data_7KL2 # _entry.id 7KL2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7KL2 pdb_00007kl2 10.2210/pdb7kl2/pdb WWPDB D_1000252653 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'This entry has the same protein and peptide-bound structure, but no ATP is bound.' 6XOE unspecified PDB 'This entry has the same protein and peptide-bound structure, but crystallized in different cell constants.' 7KL4 unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7KL2 _pdbx_database_status.recvd_initial_deposition_date 2020-10-28 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Ozden, C.' 1 0000-0002-5673-878X 'Stratton, M.M.' 2 0000-0003-2686-9022 'Garman, S.C.' 3 0000-0001-9912-2670 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluN2B(S1303D)' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ozden, C.' 1 0000-0002-5673-878X primary 'Stratton, M.M.' 2 0000-0003-2686-9022 primary 'Garman, S.C.' 3 0000-0001-9912-2670 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 95.800 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7KL2 _cell.details ? _cell.formula_units_Z ? _cell.length_a 44.777 _cell.length_a_esd ? _cell.length_b 65.162 _cell.length_b_esd ? _cell.length_c 54.105 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7KL2 _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Calcium/calmodulin-dependent protein kinase type II subunit alpha' 30548.086 1 2.7.11.17 'D135N, Q223K' ? ? 2 polymer syn 'Glutamate receptor ionotropic, NMDA 2B' 2782.165 1 ? S1303D ? ? 3 water nat water 18.015 6 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'CaMK-II subunit alpha' 2 ;GluN2B,Glutamate [NMDA] receptor subunit epsilon-2,N-methyl D-aspartate receptor subtype 2B,NR2B,N-methyl-D-aspartate receptor subunit 3,hNR3 ; # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;TRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGHHY LIFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRNLKPENLLLASKLKGAAVKLADFGLAIEVEGE QQAWFGFAGTPGYLSPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYKQIKAGAYDFPSPEWDTVTPEAKD LINKMLTINPSKRITAAEALKHPWISHR ; ;TRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGHHY LIFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRNLKPENLLLASKLKGAAVKLADFGLAIEVEGE QQAWFGFAGTPGYLSPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYKQIKAGAYDFPSPEWDTVTPEAKD LINKMLTINPSKRITAAEALKHPWISHR ; A ? 2 'polypeptide(L)' no no KAQKKNRNKLRRQHDYDTFVDL KAQKKNRNKLRRQHDYDTFVDL B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 ARG n 1 3 PHE n 1 4 THR n 1 5 GLU n 1 6 GLU n 1 7 TYR n 1 8 GLN n 1 9 LEU n 1 10 PHE n 1 11 GLU n 1 12 GLU n 1 13 LEU n 1 14 GLY n 1 15 LYS n 1 16 GLY n 1 17 ALA n 1 18 PHE n 1 19 SER n 1 20 VAL n 1 21 VAL n 1 22 ARG n 1 23 ARG n 1 24 CYS n 1 25 VAL n 1 26 LYS n 1 27 VAL n 1 28 LEU n 1 29 ALA n 1 30 GLY n 1 31 GLN n 1 32 GLU n 1 33 TYR n 1 34 ALA n 1 35 ALA n 1 36 LYS n 1 37 ILE n 1 38 ILE n 1 39 ASN n 1 40 THR n 1 41 LYS n 1 42 LYS n 1 43 LEU n 1 44 SER n 1 45 ALA n 1 46 ARG n 1 47 ASP n 1 48 HIS n 1 49 GLN n 1 50 LYS n 1 51 LEU n 1 52 GLU n 1 53 ARG n 1 54 GLU n 1 55 ALA n 1 56 ARG n 1 57 ILE n 1 58 CYS n 1 59 ARG n 1 60 LEU n 1 61 LEU n 1 62 LYS n 1 63 HIS n 1 64 PRO n 1 65 ASN n 1 66 ILE n 1 67 VAL n 1 68 ARG n 1 69 LEU n 1 70 HIS n 1 71 ASP n 1 72 SER n 1 73 ILE n 1 74 SER n 1 75 GLU n 1 76 GLU n 1 77 GLY n 1 78 HIS n 1 79 HIS n 1 80 TYR n 1 81 LEU n 1 82 ILE n 1 83 PHE n 1 84 ASP n 1 85 LEU n 1 86 VAL n 1 87 THR n 1 88 GLY n 1 89 GLY n 1 90 GLU n 1 91 LEU n 1 92 PHE n 1 93 GLU n 1 94 ASP n 1 95 ILE n 1 96 VAL n 1 97 ALA n 1 98 ARG n 1 99 GLU n 1 100 TYR n 1 101 TYR n 1 102 SER n 1 103 GLU n 1 104 ALA n 1 105 ASP n 1 106 ALA n 1 107 SER n 1 108 HIS n 1 109 CYS n 1 110 ILE n 1 111 GLN n 1 112 GLN n 1 113 ILE n 1 114 LEU n 1 115 GLU n 1 116 ALA n 1 117 VAL n 1 118 LEU n 1 119 HIS n 1 120 CYS n 1 121 HIS n 1 122 GLN n 1 123 MET n 1 124 GLY n 1 125 VAL n 1 126 VAL n 1 127 HIS n 1 128 ARG n 1 129 ASN n 1 130 LEU n 1 131 LYS n 1 132 PRO n 1 133 GLU n 1 134 ASN n 1 135 LEU n 1 136 LEU n 1 137 LEU n 1 138 ALA n 1 139 SER n 1 140 LYS n 1 141 LEU n 1 142 LYS n 1 143 GLY n 1 144 ALA n 1 145 ALA n 1 146 VAL n 1 147 LYS n 1 148 LEU n 1 149 ALA n 1 150 ASP n 1 151 PHE n 1 152 GLY n 1 153 LEU n 1 154 ALA n 1 155 ILE n 1 156 GLU n 1 157 VAL n 1 158 GLU n 1 159 GLY n 1 160 GLU n 1 161 GLN n 1 162 GLN n 1 163 ALA n 1 164 TRP n 