 70 LYS LYS A . n A 1 73 PHE 73 71 71 PHE PHE A . n A 1 74 ASN 74 72 72 ASN ASN A . n A 1 75 GLY 75 73 73 GLY GLY A . n A 1 76 ASN 76 74 74 ASN ASN A . n A 1 77 TYR 77 75 75 TYR TYR A . n A 1 78 VAL 78 76 76 VAL VAL A . n A 1 79 PHE 79 77 77 PHE PHE A . n A 1 80 LEU 80 78 78 LEU LEU A . n A 1 81 TRP 81 79 79 TRP TRP A . n A 1 82 ILE 82 80 80 ILE ILE A . n A 1 83 LYS 83 81 81 LYS LYS A . n A 1 84 LYS 84 82 82 LYS LYS A . n A 1 85 SER 85 83 83 SER SER A . n A 1 86 LEU 86 84 84 LEU LEU A . n A 1 87 ILE 87 85 85 ILE ILE A . n A 1 88 ASN 88 86 86 ASN ASN A . n A 1 89 ASP 89 87 87 ASP ASP A . n A 1 90 GLY 90 88 88 GLY GLY A . n A 1 91 GLY 91 89 89 GLY GLY A . n A 1 92 ALA 92 90 90 ALA ALA A . n A 1 93 SER 93 91 91 SER SER A . n A 1 94 TRP 94 92 92 TRP TRP A . n A 1 95 LYS 95 93 93 LYS LYS A . n A 1 96 ILE 96 94 94 ILE ILE A . n A 1 97 THR 97 95 95 THR THR A . n A 1 98 GLU 98 96 96 GLU GLU A . n A 1 99 SER 99 97 97 SER SER A . n A 1 100 GLY 100 98 98 GLY GLY A . n A 1 101 ASN 101 99 99 ASN ASN A . n A 1 102 PRO 102 100 100 PRO PRO A . n A 1 103 GLY 103 101 101 GLY GLY A . n A 1 104 TYR 104 102 102 TYR TYR A . n A 1 105 PHE 105 103 103 PHE PHE A . n A 1 106 HIS 106 104 104 HIS HIS A . n A 1 107 ILE 107 105 105 ILE ILE A . n A 1 108 LYS 108 106 106 LYS LYS A . n A 1 109 ASN 109 107 107 ASN ASN A . n A 1 110 VAL 110 108 108 VAL VAL A . n A 1 111 LYS 111 109 109 LYS LYS A . n A 1 112 PHE 112 110 110 PHE PHE A . n A 1 113 SER 113 111 111 SER SER A . n A 1 114 HIS 114 112 112 HIS HIS A . n A 1 115 CYS 115 113 113 CYS CYS A . n A 1 116 LEU 116 114 114 LEU LEU A . n A 1 117 PHE 117 115 115 PHE PHE A . n A 1 118 THR 118 116 116 THR THR A . n A 1 119 GLN 119 117 117 GLN GLN A . n A 1 120 GLY 120 118 118 GLY GLY A . n A 1 121 GLY 121 119 119 GLY GLY A . n A 1 122 THR 122 120 120 THR THR A . n A 1 123 ASP 123 121 121 ASP ASP A . n A 1 124 TRP 124 122 122 TRP TRP A . n A 1 125 VAL 125 123 123 VAL VAL A . n A 1 126 ALA 126 124 124 ALA ALA A . n A 1 127 ALA 127 125 125 ALA ALA A . n A 1 128 TYR 128 126 126 TYR TYR A . n A 1 129 GLU 129 127 127 GLU GLU A . n A 1 130 SER 130 128 128 SER SER A . n A 1 131 CYS 131 129 129 CYS CYS A . n A 1 132 ASP 132 130 130 ASP ASP A . n A 1 133 THR 133 131 131 THR THR A . n A 1 134 ALA 134 132 132 ALA ALA A . n A 1 135 LYS 135 133 133 LYS LYS A . n A 1 136 TYR 136 134 134 TYR TYR A . n A 1 137 GLU 137 135 135 GLU GLU A . n A 1 138 TRP 138 136 136 TRP TRP A . n A 1 139 ARG 139 137 137 ARG ARG A . n A 1 140 ILE 140 138 138 ILE ILE A . n A 1 141 VAL 141 139 139 VAL VAL A . n A 1 142 LYS 142 140 140 LYS LYS A . n A 1 143 CYS 143 141 141 CYS CYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 FMT 1 301 301 FMT FMT A . C 2 FMT 1 302 302 FMT FMT A . D 2 FMT 1 303 303 FMT FMT A . E 3 HOH 1 401 210 HOH HOH A . E 3 HOH 2 402 205 HOH HOH A . E 3 HOH 3 403 222 HOH HOH A . E 3 HOH 4 404 201 HOH HOH A . E 3 HOH 5 405 204 HOH HOH A . E 3 HOH 6 406 213 HOH HOH A . E 3 HOH 7 407 227 HOH HOH A . E 3 HOH 8 408 207 HOH HOH A . E 3 HOH 9 409 220 HOH HOH A . E 3 HOH 10 410 215 HOH HOH A . E 3 HOH 11 411 226 HOH HOH A . E 3 HOH 12 412 229 HOH HOH A . E 3 HOH 13 413 203 HOH HOH A . E 3 HOH 14 414 214 HOH HOH A . E 3 HOH 15 415 217 HOH HOH A . E 3 HOH 16 416 209 HOH HOH A . E 3 HOH 17 417 230 HOH HOH A . E 3 HOH 18 418 224 HOH HOH A . E 3 HOH 19 419 211 HOH HOH A . E 3 HOH 20 420 212 HOH HOH A . E 3 HOH 21 421 208 HOH HOH A . E 3 HOH 22 422 216 HOH HOH A . E 3 HOH 23 423 223 HOH HOH A . E 3 HOH 24 424 218 HOH HOH A . E 3 HOH 25 425 221 HOH HOH A . E 3 HOH 26 426 219 HOH HOH A . E 3 HOH 27 427 202 HOH HOH A . E 3 HOH 28 428 206 HOH HOH A . E 3 HOH 29 429 228 HOH HOH A . E 3 HOH 30 430 225 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A HIS -1 ? CB ? A HIS 1 CB 2 1 Y 1 A HIS -1 ? CG ? A HIS 1 CG 3 1 Y 1 A HIS -1 ? ND1 ? A HIS 1 ND1 4 1 Y 1 A HIS -1 ? CD2 ? A HIS 1 CD2 5 1 Y 1 A HIS -1 ? CE1 ? A HIS 1 CE1 6 1 Y 1 A HIS -1 ? NE2 ? A HIS 1 NE2 7 1 Y 1 A MET 0 ? CG ? A MET 2 CG 8 1 Y 1 A MET 0 ? SD ? A MET 2 SD 9 1 Y 1 A MET 0 ? CE ? A MET 2 CE 10 1 Y 1 A LEU 1 ? CG ? A LEU 3 CG 11 1 Y 1 A LEU 1 ? CD1 ? A LEU 3 CD1 12 1 Y 1 A LEU 1 ? CD2 ? A LEU 3 CD2 13 1 Y 1 A ALA 2 ? CB ? A ALA 4 CB 14 1 Y 1 A ALA 3 ? CB ? A ALA 5 CB 15 1 Y 1 A LYS 13 ? CE ? A LYS 15 CE 16 1 Y 1 A LYS 