1 165 PHE n 1 166 GLY n 1 167 PHE n 1 168 ALA n 1 169 GLY n 1 170 THR n 1 171 PRO n 1 172 GLY n 1 173 TYR n 1 174 LEU n 1 175 SER n 1 176 PRO n 1 177 GLU n 1 178 VAL n 1 179 LEU n 1 180 ARG n 1 181 LYS n 1 182 ASP n 1 183 PRO n 1 184 TYR n 1 185 GLY n 1 186 LYS n 1 187 PRO n 1 188 VAL n 1 189 ASP n 1 190 LEU n 1 191 TRP n 1 192 ALA n 1 193 CYS n 1 194 GLY n 1 195 VAL n 1 196 ILE n 1 197 LEU n 1 198 TYR n 1 199 ILE n 1 200 LEU n 1 201 LEU n 1 202 VAL n 1 203 GLY n 1 204 TYR n 1 205 PRO n 1 206 PRO n 1 207 PHE n 1 208 TRP n 1 209 ASP n 1 210 GLU n 1 211 ASP n 1 212 GLN n 1 213 HIS n 1 214 ARG n 1 215 LEU n 1 216 TYR n 1 217 LYS n 1 218 GLN n 1 219 ILE n 1 220 LYS n 1 221 ALA n 1 222 GLY n 1 223 ALA n 1 224 TYR n 1 225 ASP n 1 226 PHE n 1 227 PRO n 1 228 SER n 1 229 PRO n 1 230 GLU n 1 231 TRP n 1 232 ASP n 1 233 THR n 1 234 VAL n 1 235 THR n 1 236 PRO n 1 237 GLU n 1 238 ALA n 1 239 LYS n 1 240 ASP n 1 241 LEU n 1 242 ILE n 1 243 ASN n 1 244 LYS n 1 245 MET n 1 246 LEU n 1 247 THR n 1 248 ILE n 1 249 ASN n 1 250 PRO n 1 251 SER n 1 252 LYS n 1 253 ARG n 1 254 ILE n 1 255 THR n 1 256 ALA n 1 257 ALA n 1 258 GLU n 1 259 ALA n 1 260 LEU n 1 261 LYS n 1 262 HIS n 1 263 PRO n 1 264 TRP n 1 265 ILE n 1 266 SER n 1 267 HIS n 1 268 ARG n 2 1 LYS n 2 2 ALA n 2 3 GLN n 2 4 LYS n 2 5 LYS n 2 6 ASN n 2 7 ARG n 2 8 ASN n 2 9 LYS n 2 10 LEU n 2 11 ARG n 2 12 ARG n 2 13 GLN n 2 14 HIS n 2 15 ASP n 2 16 TYR n 2 17 ASP n 2 18 THR n 2 19 PHE n 2 20 VAL n 2 21 ASP n 2 22 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 268 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CAMK2A, CAMKA, KIAA0968' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 22 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP KCC2A_HUMAN Q9UQM7 ? 1 ;TRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGHHY LIFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGE QQAWFGFAGTPGYLSPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKD LINKMLTINPSKRITAAEALKHPWISHR ; 7 2 UNP NMDE2_HUMAN Q13224 ? 2 KAQKKNRNKLRRQHSYDTFVDL 1289 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7KL2 A 1 ? 268 ? Q9UQM7 7 ? 274 ? 7 274 2 2 7KL2 B 1 ? 22 ? Q13224 1289 ? 1310 ? 1289 1310 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7KL2 ASN A 129 ? UNP Q9UQM7 ASP 135 'engineered mutation' 135 1 1 7KL2 LYS A 217 ? UNP Q9UQM7 GLN 223 'engineered mutation' 223 2 2 7KL2 ASP B 15 ? UNP Q13224 SER 1303 'engineered mutation' 1303 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7KL2 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.36 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 47.79 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.15 M DL-Malic acid pH 7, 20% PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details '100 K thorughout the collection' _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details 'Rigaku VariMax HF' _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 R 200K-A' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-07-08 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU MICROMAX-007 HF' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.5418 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7KL2 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.550 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9973 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.500 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.100 _reflns.pdbx_Rmerge_I_obs 0.199 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 3.200 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.648 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.238 _reflns.pdbx_Rpim_I_all 0.138 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 30971 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.550 2.590 ? ? ? ? ? ? 471 97.700 ? ? ? ? ? ? ? ? ? ? ? ? ? 2.600 ? 1.252 ? ? ? ? ? 1 1 0.133 ? ? ? ? ? ? ? ? ? ? 2.590 2.640 ? ? ? ? ? ? 500 98.800 ? ? ? ? ? ? ? ? ? ? ? ? ? 2.800 ? 1.371 ? ? ? ? ? 2 1 0.048 ? ? ? ? ? ? ? ? ? ? 2.640 2.690 ? ? ? ? ? ? 484 99.200 ? ? ? ? ? ? ? ? ? ? ? ? ? 2.800 ? 1.346 ? ? ? ? ? 3 1 0.182 ? ? ? ? ? ? ? ? ? ? 2.690 2.750 ? ? ? ? ? ? 496 99.800 ? ? ? ? ? ? ? ? ? ? ? ? ? 2.900 ? 1.283 ? ? ? ? ? 4 1 0.295 ? ? ? ? ? ? ? ? ? ? 2.750 2.810 ? ? ? ? ? ? 516 99.200 ? ? ? ? ? ? ? ? ? ? ? ? ? 2.800 ? 1.284 ? ? ? ? ? 5 1 0.261 ? ? ? ? ? ? ? ? ? ? 2.810 2.870 ? ? ? ? ? ? 464 100.000 ? ? ? ? ? ? ? ? ? ? ? ? ? 3.000 ? 1.299 ? ? ? ? ? 6 1 0.387 ? ? ? ? ? ? ? ? ? ? 2.870 2.940 ? ? ? ? ? ? 504 99.600 ? ? ? ? ? ? ? ? ? ? ? ? ? 2.900 ? 1.297 ? ? ? ? ? 7 1 0.472 ? ? ? ? ? ? ? ? ? ? 2.940 3.020 ? ? ? ? ? ? 508 99.800 ? ? ? ? ? ? ? ? ? ? ? ? ? 3.000 ? 1.370 ? ? ? 0.830 ? 8 1 0.598 ? ? ? ? ? ? ? ? ? ? 3.020 3.110 ? ? ? ? ? ? 493 100.000 ? ? ? ? 0.776 ? ? ? ? ? ? ? ? 3.200 ? 1.383 ? ? 0.936 0.515 ? 9 1 0.630 ? ? ? ? ? ? ? ? ? ? 3.110 3.210 ? ? ? ? ? ? 504 100.000 ? ? ? ? 0.528 ? ? ? ? ? ? ? ? 3.200 ? 1.607 ? ? 0.635 0.347 ? 10 1 0.645 ? ? ? ? ? ? ? ? ? ? 3.210 3.330 ? ? ? ? ? ? 500 100.000 ? ? ? ? 0.392 ? ? ? ? ? ? ? ? 3.300 ? 1.553 ? ? 0.470 0.255 ? 11 1 0.795 ? ? ? ? ? ? ? ? ? ? 3.330 3.460 ? ? ? ? ? ? 491 99.600 ? ? ? ? 0.281 ? ? ? ? ? ? ? ? 3.400 ? 1.591 ? ? 0.335 0.180 ? 12 1 0.856 ? ? ? ? ? ? ? ? ? ? 3.460 3.620 ? ? ? ? ? ? 506 99.600 ? ? ? ? 0.263 ? ? ? ? ? ? ? ? 3.400 ? 1.785 ? ? 0.313 0.168 ? 13 1 0.904 ? ? ? ? ? ? ? ? ? ? 3.620 3.810 ? ? ? ? ? ? 504 100.000 ? ? ? ? 0.194 ? ? ? ? ? ? ? ? 3.400 ? 1.729 ? ? 0.231 0.124 ? 14 1 0.946 ? ? ? ? ? ? ? ? ? ? 3.810 4.050 ? ? ? ? ? ? 506 100.000 ? ? ? ? 0.201 ? ? ? ? ? ? ? ? 3.300 ? 1.908 ? ? 0.241 0.131 ? 15 1 0.956 ? ? ? ? ? ? ? ? ? ? 4.050 4.360 ? ? ? ? ? ? 489 99.800 ? ? ? ? 0.153 ? ? ? ? ? ? ? ? 3.300 ? 1.858 ? ? 0.183 0.100 ? 16 1 0.970 ? ? ? ? ? ? ? ? ? ? 4.360 4.800 ? ? ? ? ? ? 504 100.000 ? ? ? ? 0.140 ? ? ? ? ? ? ? ? 3.300 ? 2.061 ? ? 0.168 0.091 ? 17 1 0.971 ? ? ? ? ? ? ? ? ? ? 4.800 5.490 ? ? ? ? ? ? 511 99.400 ? ? ? ? 0.150 ? ? ? ? ? ? ? ? 3.300 ? 1.744 ? ? 0.179 0.097 ? 18 1 0.973 ? ? ? ? ? ? ? ? ? ? 5.490 6.920 ? ? ? ? ? ? 499 100.000 ? ? ? ? 0.169 ? ? ? ? ? ? ? ? 3.200 ? 2.190 ? ? 0.203 0.111 ? 19 1 0.956 ? ? ? ? ? ? ? ? ? ? 6.920 50.000 ? ? ? ? ? ? 523 97.900 ? ? ? ? 0.083 ? ? ? ? ? ? ? ? 2.900 ? 2.647 ? ? 0.101 0.058 ? 20 1 0.989 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] -2.0200 _refine.aniso_B[1][2] -0.0000 _refine.aniso_B[1][3] 0.8800 _refine.aniso_B[2][2] -0.8500 _refine.aniso_B[2][3] -0.0000 _refine.aniso_B[3][3] 2.6400 _refine.B_iso_max 99.500 _refine.B_iso_mean 45.3860 _refine.B_iso_min 16.380 _refine.correlation_coeff_Fo_to_Fc 0.9210 _refine.correlation_coeff_Fo_to_Fc_free 0.8740 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7KL2 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.5600 _refine.ls_d_res_low 41.5300 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9458 _refine.ls_number_reflns_R_free 500 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.3300 _refine.ls_percent_reflns_R_free 5.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2466 _refine.ls_R_factor_R_free 0.2930 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2439 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6VZK _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 1.3830 _refine.pdbx_overall_ESU_R_Free 0.3730 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 30.7270 _refine.overall_SU_ML 0.5460 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.5600 _refine_hist.d_res_low 41.5300 _refine_hist.number_atoms_solvent 6 _refine_hist.number_atoms_total 2245 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 284 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent 24.37 _refine_hist.pdbx_number_atoms_protein 2239 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.005 0.013 2296 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 2089 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.439 1.637 3123 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.140 1.572 4816 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.455 5.000 282 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 33.029 21.855 124 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 21.391 15.000 359 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 13.830 15.000 15 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.056 0.200 294 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 0.020 2590 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 503 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.56 _refine_ls_shell.d_res_low 2.6230 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 32 _refine_ls_shell.number_reflns_R_work 577 _refine_ls_shell.percent_reflns_obs 82.3000 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3730 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.4170 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7KL2 _struct.title 'Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluN2B(S1303D)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7KL2 _struct_keywords.text 'CaMKII, Kinase, Human, CAMK2A, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ARG A 2 ? GLU A 6 ? ARG A 8 GLU A 12 1 ? 