13 ? NZ ? A LYS 15 NZ 17 1 Y 1 A ILE 25 ? CG2 ? A ILE 27 CG2 18 1 Y 1 A ILE 25 ? CD1 ? A ILE 27 CD1 19 1 Y 1 A ALA 30 ? CB ? A ALA 32 CB 20 1 Y 1 A ASP 40 ? CB ? A ASP 42 CB 21 1 Y 1 A ASP 40 ? CG ? A ASP 42 CG 22 1 Y 1 A ASP 40 ? OD1 ? A ASP 42 OD1 23 1 Y 1 A ASP 40 ? OD2 ? A ASP 42 OD2 24 1 Y 1 A GLN 42 ? OE1 ? A GLN 44 OE1 25 1 Y 1 A GLN 42 ? NE2 ? A GLN 44 NE2 26 1 Y 1 A LYS 59 ? CG ? A LYS 61 CG 27 1 Y 1 A LYS 59 ? CD ? A LYS 61 CD 28 1 Y 1 A LYS 59 ? CE ? A LYS 61 CE 29 1 Y 1 A LYS 59 ? NZ ? A LYS 61 NZ 30 1 Y 1 A LYS 70 ? CE ? A LYS 72 CE 31 1 Y 1 A LYS 70 ? NZ ? A LYS 72 NZ 32 1 Y 1 A ASN 72 ? CB ? A ASN 74 CB 33 1 Y 1 A ASN 72 ? CG ? A ASN 74 CG 34 1 Y 1 A ASN 72 ? OD1 ? A ASN 74 OD1 35 1 Y 1 A ASN 72 ? ND2 ? A ASN 74 ND2 36 1 Y 1 A LYS 93 ? CD ? A LYS 95 CD 37 1 Y 1 A LYS 93 ? CE ? A LYS 95 CE 38 1 Y 1 A LYS 93 ? NZ ? A LYS 95 NZ 39 1 Y 1 A SER 128 ? OG ? A SER 130 OG 40 1 Y 1 A LYS 140 ? CE ? A LYS 142 CE 41 1 Y 1 A LYS 140 ? NZ ? A LYS 142 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.18.2_3874 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7KCG _cell.details ? _cell.formula_units_Z ? _cell.length_a 34.800 _cell.length_a_esd ? _cell.length_b 59.680 _cell.length_b_esd ? _cell.length_c 85.440 _cell.length_c_esd ? _cell.volume 177447.262 _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7KCG _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall 'P 2ac 2ab' _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7KCG _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.69 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 54.34 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '4M Sodium formate (Condition 33, Crystal Screen, Hampton Research)' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 95 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RAYONIX MX300-HS' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-10-19 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.000000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 22-BM' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.000000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 22-BM _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 37.43 _reflns.entry_id 7KCG _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.870 _reflns.d_resolution_low 34.740 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 15256 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.600 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.418 _reflns.pdbx_Rmerge_I_obs 0.038 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 23.770 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.050 _reflns.pdbx_scaling_rejects 108 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.041 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 113172 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 1.870 1.920 ? 3.480 ? 5231 1124 ? 1079 96.000 ? ? ? ? 0.367 ? ? ? ? ? ? ? ? 4.848 ? ? ? ? 0.410 ? ? 1 1 0.948 ? ? 1.920 1.970 ? 5.790 ? 8203 1057 ? 1057 100.000 ? ? ? ? 0.310 ? ? ? ? ? ? ? ? 7.761 ? ? ? ? 0.332 ? ? 2 1 0.984 ? ? 1.970 2.030 ? 7.220 ? 8212 1060 ? 1060 100.000 ? ? ? ? 0.243 ? ? ? ? ? ? ? ? 7.747 ? ? ? ? 0.260 ? ? 3 1 0.988 ? ? 2.030 2.090 ? 9.860 ? 7889 1025 ? 1025 100.000 ? ? ? ? 0.171 ? ? ? ? ? ? ? ? 7.697 ? ? ? ? 0.184 ? ? 4 1 0.993 ? ? 2.090 2.160 ? 12.690 ? 7656 1001 ? 1001 100.000 ? ? ? ? 0.123 ? ? ? ? ? ? ? ? 7.648 ? ? ? ? 0.132 ? ? 5 1 0.996 ? ? 2.160 2.240 ? 16.150 ? 7292 951 ? 951 100.000 ? ? ? ? 0.095 ? ? ? ? ? ? ? ? 7.668 ? ? ? ? 0.102 ? ? 6 1 0.997 ? ? 2.240 2.320 ? 18.830 ? 7370 947 ? 947 100.000 ? ? ? ? 0.083 ? ? ? ? ? ? ? ? 7.782 ? ? ? ? 0.089 ? ? 7 1 0.998 ? ? 2.320 2.410 ? 20.730 ? 7014 876 ? 876 100.000 ? ? ? ? 0.078 ? ? ? ? ? ? ? ? 8.007 ? ? ? ? 0.083 ? ? 8 1 0.998 ? ? 2.410 2.520 ? 24.300 ? 6954 869 ? 869 100.000 ? ? ? ? 0.066 ? ? ? ? ? ? ? ? 8.002 ? ? ? ? 0.070 ? ? 9 1 0.998 ? ? 2.520 2.640 ? 28.950 ? 6617 831 ? 831 100.000 ? ? ? ? 0.058 ? ? ? ? ? ? ? ? 7.963 ? ? ? ? 0.062 ? ? 10 1 0.998 ? ? 2.640 2.790 ? 31.880 ? 6128 787 ? 787 100.000 ? ? ? ? 0.051 ? ? ? ? ? ? ? ? 7.787 ? ? ? ? 0.055 ? ? 11 1 0.998 ? ? 2.790 2.960 ? 35.430 ? 5835 760 ? 760 100.000 ? ? ? ? 0.044 ? ? ? ? ? ? ? ? 7.678 ? ? ? ? 0.047 ? ? 12 1 0.999 ? ? 2.960 3.160 ? 40.390 ? 5422 725 ? 725 100.000 ? ? ? ? 0.038 ? ? ? ? ? ? ? ? 7.479 ? ? ? ? 0.041 ? ? 13 1 0.999 ? ? 3.160 3.410 ? 42.860 ? 4793 647 ? 647 100.000 ? ? ? ? 0.038 ? ? ? ? ? ? ? ? 7.408 ? ? ? ? 0.041 ? ? 14 1 0.999 ? ? 3.410 3.740 ? 43.800 ? 4455 609 ? 609 100.000 ? ? ? ? 0.035 ? ? ? ? ? ? ? ? 7.315 ? ? ? ? 0.038 ? ? 15 1 0.999 ? ? 3.740 4.180 ? 44.570 ? 4034 562 ? 561 99.800 ? ? ? ? 0.031 ? ? ? ? ? ? ? ? 7.191 ? ? ? ? 0.033 ? ? 16 1 1.000 ? ? 4.180 4.830 ? 45.870 ? 3638 503 ? 503 100.000 ? ? ? ? 0.031 ? ? ? ? ? ? ? ? 7.233 ? ? ? ? 0.033 ? ? 17 1 0.999 ? ? 4.830 5.910 ? 44.750 ? 3015 430 ? 429 99.800 ? ? ? ? 0.032 ? ? ? ? ? ? ? ? 7.028 ? ? ? ? 0.034 ? ? 18 1 0.999 ? ? 5.910 8.360 ? 44.000 ? 2405 351 ? 351 100.000 ? ? ? ? 0.031 ? ? ? ? ? ? ? ? 6.852 ? ? ? ? 0.033 ? ? 19 1 0.999 ? ? 8.360 34.740 ? 38.870 ? 1009 205 ? 188 91.700 ? ? ? ? 0.029 ? ? ? ? ? ? ? ? 5.367 ? ? ? ? 0.032 ? ? 20 1 0.999 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 54.13 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7KCG _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.87 _refine.ls_d_res_low 34.74 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 14833 _refine.ls_number_reflns_R_free 1187 _refine.ls_number_reflns_R_work 13646 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.84 _refine.ls_percent_reflns_R_free 8.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2308 _refine.ls_R_factor_R_free 0.2543 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2287 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.43 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model homology _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 32.0060 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2219 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.87 _refine_hist.d_res_low 34.74 _refine_hist.number_atoms_solvent 30 _refine_hist.number_atoms_total 1158 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1119 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 9 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0094 ? 1157 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.3598 ? 1561 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0942 ? 157 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0058 ? 203 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 15.7592 ? 394 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.87 1.96 . . 130 1494 86.84 . . . 0.3088 . 0.2887 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.96 2.06 . . 142 1636 94.98 . . . 0.3451 . 0.2955 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.06 2.19 . . 146 1671 96.55 . . . 0.3251 . 0.2756 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.19 2.36 . . 148 1702 97.99 . . . 0.3259 . 0.2623 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.36 2.59 . . 150 1730 99.10 . . . 0.3032 . 0.2908 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.59 2.97 . . 154 1764 99.79 . . . 0.2761 . 0.2861 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.97 3.74 . . 154 1777 100.00 . . . 0.2525 . 0.2285 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.74 34.74 . . 163 1872 99.17 . . . 0.2132 . 0.1820 . . . . . . . . . . . # _struct.entry_id 7KCG _struct.title 'Salivary protein from Culex quiquefasciatus that belongs to the Cysteine and Tryptophan-Rich (CWRC) family' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7KCG _struct_keywords.text 'Salivary protein, Culex quinquefasciatus, Cysteine and Tryptophan-Rich (CWRC) protein family, UNKNOWN FUNCTION' _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q6TRZ5_CULQU _struct_ref.pdbx_db_accession Q6TRZ5 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;LAADVPTGCVTIKNRHEGRYLAHSISTHDADRRHVSFCTDPQRWTITAEGTNFRIRNNKHGEELFESQQKFNGNYVFLWI KKSLINDGGASWKITESGNPGYFHIKNVKFSHCLFTQGGTDWVAAYESCDTAKYEWRIVKC ; _struct_ref.pdbx_align_begin 18 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7KCG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 143 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q6TRZ5 _struct_ref_seq.db_align_beg 18 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 158 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 141 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7KCG HIS A 1 ? UNP Q6TRZ5 ? ? 