5 HELX_P HELX_P2 AA2 SER A 44 ? ARG A 59 ? SER A 50 ARG A 65 1 ? 16 HELX_P HELX_P3 AA3 GLU A 90 ? ALA A 97 ? GLU A 96 ALA A 103 1 ? 8 HELX_P HELX_P4 AA4 SER A 102 ? MET A 123 ? SER A 108 MET A 129 1 ? 22 HELX_P HELX_P5 AA5 THR A 170 ? LEU A 174 ? THR A 176 LEU A 180 5 ? 5 HELX_P HELX_P6 AA6 SER A 175 ? ARG A 180 ? SER A 181 ARG A 186 1 ? 6 HELX_P HELX_P7 AA7 PRO A 187 ? GLY A 203 ? PRO A 193 GLY A 209 1 ? 17 HELX_P HELX_P8 AA8 ASP A 211 ? ALA A 221 ? ASP A 217 ALA A 227 1 ? 11 HELX_P HELX_P9 AA9 PRO A 229 ? VAL A 234 ? PRO A 235 VAL A 240 5 ? 6 HELX_P HELX_P10 AB1 THR A 235 ? LEU A 246 ? THR A 241 LEU A 252 1 ? 12 HELX_P HELX_P11 AB2 THR A 255 ? HIS A 262 ? THR A 261 HIS A 268 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id SER _struct_mon_prot_cis.label_seq_id 228 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id SER _struct_mon_prot_cis.auth_seq_id 234 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 229 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 235 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 5.62 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 7 ? LEU A 9 ? TYR A 13 LEU A 15 AA1 2 SER A 19 ? LYS A 26 ? SER A 25 LYS A 32 AA1 3 GLU A 32 ? ASN A 39 ? GLU A 38 ASN A 45 AA1 4 HIS A 78 ? PHE A 83 ? HIS A 84 PHE A 89 AA1 5 LEU A 69 ? GLU A 75 ? LEU A 75 GLU A 81 AA2 1 VAL A 125 ? VAL A 126 ? VAL A 131 VAL A 132 AA2 2 ILE A 155 ? GLU A 156 ? ILE A 161 GLU A 162 AA3 1 LEU A 135 ? LEU A 137 ? LEU A 141 LEU A 143 AA3 2 VAL A 146 ? LEU A 148 ? VAL A 152 LEU A 154 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLN A 8 ? N GLN A 14 O VAL A 25 ? O VAL A 31 AA1 2 3 N CYS A 24 ? N CYS A 30 O TYR A 33 ? O TYR A 39 AA1 3 4 N ALA A 34 ? N ALA A 40 O PHE A 83 ? O PHE A 89 AA1 4 5 O TYR A 80 ? O TYR A 86 N ILE A 73 ? N ILE A 79 AA2 1 2 N VAL A 126 ? N VAL A 132 O ILE A 155 ? O ILE A 161 AA3 1 2 N LEU A 136 ? N LEU A 142 O LYS A 147 ? O LYS A 153 # _atom_sites.entry_id 7KL2 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.022333 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.002269 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015346 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.018578 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 7 7 THR THR A . n A 1 2 ARG 2 8 8 ARG ARG A . n A 1 3 PHE 3 9 9 PHE PHE A . n A 1 4 THR 4 10 10 THR THR A . n A 1 5 GLU 5 11 11 GLU GLU A . n A 1 6 GLU 6 12 12 GLU GLU A . n A 1 7 TYR 7 13 13 TYR TYR A . n A 1 8 GLN 8 14 14 GLN GLN A . n A 1 9 LEU 9 15 15 LEU LEU A . n A 1 10 PHE 10 16 16 PHE PHE A . n A 1 11 GLU 11 17 17 GLU GLU A . n A 1 12 GLU 12 18 18 GLU GLU A . n A 1 13 LEU 13 19 19 LEU LEU A . n A 1 14 GLY 14 20 20 GLY GLY A . n A 1 15 LYS 15 21 21 LYS LYS A . n A 1 16 GLY 16 22 22 GLY GLY A . n A 1 17 ALA 17 23 23 ALA ALA A . n A 1 18 PHE 18 24 24 PHE PHE A . n A 1 19 SER 19 25 25 SER SER A . n A 1 20 VAL 20 26 26 VAL VAL A . n A 1 21 VAL 21 27 27 VAL VAL A . n A 1 22 ARG 22 28 28 ARG ARG A . n A 1 23 ARG 23 29 29 ARG ARG A . n A 1 24 CYS 24 30 30 CYS CYS A . n A 1 25 VAL 25 31 31 VAL VAL A . n A 1 26 LYS 26 32 32 LYS LYS A . n A 1 27 VAL 27 33 33 VAL VAL A . n A 1 28 LEU 28 34 34 LEU LEU A . n A 1 29 ALA 29 35 35 ALA ALA A . n A 1 30 GLY 30 36 36 GLY GLY A . n A 1 31 GLN 31 37 37 GLN GLN A . n A 1 32 GLU 32 38 38 GLU GLU A . n A 1 33 TYR 33 39 39 TYR TYR A . n A 1 34 ALA 34 40 40 ALA ALA A . n A 1 35 ALA 35 41 41 ALA ALA A . n A 1 36 LYS 36 42 42 LYS LYS A . n A 1 37 ILE 37 43 43 ILE ILE A . n A 1 38 ILE 38 44 44 ILE ILE A . n A 1 39 ASN 39 45 45 ASN ASN A . n A 1 40 THR 40 46 46 THR THR A . n A 1 41 LYS 41 47 47 LYS LYS A . n A 1 42 LYS 42 48 48 LYS LYS A . n A 1 43 LEU 43 49 49 LEU LEU A . n A 1 44 SER 44 50 50 SER SER A . n A 1 45 ALA 45 51 51 ALA ALA A . n A 1 46 ARG 46 52 52 ARG ARG A . n A 1 47 ASP 47 53 53 ASP ASP A . n A 1 48 HIS 48 54 54 HIS HIS A . n A 1 49 GLN 49 55 55 GLN GLN A . n A 1 50 LYS 50 56 56 LYS LYS A . n A 1 51 LEU 51 57 57 LEU LEU A . n A 1 52 GLU 