'expression tag' -1 1 1 7KCG MET A 2 ? UNP Q6TRZ5 ? ? 'expression tag' 0 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'light scattering' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id THR _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 133 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id TYR _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 136 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id THR _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 131 _struct_conf.end_auth_comp_id TYR _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 134 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 11 SG ? ? ? 1_555 A CYS 143 SG ? ? A CYS 9 A CYS 141 1_555 ? ? ? ? ? ? ? 2.048 ? ? disulf2 disulf ? ? A CYS 115 SG ? ? ? 1_555 A CYS 131 SG ? ? A CYS 113 A CYS 129 1_555 ? ? ? ? ? ? ? 2.023 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 11 ? CYS A 143 ? CYS A 9 ? 1_555 CYS A 141 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 115 ? CYS A 131 ? CYS A 113 ? 1_555 CYS A 129 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 13 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA1 10 11 ? anti-parallel AA1 11 12 ? anti-parallel AA1 12 13 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLY A 10 ? ASN A 16 ? GLY A 8 ASN A 14 AA1 2 ARG A 45 ? GLU A 51 ? ARG A 43 GLU A 49 AA1 3 ASN A 54 ? ASN A 59 ? ASN A 52 ASN A 57 AA1 4 GLY A 10 ? ASN A 16 ? GLY A 8 ASN A 14 AA1 5 TYR A 22 ? THR A 29 ? TYR A 20 THR A 27 AA1 6 ARG A 34 ? CYS A 40 ? ARG A 32 CYS A 38 AA1 7 ASN A 76 ? TRP A 81 ? ASN A 74 TRP A 79 AA1 8 GLU A 64 ? LYS A 72 ? GLU A 62 LYS A 70 AA1 9 ASN A 54 ? ASN A 59 ? ASN A 52 ASN A 57 AA1 10 TRP A 138 ? LYS A 142 ? TRP A 136 LYS A 140 AA1 11 TYR A 104 ? ASN A 109 ? TYR A 102 ASN A 107 AA1 12 SER A 93 ? GLU A 98 ? SER A 91 GLU A 96 AA1 13 ASN A 54 ? ASN A 59 ? ASN A 52 ASN A 57 AA2 1 CYS A 115 ? THR A 118 ? CYS A 113 THR A 116 AA2 2 VAL A 125 ? TYR A 128 ? VAL A 123 TYR A 126 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 10 ? N GLY A 8 O ILE A 48 ? O ILE A 46 AA1 2 3 N GLU A 51 ? N GLU A 49 O ASN A 54 ? O ASN A 52 AA1 4 5 N ILE A 14 ? N ILE A 12 O LEU A 23 ? O LEU A 21 AA1 5 6 N ALA A 24 ? N ALA A 22 O SER A 38 ? O SER A 36 AA1 6 7 N ARG A 35 ? N ARG A 33 O LEU A 80 ? O LEU A 78 AA1 7 8 O PHE A 79 ? O PHE A 77 N PHE A 67 ? N PHE A 65 AA1 8 9 O LEU A 66 ? O LEU A 64 N ILE A 57 ? N ILE A 55 AA1 10 11 O TRP A 138 ? O TRP A 136 N PHE A 105 ? N PHE A 103 AA1 11 12 O LYS A 108 ? O LYS A 106 N LYS A 95 ? N LYS A 93 AA1 12 13 O TRP A 94 ? O TRP A 92 N PHE A 55 ? N PHE A 53 AA2 1 2 N CYS A 115 ? N CYS A 113 O TYR A 128 ? O TYR A 126 # _pdbx_entry_details.entry_id 7KCG _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CB _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 GLU _pdbx_validate_rmsd_angle.auth_seq_id_1 49 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CA _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 GLU _pdbx_validate_rmsd_angle.auth_seq_id_2 49 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 C _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 GLU _pdbx_validate_rmsd_angle.auth_seq_id_3 49 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 122.74 _pdbx_validate_rmsd_angle.angle_target_value 110.40 _pdbx_validate_rmsd_angle.angle_deviation 12.34 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.00 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 29 ? ? -165.19 -167.03 2 1 PHE A 71 ? ? -87.58 -99.61 3 1 LYS A 82 ? ? 81.11 8.43 4 1 ASP A 130 ? ? -144.92 -2.62 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 24.8187073946 36.2098198453 23.2267707036 0.47979989468 ? -0.0682483108788 ? 0.0603045270106 ? 0.455494773681 ? -0.0560396923447 ? 0.464984731515 ? 1.65470064154 ? -0.178751135167 ? 0.981970177708 ? 1.0250891058 ? 0.575767415254 ? 2.48788717372 ? 0.0337287888817 ? 0.368328699576 ? -0.183147087781 ? -1.28221579108 ? 0.247017070794 ? -0.340929111934 ? -0.0289884386211 ? 0.517979255998 ? 0.00867362083439 ? 2 'X-RAY DIFFRACTION' ? refined 25.8976895486 47.7517633881 29.5321677417 0.762762587529 ? -0.148915759597 ? 0.0735979719716 ? 0.471817898744 ? -0.0333276856478 ? 0.447986366161 ? 2.14117265303 ? 0.243605422535 ? 1.63612872007 ? 2.94701030538 ? 1.43367093386 ? 2.5260550497 ? -0.258233678937 ? -0.036385288358 ? 0.287802664994 ? -0.665992527294 ? 0.120575581576 ? -0.595703660866 ? -1.82881317864 ? 0.959803894218 ? -0.0300445594907 ? 3 'X-RAY DIFFRACTION' ? refined 22.2746171304 37.6521563723 36.8757581785 0.282019421297 ? -0.0362709602156 ? -0.0152120957309 ? 0.448573525069 ? 0.012116772691 ? 0.392881596183 ? 0.589623272164 ? -0.591260065797 ? 0.261216683584 ? 0.781639553682 ? 0.216115292355 ? 1.07561134506 ? -0.174346015289 ? -0.30219638503 ? -0.236777495846 ? 0.0832003163789 ? 0.391041939852 ? -0.0129782399743 ? 0.463584701851 ? 0.156043255753 ? 0.0134029843667 ? 4 'X-RAY DIFFRACTION' ? refined 25.3481223296 46.6501975929 34.3813741895 0.381390293894 ? -0.151577989779 ? 0.0616329595839 ? 0.39375214374 ? -0.153431628741 ? 0.437958537935 ? 0.79976974935 ? -0.97371324065 ? 1.58491913924 ? 1.20797267751 ? -1.9145186271 ? 3.12538100614 ? -0.310821006255 ? 0.172476378826 ? -0.229645053868 ? -0.271952783646 ? 0.423416287197 ? -0.420824371084 ? -1.09337437738 ? 0.335327106312 ? -0.0211954893111 ? 5 'X-RAY DIFFRACTION' ? refined 14.9794608827 52.3974309837 32.2491811153 0.770891078168 ? 0.0961239091004 ? -0.116349472819 ? 0.384827968684 ? -0.0239534525432 ? 0.60236205055 ? 4.22753676749 ? 0.0265420267183 ? 2.44873283485 ? 1.38830704639 ? 1.8630005983 ? 3.94235465667 ? -0.464456448657 ? 0.688560369355 ? 1.45137618363 ? -0.61898480181 ? 0.0388000442834 ? 0.478487246792 ? -2.1618318057 ? -0.0397190140585 ? -0.150558588966 ? 6 'X-RAY DIFFRACTION' ? refined 18.8005194053 39.0583652922 33.6475485201 0.18679789491 ? 0.0230691670786 ? 0.0166534406836 ? 0.349885675368 ? -0.0229216134475 ? 0.359094084192 ? 2.31802058419 ? 0.493710157719 ? 0.228769321178 ? 2.24608704371 ? -1.83134222298 ? 1.66913184741 ? -0.0523730490562 ? -0.169651066199 ? -0.131723632396 ? -0.390419913958 ? 0.0170308543006 ? -0.229419782361 ? -0.208121315981 ? -0.0643815001753 ? -0.0017536776717 ? 7 'X-RAY DIFFRACTION' ? refined 12.7316050686 40.3649608413 29.6057746261 0.335061172716 ? 0.0460473401893 ? -0.0794416664975 ? 0.416587082889 ? -0.0746111204696 ? 0.381648159117 ? 0.143430665077 ? 0.084972767372 ? -0.189198853511 ? 0.544800697974 ? 0.0187038459311 ? 0.220243474811 ? -0.105710694437 ? 0.151981678113 ? -0.00665538114049 ? -0.58550375207 ? -0.12896221542 ? 0.292149786534 ? -0.302862255283 ? -0.496650098891 ? -0.0239760726931 ? 8 'X-RAY DIFFRACTION' ? refined 12.7746441898 45.4972958658 21.2943279496 0.662929752249 ? 0.0272227558934 ? -0.0974121285168 ? 0.690210337318 ? 0.012876567815 ? 0.449463214269 ? 0.558292913448 ? -0.20045391952 ? -0.360750424187 ? 1.2278156061 ? 0.303170034371 ? 0.229337776459 ? -0.0762132190676 ? 0.528012489858 ? 0.138624668352 ? -1.29364321445 ? -0.0663670081163 ? 0.0539989029784 ? -0.671580746631 ? -0.632501490905 ? -0.0260611446494 ? 9 'X-RAY DIFFRACTION' ? refined 20.7890394648 35.8616077805 22.244774741 0.413429991983 ? -0.00411842966326 ? -0.0494955693998 ? 0.419844045759 ? -0.098200231738 ? 0.413541738762 ? 1.43521170208 ? -0.0653742123668 ? 0.315061469806 ? 1.22123170835 ? 0.674787623898 ? 0.402393020084 ? -0.463901364685 ? 0.968945758173 ? -0.162717169502 ? -1.01030016884 ? 0.233175037917 ? -0.187984421964 ? -0.672740047449 ? 0.410700280021 ? -0.00959021573217 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 A 1 A -1 ? A 25 A 23 ? ? ;chain 'A' and (resid -1 through 23 ) ; 2 'X-RAY DIFFRACTION' 2 A 26 A 24 ? A 51 A 49 ? ? ;chain 'A' and (resid 24 through 49 ) ; 3 'X-RAY DIFFRACTION' 3 A 52 A 50 ? A 59 A 57 ? ? ;chain 'A' and (resid 50 through 57 ) ; 4 'X-RAY DIFFRACTION' 4 A 60 A 58 ? A 68 A 66 ? ? ;chain 'A' and (resid 58 through 66 ) ; 5 'X-RAY DIFFRACTION' 5 A 69 A 67 ? A 81 A 79 ? ? ;chain 'A' and (resid 67 through 79 ) ; 6 'X-RAY DIFFRACTION' 6 A 82 A 80 ? A 104 A 102 ? ? ;chain 'A' and (resid 80 through 102 ) ; 7 'X-RAY DIFFRACTION' 7 A 105 A 103 ? A 118 A 116 ? ? ;chain 'A' and (resid 103 through 116 ) ; 8 'X-RAY DIFFRACTION' 8 A 119 A 117 ? A 133 A 131 ? ? ;chain 'A' and (resid 117 through 131 ) ; 9 'X-RAY DIFFRACTION' 9 A 134 A 132 ? A 143 A 141 ? ? ;chain 'A' and (resid 132 through 141 ) ; # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 FMT C C N N 88 FMT O1 O N N 89 FMT O2 O N N 90 FMT H H N N 