52 58 58 GLU GLU A . n A 1 53 ARG 53 59 59 ARG ARG A . n A 1 54 GLU 54 60 60 GLU GLU A . n A 1 55 ALA 55 61 61 ALA ALA A . n A 1 56 ARG 56 62 62 ARG ARG A . n A 1 57 ILE 57 63 63 ILE ILE A . n A 1 58 CYS 58 64 64 CYS CYS A . n A 1 59 ARG 59 65 65 ARG ARG A . n A 1 60 LEU 60 66 66 LEU LEU A . n A 1 61 LEU 61 67 67 LEU LEU A . n A 1 62 LYS 62 68 68 LYS LYS A . n A 1 63 HIS 63 69 69 HIS HIS A . n A 1 64 PRO 64 70 70 PRO PRO A . n A 1 65 ASN 65 71 71 ASN ASN A . n A 1 66 ILE 66 72 72 ILE ILE A . n A 1 67 VAL 67 73 73 VAL VAL A . n A 1 68 ARG 68 74 74 ARG ARG A . n A 1 69 LEU 69 75 75 LEU LEU A . n A 1 70 HIS 70 76 76 HIS HIS A . n A 1 71 ASP 71 77 77 ASP ASP A . n A 1 72 SER 72 78 78 SER SER A . n A 1 73 ILE 73 79 79 ILE ILE A . n A 1 74 SER 74 80 80 SER SER A . n A 1 75 GLU 75 81 81 GLU GLU A . n A 1 76 GLU 76 82 82 GLU GLU A . n A 1 77 GLY 77 83 83 GLY GLY A . n A 1 78 HIS 78 84 84 HIS HIS A . n A 1 79 HIS 79 85 85 HIS HIS A . n A 1 80 TYR 80 86 86 TYR TYR A . n A 1 81 LEU 81 87 87 LEU LEU A . n A 1 82 ILE 82 88 88 ILE ILE A . n A 1 83 PHE 83 89 89 PHE PHE A . n A 1 84 ASP 84 90 90 ASP ASP A . n A 1 85 LEU 85 91 91 LEU LEU A . n A 1 86 VAL 86 92 92 VAL VAL A . n A 1 87 THR 87 93 93 THR THR A . n A 1 88 GLY 88 94 94 GLY GLY A . n A 1 89 GLY 89 95 95 GLY GLY A . n A 1 90 GLU 90 96 96 GLU GLU A . n A 1 91 LEU 91 97 97 LEU LEU A . n A 1 92 PHE 92 98 98 PHE PHE A . n A 1 93 GLU 93 99 99 GLU GLU A . n A 1 94 ASP 94 100 100 ASP ASP A . n A 1 95 ILE 95 101 101 ILE ILE A . n A 1 96 VAL 96 102 102 VAL VAL A . n A 1 97 ALA 97 103 103 ALA ALA A . n A 1 98 ARG 98 104 104 ARG ARG A . n A 1 99 GLU 99 105 105 GLU GLU A . n A 1 100 TYR 100 106 106 TYR TYR A . n A 1 101 TYR 101 107 107 TYR TYR A . n A 1 102 SER 102 108 108 SER SER A . n A 1 103 GLU 103 109 109 GLU GLU A . n A 1 104 ALA 104 110 110 ALA ALA A . n A 1 105 ASP 105 111 111 ASP ASP A . n A 1 106 ALA 106 112 112 ALA ALA A . n A 1 107 SER 107 113 113 SER SER A . n A 1 108 HIS 108 114 114 HIS HIS A . n A 1 109 CYS 109 115 115 CYS CYS A . n A 1 110 ILE 110 116 116 ILE ILE A . n A 1 111 GLN 111 117 117 GLN GLN A . n A 1 112 GLN 112 118 118 GLN GLN A . n A 1 113 ILE 113 119 119 ILE ILE A . n A 1 114 LEU 114 120 120 LEU LEU A . n A 1 115 GLU 115 121 121 GLU GLU A . n A 1 116 ALA 116 122 122 ALA ALA A . n A 1 117 VAL 117 123 123 VAL VAL A . n A 1 118 LEU 118 124 124 LEU LEU A . n A 1 119 HIS 119 125 125 HIS HIS A . n A 1 120 CYS 120 126 126 CYS CYS A . n A 1 121 HIS 121 127 127 HIS HIS A . n A 1 122 GLN 122 128 128 GLN GLN A . n A 1 123 MET 123 129 129 MET MET A . n A 1 124 GLY 124 130 130 GLY GLY A . n A 1 125 VAL 125 131 131 VAL VAL A . n A 1 126 VAL 126 132 132 VAL VAL A . n A 1 127 HIS 127 133 133 HIS HIS A . n A 1 128 ARG 128 134 134 ARG ARG A . n A 1 129 ASN 129 135 135 ASN ASN A . n A 1 130 LEU 130 136 136 LEU LEU A . n A 1 131 LYS 131 137 137 LYS LYS A . n A 1 132 PRO 132 138 138 PRO PRO A . n A 1 133 GLU 133 139 139 GLU GLU A . n A 1 134 ASN 134 140 140 ASN ASN A . n A 1 135 LEU 135 141 141 LEU LEU A . n A 1 136 LEU 136 142 142 LEU LEU A . n A 1 137 LEU 137 143 143 LEU LEU A . n A 1 138 ALA 138 144 144 ALA ALA A . n A 1 139 SER 139 145 145 SER SER A . n A 1 140 LYS 140 146 146 LYS LYS A . n A 1 141 LEU 141 147 147 LEU LEU A . n A 1 142 LYS 142 148 148 LYS LYS A . n A 1 143 GLY 143 149 149 GLY GLY A . n A 1 144 ALA 144 150 150 ALA ALA A . n A 1 145 ALA 145 151 151 ALA ALA A . n A 1 146 VAL 146 152 152 VAL VAL A . n A 1 147 LYS 147 153 153 LYS LYS A . n A 1 148 LEU 148 154 154 LEU LEU A . n A 1 149 ALA 149 155 155 ALA ALA A . n A 1 150 ASP 150 156 156 ASP ASP A . n A 1 151 PHE 151 157 157 PHE PHE A . n A 1 152 GLY 152 158 158 GLY GLY A . n A 1 153 LEU 153 159 159 LEU LEU A . n A 1 154 ALA 154 160 160 ALA ALA A . n A 1 155 ILE 155 161 161 ILE ILE A . n A 1 156 GLU 156 162 162 GLU GLU A . n A 1 157 VAL 157 163 163 VAL VAL A . n A 1 158 GLU 158 164 164 GLU GLU A . n A 1 159 GLY 159 165 165 GLY GLY A . n A 1 160 GLU 160 166 166 GLU GLU A . n A 1 161 GLN 161 167 167 GLN GLN A . n A 1 162 GLN 162 168 168 GLN GLN A . n A 1 163 ALA 163 169 169 ALA ALA A . n A 1 164 TRP 164 170 170 TRP TRP A . n A 1 165 PHE 165 171 171 PHE PHE A . n A 1 166 GLY 166 172 172 GLY GLY A . n A 1 167 PHE 167 173 173 PHE PHE A . n A 1 168 ALA 168 174 174 ALA ALA A . n A 1 169 GLY 169 175 175 GLY GLY A . n A 1 170 THR 170 176 176 THR THR A . n A 1 171 