91 FMT HO2 H N N 92 GLN N N N N 93 GLN CA C N S 94 GLN C C N N 95 GLN O O N N 96 GLN CB C N N 97 GLN CG C N N 98 GLN CD C N N 99 GLN OE1 O N N 100 GLN NE2 N N N 101 GLN OXT O N N 102 GLN H H N N 103 GLN H2 H N N 104 GLN HA H N N 105 GLN HB2 H N N 106 GLN HB3 H N N 107 GLN HG2 H N N 108 GLN HG3 H N N 109 GLN HE21 H N N 110 GLN HE22 H N N 111 GLN HXT H N N 112 GLU N N N N 113 GLU CA C N S 114 GLU C C N N 115 GLU O O N N 116 GLU CB C N N 117 GLU CG C N N 118 GLU CD C N N 119 GLU OE1 O N N 120 GLU OE2 O N N 121 GLU OXT O N N 122 GLU H H N N 123 GLU H2 H N N 124 GLU HA H N N 125 GLU HB2 H N N 126 GLU HB3 H N N 127 GLU HG2 H N N 128 GLU HG3 H N N 129 GLU HE2 H N N 130 GLU HXT H N N 131 GLY N N N N 132 GLY CA C N N 133 GLY C C N N 134 GLY O O N N 135 GLY OXT O N N 136 GLY H H N N 137 GLY H2 H N N 138 GLY HA2 H N N 139 GLY HA3 H N N 140 GLY HXT H N N 141 HIS N N N N 142 HIS CA C N S 143 HIS C C N N 144 HIS O O N N 145 HIS CB C N N 146 HIS CG C Y N 147 HIS ND1 N Y N 148 HIS CD2 C Y N 149 HIS CE1 C Y N 150 HIS NE2 N Y N 151 HIS OXT O N N 152 HIS H H N N 153 HIS H2 H N N 154 HIS HA H N N 155 HIS HB2 H N N 156 HIS HB3 H N N 157 HIS HD1 H N N 158 HIS HD2 H N N 159 HIS HE1 H N N 160 HIS HE2 H N N 161 HIS HXT H N N 162 HOH O O N N 163 HOH H1 H N N 164 HOH H2 H N N 165 ILE N N N N 166 ILE CA C N S 167 ILE C C N N 168 ILE O O N N 169 ILE CB C N S 170 ILE CG1 C N N 171 ILE CG2 C N N 172 ILE CD1 C N N 173 ILE OXT O N N 174 ILE H H N N 175 ILE H2 H N N 176 ILE HA H N N 177 ILE HB H N N 178 ILE HG12 H N N 179 ILE HG13 H N N 180 ILE HG21 H N N 181 ILE HG22 H N N 182 ILE HG23 H N N 183 ILE HD11 H N N 184 ILE HD12 H N N 185 ILE HD13 H N N 186 ILE HXT H N N 187 LEU N N N N 188 LEU CA C N S 189 LEU C C N N 190 LEU O O N N 191 LEU CB C N N 192 LEU CG C N N 193 LEU CD1 C N N 194 LEU CD2 C N N 195 LEU OXT O N N 196 LEU H H N N 197 LEU H2 H N N 198 LEU HA H N N 199 LEU HB2 H N N 200 LEU HB3 H N N 201 LEU HG H N N 202 LEU HD11 H N N 203 LEU HD12 H N N 204 LEU HD13 H N N 205 LEU HD21 H N N 206 LEU HD22 H N N 207 LEU HD23 H N N 208 LEU HXT H N N 209 LYS N N N N 210 LYS CA C N S 211 LYS C C N N 212 LYS O O N N 213 LYS CB C N N 214 LYS CG C N N 215 LYS CD C N N 216 LYS CE C N N 217 LYS NZ N N N 218 LYS OXT O N N 219 LYS H H N N 220 LYS H2 H N N 221 LYS HA H N N 222 LYS HB2 H N N 223 LYS HB3 H N N 224 LYS HG2 H N N 225 LYS HG3 H N N 226 LYS HD2 H N N 227 LYS HD3 H N N 228 LYS HE2 H N N 229 LYS HE3 H N N 230 LYS HZ1 H N N 231 LYS HZ2 H N N 232 LYS HZ3 H N N 233 LYS HXT H N N 234 MET N N N N 235 MET CA C N S 236 MET C C N N 237 MET O O N N 238 MET CB C N N 239 MET CG C N N 240 MET SD S N N 241 MET CE C N N 242 MET OXT O N N 243 MET H H N N 244 MET H2 H N N 245 MET HA H N N 246 MET HB2 H N N 247 MET HB3 H N N 248 MET HG2 H N N 249 MET HG3 H N N 250 MET HE1 H N N 251 MET HE2 H N N 252 MET HE3 H N N 253 MET HXT H N N 254 PHE N N N N 255 PHE CA C N S 256 PHE C C N N 257 PHE O O N N 258 PHE CB C N N 259 PHE CG C Y N 260 PHE CD1 C Y N 261 PHE CD2 C Y N 262 PHE CE1 C Y N 263 PHE CE2 C Y N 264 PHE CZ C Y N 265 PHE OXT O N N 266 PHE H H N N 267 PHE H2 H N N 268 PHE HA H N N 269 PHE HB2 H N N 270 PHE HB3 H N N 271 PHE HD1 H N N 272 PHE HD2 H N N 273 PHE HE1 H N N 274 PHE HE2 H N N 275 PHE HZ H N N 276 PHE HXT H N N 277 PRO N N N N 278 PRO CA C N S 279 PRO C C N N 280 PRO O O N N 281 PRO CB C N N 282 PRO CG C N N 283 PRO CD C N N 284 PRO OXT O N N 285 PRO H H N N 286 PRO HA H N N 287 PRO HB2 H N N 288 PRO HB3 H N N 289 PRO HG2 H N N 290 PRO HG3 H N N 291 PRO HD2 H N N 292 PRO HD3 H N N 293 PRO HXT H N N 294 SER N N N N 295 SER CA C N S 296 SER C C N N 297 SER O O N N 298 SER CB C N N 299 SER OG O N N 300 SER OXT O N N 301 SER H H N N 302 SER H2 H N N 303 SER HA H N N 304 SER HB2 H N N 305 SER HB3 H N N 306 SER HG H N N 307 SER HXT H N N 308 THR N N N N 309 THR CA C N S 310 THR C C N N 311 THR O O N N 312 THR CB C N R 313 THR OG1 O N N 314 THR CG2 C N N 315 THR OXT O N N 316 THR H H N N 317 THR H2 H N N 318 THR HA H N N 319 THR HB H N N 320 THR HG1 H N N 321 THR HG21 H N N 322 THR HG22 H N N 323 THR HG23 H N N 324 THR HXT H N N 325 TRP N N N N 326 TRP CA C N S 327 TRP C C N N 328 TRP O O N N 329 TRP CB C N N 330 TRP CG C Y N 331 TRP CD1 C Y N 332 TRP CD2 C Y N 333 TRP NE1 N Y N 334 TRP CE2 C Y N 335 TRP CE3 C Y N 336 TRP CZ2 C Y N 337 TRP CZ3 C Y N 338 TRP CH2 C Y N 339 TRP OXT O N N 340 TRP H H N N 341 TRP H2 H N N 342 TRP HA H N N 343 TRP HB2 H N N 344 TRP HB3 H N N 345 TRP HD1 H N N 346 TRP HE1 H N N 347 TRP HE3 H N N 348 TRP HZ2 H N N 349 TRP HZ3 H N N 350 TRP HH2 H N N 351 TRP HXT H N N 352 TYR N N N N 353 TYR CA C N S 354 TYR C C N N 355 TYR O O N N 356 TYR CB C N N 357 TYR CG C Y N 358 TYR CD1 C Y N 359 TYR CD2 C Y N 360 TYR CE1 C Y N 361 TYR CE2 C Y N 362 TYR CZ C Y N 363 TYR OH O N N 364 TYR OXT O N N 365 TYR H H N N 366 TYR H2 H N N 367 TYR HA H N N 368 TYR HB2 H N N 369 TYR HB3 H N N 370 TYR HD1 H N N 371 TYR HD2 H N N 372 TYR HE1 H N N 373 TYR HE2 H N N 374 TYR HH H N N 375 TYR HXT H N N 376 VAL N N N N 377 VAL CA C N S 378 VAL C C N N 379 VAL O O N N 380 VAL CB C N N 381 VAL CG1 C N N 382 VAL CG2 C N N 383 VAL OXT O N N 384 VAL H H N N 385 VAL H2 H N N 386 VAL HA H N N 387 VAL HB H N N 388 VAL HG11 H N N 389 VAL HG12 H N N 390 VAL HG13 H N N 391 VAL HG21 H N N 392 VAL HG22 H N N 393 VAL HG23 H N N 394 VAL HXT H N N 395 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 FMT C O1 doub N N 83 FMT C O2 sing N N 84 FMT C H sing N N 85 FMT O2 HO2 sing N N 86 GLN N CA sing N N 87 GLN N H sing N N 88 GLN N H2 sing N N 89 GLN CA C sing N N 90 GLN CA CB sing N N 91 GLN CA HA sing N N 92 GLN C O doub N N 93 GLN C OXT sing N N 94 GLN CB CG sing N N 95 GLN CB HB2 sing N N 96 GLN CB HB3 sing N N 97 GLN CG CD sing N N 98 GLN CG HG2 sing N N 99 GLN CG HG3 sing N N 100 GLN CD OE1 doub N N 101 GLN CD NE2 sing N N 102 GLN NE2 HE21 sing N N 103 GLN NE2 HE22 sing N N 104 GLN OXT HXT sing N N 105 GLU N CA sing N N 106 GLU N H sing N N 107 GLU N H2 sing N N 108 GLU CA C sing N N 109 GLU CA CB sing N N 110 GLU CA HA sing N N 111 GLU C O doub N N 112 GLU C OXT sing N N 113 GLU CB CG sing N N 114 GLU CB HB2 sing N N 115 GLU CB HB3 sing N N 116 GLU CG CD sing N N 117 GLU CG HG2 sing N N 118 GLU CG HG3 sing N N 119 GLU CD OE1 doub N N 120 GLU CD OE2 sing N N 121 GLU OE2 HE2 sing N N 122 GLU OXT HXT sing N N 123 GLY N CA sing N N 124 GLY N H sing N N 125 GLY N H2 sing N N 126 GLY CA C sing N N 127 GLY CA HA2 sing N N 128 GLY CA HA3 sing N N 129 GLY C O doub N N 130 GLY C OXT sing N N 131 GLY OXT HXT sing N N 132 HIS N CA sing N N 133 HIS N H sing N N 134 HIS N H2 sing N N 135 HIS CA C sing N N 136 HIS CA CB sing N N 137 HIS CA HA sing N N 138 HIS C O doub N N 139 HIS C OXT sing N N 140 HIS CB CG sing N N 141 HIS CB HB2 sing N N 142 HIS CB HB3 sing N N 143 HIS CG ND1 sing Y N 144 HIS CG CD2 doub Y N 145 HIS ND1 CE1 doub Y N 146 HIS ND1 HD1 sing N N 147 HIS CD2 NE2 sing Y N 148 HIS CD2 HD2 sing N N 149 HIS CE1 NE2 sing Y N 150 HIS CE1 HE1 sing N N 151 HIS NE2 HE2 sing N N 152 HIS OXT HXT sing N N 153 HOH O H1 sing N N 154 HOH O H2 sing N N 155 ILE N CA sing N N 156 ILE N H sing N N 157 ILE N H2 sing N N 158 ILE CA C sing N N 159 ILE CA CB sing N N 160 ILE CA HA sing N N 161 ILE C O doub N N 162 ILE C OXT sing N N 163 ILE CB CG1 sing N N 164 ILE CB CG2 sing N N 165 ILE CB HB sing N N 166 ILE CG1 CD1 sing N N 167 ILE CG1 HG12 sing N N 168 ILE CG1 HG13 sing N N 169 ILE CG2 HG21 sing N N 170 ILE CG2 HG22 sing N N 171 ILE CG2 HG23 sing N N 172 ILE CD1 HD11 sing N N 173 ILE CD1 HD12 sing N N 174 ILE CD1 HD13 sing N N 175 ILE OXT HXT sing N N 176 LEU N CA sing N N 177 LEU N H sing N N 178 LEU N H2 sing N N 179 LEU CA C sing N N 180 LEU CA CB sing N N 181 LEU CA HA sing N N 182 LEU C O doub N N 183 LEU C OXT sing N N 184 LEU CB CG sing N N 185 LEU CB HB2 sing N N 186 LEU CB HB3 sing N N 187 LEU CG CD1 sing N N 188 LEU CG CD2 sing N N 189 LEU CG HG sing N N 190 LEU CD1 HD11 sing N N 191 LEU CD1 HD12 sing N N 192 LEU CD1 HD13 sing N N 193 LEU CD2 HD21 sing N N 194 LEU CD2 HD22 sing N N 195 LEU CD2 HD23 sing N N 196 LEU OXT HXT sing N N 197 LYS N CA sing N N 198 LYS N H sing N N 199 LYS N H2 sing N N 200 LYS CA C sing N N 201 LYS CA CB sing N N 202 LYS CA HA sing N N 203 LYS C O doub N N 204 LYS C OXT sing N N 205 LYS CB CG sing N N 206 LYS CB HB2 sing N N 207 LYS CB HB3 sing N N 208 LYS CG CD sing N N 209 LYS CG HG2 sing N N 210 LYS CG HG3 sing N N 211 LYS CD CE sing N N 212 LYS CD HD2 sing N N 213 LYS CD HD3 sing N N 214 LYS CE NZ sing N N 215 LYS CE HE2 sing N N 216 LYS CE HE3 sing N N 217 LYS