PRO 171 177 177 PRO PRO A . n A 1 172 GLY 172 178 178 GLY GLY A . n A 1 173 TYR 173 179 179 TYR TYR A . n A 1 174 LEU 174 180 180 LEU LEU A . n A 1 175 SER 175 181 181 SER SER A . n A 1 176 PRO 176 182 182 PRO PRO A . n A 1 177 GLU 177 183 183 GLU GLU A . n A 1 178 VAL 178 184 184 VAL VAL A . n A 1 179 LEU 179 185 185 LEU LEU A . n A 1 180 ARG 180 186 186 ARG ARG A . n A 1 181 LYS 181 187 187 LYS LYS A . n A 1 182 ASP 182 188 188 ASP ASP A . n A 1 183 PRO 183 189 189 PRO PRO A . n A 1 184 TYR 184 190 190 TYR TYR A . n A 1 185 GLY 185 191 191 GLY GLY A . n A 1 186 LYS 186 192 192 LYS LYS A . n A 1 187 PRO 187 193 193 PRO PRO A . n A 1 188 VAL 188 194 194 VAL VAL A . n A 1 189 ASP 189 195 195 ASP ASP A . n A 1 190 LEU 190 196 196 LEU LEU A . n A 1 191 TRP 191 197 197 TRP TRP A . n A 1 192 ALA 192 198 198 ALA ALA A . n A 1 193 CYS 193 199 199 CYS CYS A . n A 1 194 GLY 194 200 200 GLY GLY A . n A 1 195 VAL 195 201 201 VAL VAL A . n A 1 196 ILE 196 202 202 ILE ILE A . n A 1 197 LEU 197 203 203 LEU LEU A . n A 1 198 TYR 198 204 204 TYR TYR A . n A 1 199 ILE 199 205 205 ILE ILE A . n A 1 200 LEU 200 206 206 LEU LEU A . n A 1 201 LEU 201 207 207 LEU LEU A . n A 1 202 VAL 202 208 208 VAL VAL A . n A 1 203 GLY 203 209 209 GLY GLY A . n A 1 204 TYR 204 210 210 TYR TYR A . n A 1 205 PRO 205 211 211 PRO PRO A . n A 1 206 PRO 206 212 212 PRO PRO A . n A 1 207 PHE 207 213 213 PHE PHE A . n A 1 208 TRP 208 214 214 TRP TRP A . n A 1 209 ASP 209 215 215 ASP ASP A . n A 1 210 GLU 210 216 216 GLU GLU A . n A 1 211 ASP 211 217 217 ASP ASP A . n A 1 212 GLN 212 218 218 GLN GLN A . n A 1 213 HIS 213 219 219 HIS HIS A . n A 1 214 ARG 214 220 220 ARG ARG A . n A 1 215 LEU 215 221 221 LEU LEU A . n A 1 216 TYR 216 222 222 TYR TYR A . n A 1 217 LYS 217 223 223 LYS LYS A . n A 1 218 GLN 218 224 224 GLN GLN A . n A 1 219 ILE 219 225 225 ILE ILE A . n A 1 220 LYS 220 226 226 LYS LYS A . n A 1 221 ALA 221 227 227 ALA ALA A . n A 1 222 GLY 222 228 228 GLY GLY A . n A 1 223 ALA 223 229 229 ALA ALA A . n A 1 224 TYR 224 230 230 TYR TYR A . n A 1 225 ASP 225 231 231 ASP ASP A . n A 1 226 PHE 226 232 232 PHE PHE A . n A 1 227 PRO 227 233 233 PRO PRO A . n A 1 228 SER 228 234 234 SER SER A . n A 1 229 PRO 229 235 235 PRO PRO A . n A 1 230 GLU 230 236 236 GLU GLU A . n A 1 231 TRP 231 237 237 TRP TRP A . n A 1 232 ASP 232 238 238 ASP ASP A . n A 1 233 THR 233 239 239 THR THR A . n A 1 234 VAL 234 240 240 VAL VAL A . n A 1 235 THR 235 241 241 THR THR A . n A 1 236 PRO 236 242 242 PRO PRO A . n A 1 237 GLU 237 243 243 GLU GLU A . n A 1 238 ALA 238 244 244 ALA ALA A . n A 1 239 LYS 239 245 245 LYS LYS A . n A 1 240 ASP 240 246 246 ASP ASP A . n A 1 241 LEU 241 247 247 LEU LEU A . n A 1 242 ILE 242 248 248 ILE ILE A . n A 1 243 ASN 243 249 249 ASN ASN A . n A 1 244 LYS 244 250 250 LYS LYS A . n A 1 245 MET 245 251 251 MET MET A . n A 1 246 LEU 246 252 252 LEU LEU A . n A 1 247 THR 247 253 253 THR THR A . n A 1 248 ILE 248 254 254 ILE ILE A . n A 1 249 ASN 249 255 255 ASN ASN A . n A 1 250 PRO 250 256 256 PRO PRO A . n A 1 251 SER 251 257 257 SER SER A . n A 1 252 LYS 252 258 258 LYS LYS A . n A 1 253 ARG 253 259 259 ARG ARG A . n A 1 254 ILE 254 260 260 ILE ILE A . n A 1 255 THR 255 261 261 THR THR A . n A 1 256 ALA 256 262 262 ALA ALA A . n A 1 257 ALA 257 263 263 ALA ALA A . n A 1 258 GLU 258 264 264 GLU GLU A . n A 1 259 ALA 259 265 265 ALA ALA A . n A 1 260 LEU 260 266 266 LEU LEU A . n A 1 261 LYS 261 267 267 LYS LYS A . n A 1 262 HIS 262 268 268 HIS HIS A . n A 1 263 PRO 263 269 269 PRO PRO A . n A 1 264 TRP 264 270 270 TRP TRP A . n A 1 265 ILE 265 271 271 ILE ILE A . n A 1 266 SER 266 272 272 SER SER A . n A 1 267 HIS 267 273 273 HIS HIS A . n A 1 268 ARG 268 274 274 ARG ARG A . n B 2 1 LYS 1 1289 ? ? ? B . n B 2 2 ALA 2 1290 ? ? ? B . n B 2 3 GLN 3 1291 ? ? ? B . n B 2 4 LYS 4 1292 ? ? ? B . n B 2 5 LYS 5 1293 ? ? ? B . n B 2 6 ASN 6 1294 ? ? ? B . n B 2 7 ARG 7 1295 1295 ARG ARG B . n B 2 8 ASN 8 1296 1296 ASN ASN B . n B 2 9 LYS 9 1297 1297 LYS LYS B . n B 2 10 LEU 10 1298 1298 LEU LEU B . n B 2 11 ARG 11 1299 1299 ARG ARG B . n B 2 12 ARG 12 1300 1300 ARG ARG B . n B 2 13 GLN 13 1301 1301 GLN GLN B . n B 2 14 HIS 14 1302 1302 HIS HIS B . n B 2 15 ASP 15 1303 1303 ASP ASP B . n B 2 16 TYR 16 1304 1304 TYR TYR B . n B 2 17 ASP 17 1305 1305 ASP ASP B . n B 2 18 THR 18 1306 1306 THR THR B . n B 2 19 PHE 19 1307 1307 PHE PHE B . n B 2 20 VAL 20 1308 1308 VAL VAL B . n B 2 21 ASP 21 1309 1309 ASP ASP B . n B 2 22 LEU 22 1310 1310 LEU LEU B . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email mstratton@umass.edu _pdbx_contact_author.name_first Margaret _pdbx_contact_author.name_last Stratton _pdbx_contact_author.name_mi M _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-2686-9022 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 HOH 1 301 9 HOH HOH A . C 3 HOH 2 302 6 HOH HOH A . C 3 HOH 3 303 5 HOH HOH A . C 3 HOH 4 304 15 HOH HOH A . C 3 HOH 5 305 18 HOH HOH A . C 3 HOH 6 306 8 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2060 ? 1 MORE -4 ? 1 'SSA (A^2)' 13000 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-12-23 2 'Structure model' 2 0 2022-04-06 3 'Structure model' 2 1 2023-10-18 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 2 'Structure model' author 'Coordinate replacement' 'Atoms with unrealistic or zero occupancies' 'We have gotten rid of some water and ligand molecules.' # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Atomic model' 3 2 'Structure model' 'Author supporting evidence' 4 2 'Structure model' 'Data collection' 5 2 'Structure model' 'Database references' 6 2 'Structure model' 'Derived calculations' 7 2 'Structure model' 'Refinement description' 8 2 'Structure model' 'Source and taxonomy' 9 2 'Structure model' 'Structure summary' 10 3 'Structure model' 'Data collection' 11 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' atom_site 2 2 'Structure model' database_2 3 2 'Structure model' entity 4 2 'Structure model' entity_src_gen 5 2 'Structure model' pdbx_audit_support 6 2 'Structure model' pdbx_contact_author 7 2 'Structure model' pdbx_entity_src_syn 8 2 'Structure model' pdbx_nonpoly_scheme 9 2 'Structure model' pdbx_struct_assembly_gen 10 2 'Structure model' pdbx_struct_assembly_prop 11 2 'Structure model' pdbx_unobs_or_zero_occ_atoms 12 2 'Structure model' pdbx_validate_close_contact 13 2 'Structure model' pdbx_validate_torsion 14 2 'Structure model' refine 15 2 'Structure model' refine_hist 16 2 'Structure model' refine_ls_restr 17 2 'Structure model' refine_ls_shell 18 2 'Structure model' software 19 2 'Structure model' struct_asym 20 2 'Structure model' struct_conf 21 2 'Structure model' struct_mon_prot_cis 22 2 'Structure model' struct_sheet_range 23 3 'Structure model' chem_comp_atom 24 3 'Structure model' chem_comp_bond 25 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_entity.pdbx_number_of_molecules' 4 2 'Structure model' '_entity_src_gen.gene_src_common_name' 5 2 'Structure model' '_pdbx_entity_src_syn.organism_common_name' 6 2 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 7 2 'Structure model' '_pdbx_struct_assembly_prop.value' 8 2 'Structure model' '_pdbx_validate_torsion.auth_comp_id' 9 2 'Structure model' '_pdbx_validate_torsion.auth_seq_id' 10 2 'Structure model' '_pdbx_validate_torsion.phi' 11 2 'Structure model' '_pdbx_validate_torsion.psi' 12 2 'Structure model' '_refine.B_iso_max' 13 2 'Structure model' '_refine.B_iso_mean' 14 2 'Structure model' '_refine.B_iso_min' 15 2 'Structure model' '_refine.aniso_B[1][1]' 16 2 'Structure model' '_refine.aniso_B[1][3]' 17 2 'Structure model' '_refine.aniso_B[2][2]' 18 2 'Structure model' '_refine.aniso_B[3][3]' 19 2 'Structure model' '_refine.correlation_coeff_Fo_to_Fc' 20 2 'Structure model' '_refine.correlation_coeff_Fo_to_Fc_free' 21 2 'Structure model' '_refine.ls_R_factor_R_free' 22 2 'Structure model' '_refine.ls_R_factor_R_work' 23 2 'Structure model' '_refine.ls_R_factor_obs' 24 2 'Structure model' '_refine.overall_SU_B' 25 2 'Structure model' '_refine.overall_SU_ML' 26 2 'Structure model' '_refine.pdbx_overall_ESU_R' 27 2 'Structure model' '_refine.pdbx_overall_ESU_R_Free' 28 2 'Structure model' '_refine_hist.number_atoms_solvent' 29 2 'Structure model' '_refine_hist.number_atoms_total' 30 2 'Structure model' '_refine_hist.pdbx_B_iso_mean_solvent' 31 2 'Structure model' '_refine_hist.pdbx_number_atoms_protein' 32 2 'Structure model' '_refine_ls_restr.dev_ideal' 33 2 'Structure model' '_refine_ls_restr.dev_ideal_target' 34 2 'Structure model' '_refine_ls_restr.number' 35 2 'Structure model' '_refine_ls_shell.R_factor_R_free' 36 2 'Structure model' '_refine_ls_shell.R_factor_R_work' 37 2 'Structure model' '_software.version' 38 2 'Structure model' '_struct_mon_prot_cis.pdbx_omega_angle' 39 2 'Structure model' '_struct_sheet_range.beg_auth_comp_id' 40 2 'Structure model' '_struct_sheet_range.beg_auth_seq_id' 41 2 'Structure model' '_struct_sheet_range.beg_label_comp_id' 42 2 'Structure model' '_struct_sheet_range.beg_label_seq_id' # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0258 1 ? 