NZ HZ1 sing N N 218 LYS NZ HZ2 sing N N 219 LYS NZ HZ3 sing N N 220 LYS OXT HXT sing N N 221 MET N CA sing N N 222 MET N H sing N N 223 MET N H2 sing N N 224 MET CA C sing N N 225 MET CA CB sing N N 226 MET CA HA sing N N 227 MET C O doub N N 228 MET C OXT sing N N 229 MET CB CG sing N N 230 MET CB HB2 sing N N 231 MET CB HB3 sing N N 232 MET CG SD sing N N 233 MET CG HG2 sing N N 234 MET CG HG3 sing N N 235 MET SD CE sing N N 236 MET CE HE1 sing N N 237 MET CE HE2 sing N N 238 MET CE HE3 sing N N 239 MET OXT HXT sing N N 240 PHE N CA sing N N 241 PHE N H sing N N 242 PHE N H2 sing N N 243 PHE CA C sing N N 244 PHE CA CB sing N N 245 PHE CA HA sing N N 246 PHE C O doub N N 247 PHE C OXT sing N N 248 PHE CB CG sing N N 249 PHE CB HB2 sing N N 250 PHE CB HB3 sing N N 251 PHE CG CD1 doub Y N 252 PHE CG CD2 sing Y N 253 PHE CD1 CE1 sing Y N 254 PHE CD1 HD1 sing N N 255 PHE CD2 CE2 doub Y N 256 PHE CD2 HD2 sing N N 257 PHE CE1 CZ doub Y N 258 PHE CE1 HE1 sing N N 259 PHE CE2 CZ sing Y N 260 PHE CE2 HE2 sing N N 261 PHE CZ HZ sing N N 262 PHE OXT HXT sing N N 263 PRO N CA sing N N 264 PRO N CD sing N N 265 PRO N H sing N N 266 PRO CA C sing N N 267 PRO CA CB sing N N 268 PRO CA HA sing N N 269 PRO C O doub N N 270 PRO C OXT sing N N 271 PRO CB CG sing N N 272 PRO CB HB2 sing N N 273 PRO CB HB3 sing N N 274 PRO CG CD sing N N 275 PRO CG HG2 sing N N 276 PRO CG HG3 sing N N 277 PRO CD HD2 sing N N 278 PRO CD HD3 sing N N 279 PRO OXT HXT sing N N 280 SER N CA sing N N 281 SER N H sing N N 282 SER N H2 sing N N 283 SER CA C sing N N 284 SER CA CB sing N N 285 SER CA HA sing N N 286 SER C O doub N N 287 SER C OXT sing N N 288 SER CB OG sing N N 289 SER CB HB2 sing N N 290 SER CB HB3 sing N N 291 SER OG HG sing N N 292 SER OXT HXT sing N N 293 THR N CA sing N N 294 THR N H sing N N 295 THR N H2 sing N N 296 THR CA C sing N N 297 THR CA CB sing N N 298 THR CA HA sing N N 299 THR C O doub N N 300 THR C OXT sing N N 301 THR CB OG1 sing N N 302 THR CB CG2 sing N N 303 THR CB HB sing N N 304 THR OG1 HG1 sing N N 305 THR CG2 HG21 sing N N 306 THR CG2 HG22 sing N N 307 THR CG2 HG23 sing N N 308 THR OXT HXT sing N N 309 TRP N CA sing N N 310 TRP N H sing N N 311 TRP N H2 sing N N 312 TRP CA C sing N N 313 TRP CA CB sing N N 314 TRP CA HA sing N N 315 TRP C O doub N N 316 TRP C OXT sing N N 317 TRP CB CG sing N N 318 TRP CB HB2 sing N N 319 TRP CB HB3 sing N N 320 TRP CG CD1 doub Y N 321 TRP CG CD2 sing Y N 322 TRP CD1 NE1 sing Y N 323 TRP CD1 HD1 sing N N 324 TRP CD2 CE2 doub Y N 325 TRP CD2 CE3 sing Y N 326 TRP NE1 CE2 sing Y N 327 TRP NE1 HE1 sing N N 328 TRP CE2 CZ2 sing Y N 329 TRP CE3 CZ3 doub Y N 330 TRP CE3 HE3 sing N N 331 TRP CZ2 CH2 doub Y N 332 TRP CZ2 HZ2 sing N N 333 TRP CZ3 CH2 sing Y N 334 TRP CZ3 HZ3 sing N N 335 TRP CH2 HH2 sing N N 336 TRP OXT HXT sing N N 337 TYR N CA sing N N 338 TYR N H sing N N 339 TYR N H2 sing N N 340 TYR CA C sing N N 341 TYR CA CB sing N N 342 TYR CA HA sing N N 343 TYR C O doub N N 344 TYR C OXT sing N N 345 TYR CB CG sing N N 346 TYR CB HB2 sing N N 347 TYR CB HB3 sing N N 348 TYR CG CD1 doub Y N 349 TYR CG CD2 sing Y N 350 TYR CD1 CE1 sing Y N 351 TYR CD1 HD1 sing N N 352 TYR CD2 CE2 doub Y N 353 TYR CD2 HD2 sing N N 354 TYR CE1 CZ doub Y N 355 TYR CE1 HE1 sing N N 356 TYR CE2 CZ sing Y N 357 TYR CE2 HE2 sing N N 358 TYR CZ OH sing N N 359 TYR OH HH sing N N 360 TYR OXT HXT sing N N 361 VAL N CA sing N N 362 VAL N H sing N N 363 VAL N H2 sing N N 364 VAL CA C sing N N 365 VAL CA CB sing N N 366 VAL CA HA sing N N 367 VAL C O doub N N 368 VAL C OXT sing N N 369 VAL CB CG1 sing N N 370 VAL CB CG2 sing N N 371 VAL CB HB sing N N 372 VAL CG1 HG11 sing N N 373 VAL CG1 HG12 sing N N 374 VAL CG1 HG13 sing N N 375 VAL CG2 HG21 sing N N 376 VAL CG2 HG22 sing N N 377 VAL CG2 HG23 sing N N 378 VAL OXT HXT sing N N 379 # _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.details 'Homology model based on sequence alignment of CqDVP-4 to proteins with known crystal structures' # _atom_sites.entry_id 7KCG _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.028736 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016756 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011704 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ # loop_ #