'data reduction' ? ? 'Zbyszek Otwinowski' hkl@hkl-xray.com ? ? ? ? ? http://www.hkl-xray.com/ ? HKL-2000 ? ? package . 2 ? 'data scaling' ? ? 'Zbyszek Otwinowski' hkl@hkl-xray.com ? ? ? ? ? http://www.hkl-xray.com/ ? HKL-2000 ? ? package . 3 ? phasing ? ? 'Randy J. Read' cimr-phaser@lists.cam.ac.uk ? ? ? ? ? http://www-structmed.cimr.cam.ac.uk/phaser/ ? PHASER ? ? program . 4 ? 'data extraction' ? ? PDB deposit@deposit.rcsb.org 'Apr. 1, 2019' ? ? ? C++ http://sw-tools.pdb.org/apps/PDB_EXTRACT/ ? PDB_EXTRACT ? ? package 3.25 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 16 ? ? -120.55 -148.39 2 1 LEU A 19 ? ? 32.51 -63.98 3 1 ALA A 23 ? ? 78.09 -125.68 4 1 PHE A 24 ? ? -96.38 39.77 5 1 LYS A 47 ? ? 76.42 -19.26 6 1 ARG A 65 ? ? -70.14 28.43 7 1 GLU A 82 ? ? -65.23 94.97 8 1 ASP A 90 ? ? -35.12 128.40 9 1 GLU A 105 ? ? 55.60 -69.22 10 1 ASN A 135 ? ? -154.26 38.66 11 1 LYS A 137 ? ? 178.93 151.76 12 1 ALA A 150 ? ? -39.09 136.43 13 1 ASP A 156 ? ? 55.42 91.02 14 1 LYS A 187 ? ? 29.29 43.46 15 1 TRP A 214 ? ? -175.12 134.86 16 1 PHE A 232 ? ? -117.09 74.67 17 1 PRO A 233 ? ? -45.40 156.06 18 1 SER A 272 ? ? -69.83 -71.10 19 1 HIS A 273 ? ? -55.22 88.97 20 1 ASN B 1296 ? ? 112.42 165.40 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 32 ? CD ? A LYS 26 CD 2 1 Y 1 A LYS 32 ? CE ? A LYS 26 CE 3 1 Y 1 A LYS 32 ? NZ ? A LYS 26 NZ 4 1 Y 1 A LYS 47 ? CG ? A LYS 41 CG 5 1 Y 1 A LYS 47 ? CD ? A LYS 41 CD 6 1 Y 1 A LYS 47 ? CE ? A LYS 41 CE 7 1 Y 1 A LYS 47 ? NZ ? A LYS 41 NZ 8 1 Y 1 A LYS 48 ? CG ? A LYS 42 CG 9 1 Y 1 A LYS 48 ? CD ? A LYS 42 CD 10 1 Y 1 A LYS 48 ? CE ? A LYS 42 CE 11 1 Y 1 A LYS 48 ? NZ ? A LYS 42 NZ 12 1 Y 1 A GLN 55 ? CG ? A GLN 49 CG 13 1 Y 1 A GLN 55 ? CD ? A GLN 49 CD 14 1 Y 1 A GLN 55 ? OE1 ? A GLN 49 OE1 15 1 Y 1 A GLN 55 ? NE2 ? A GLN 49 NE2 16 1 Y 1 A LYS 56 ? CG ? A LYS 50 CG 17 1 Y 1 A LYS 56 ? CD ? A LYS 50 CD 18 1 Y 1 A LYS 56 ? CE ? A LYS 50 CE 19 1 Y 1 A LYS 56 ? NZ ? A LYS 50 NZ 20 1 Y 1 A LYS 68 ? CG ? A LYS 62 CG 21 1 Y 1 A LYS 68 ? CD ? A LYS 62 CD 22 1 Y 1 A LYS 68 ? CE ? A LYS 62 CE 23 1 Y 1 A LYS 68 ? NZ ? A LYS 62 NZ 24 1 Y 1 A ARG 74 ? CD ? A ARG 68 CD 25 1 Y 1 A ARG 74 ? NE ? A ARG 68 NE 26 1 Y 1 A ARG 74 ? CZ ? A ARG 68 CZ 27 1 Y 1 A ARG 74 ? NH1 ? A ARG 68 NH1 28 1 Y 1 A ARG 74 ? NH2 ? A ARG 68 NH2 29 1 Y 1 A GLU 82 ? CG ? A GLU 76 CG 30 1 Y 1 A GLU 82 ? CD ? A GLU 76 CD 31 1 Y 1 A GLU 82 ? OE1 ? A GLU 76 OE1 32 1 Y 1 A GLU 82 ? OE2 ? A GLU 76 OE2 33 1 Y 1 A LYS 148 ? CG ? A LYS 142 CG 34 1 Y 1 A LYS 148 ? CD ? A LYS 142 CD 35 1 Y 1 A LYS 148 ? CE ? A LYS 142 CE 36 1 Y 1 A LYS 148 ? NZ ? A LYS 142 NZ 37 1 Y 1 A GLN 167 ? CG ? A GLN 161 CG 38 1 Y 1 A GLN 167 ? CD ? A GLN 161 CD 39 1 Y 1 A GLN 167 ? OE1 ? A GLN 161 OE1 40 1 Y 1 A GLN 167 ? NE2 ? A GLN 161 NE2 41 1 Y 1 A GLU 216 ? CG ? A GLU 210 CG 42 1 Y 1 A GLU 216 ? CD ? A GLU 210 CD 43 1 Y 1 A GLU 216 ? OE1 ? A GLU 210 OE1 44 1 Y 1 A GLU 216 ? OE2 ? A GLU 210 OE2 45 1 Y 1 A LYS 223 ? CD ? A LYS 217 CD 46 1 Y 1 A LYS 223 ? CE ? A LYS 217 CE 47 1 Y 1 A LYS 223 ? NZ ? A LYS 217 NZ 48 1 Y 1 A LYS 258 ? CG ? A LYS 252 CG 49 1 Y 1 A LYS 258 ? CD ? A LYS 252 CD 50 1 Y 1 A LYS 258 ? CE ? A LYS 252 CE 51 1 Y 1 A LYS 258 ? NZ ? A LYS 252 NZ 52 1 Y 1 A LYS 267 ? CG ? A LYS 261 CG 53 1 Y 1 A LYS 267 ? CD ? A LYS 261 CD 54 1 Y 1 A LYS 267 ? CE ? A LYS 261 CE 55 1 Y 1 A LYS 267 ? NZ ? A LYS 261 NZ 56 1 Y 1 B LYS 1297 ? CG ? B LYS 9 CG 57 1 Y 1 B LYS 1297 ? CD ? B LYS 9 CD 58 1 Y 1 B LYS 1297 ? CE ? B LYS 9 CE 59 1 Y 1 B LYS 1297 ? NZ ? B LYS 9 NZ 60 1 Y 1 B ARG 1299 ? CZ ? B ARG 11 CZ 61 1 Y 1 B ARG 1299 ? NH1 ? B ARG 11 NH1 62 1 Y 1 B ARG 1299 ? NH2 ? B ARG 11 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 B LYS 1289 ? B LYS 1 2 1 Y 1 B ALA 1290 ? B ALA 2 3 1 Y 1 B GLN 1291 ? B GLN 3 4 1 Y 1 B LYS 1292 ? B LYS 4 5 1 Y 1 B LYS 1293 ? B LYS 5 6 1 Y 1 B ASN 1294 ? B ASN 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6VZK _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #