data_7KPL # _entry.id 7KPL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7KPL pdb_00007kpl 10.2210/pdb7kpl/pdb WWPDB D_1000252907 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-03-10 2 'Structure model' 1 1 2022-03-23 3 'Structure model' 1 2 2023-10-18 4 'Structure model' 1 3 2023-11-15 5 'Structure model' 1 4 2024-10-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Refinement description' 5 4 'Structure model' 'Data collection' 6 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_audit_support 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' pdbx_initial_refinement_model 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond 8 5 'Structure model' pdbx_entry_details 9 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_chem_comp_atom.atom_id' 4 4 'Structure model' '_chem_comp_bond.atom_id_2' 5 5 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7KPL _pdbx_database_status.recvd_initial_deposition_date 2020-11-11 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Ahmed, M.' 1 ? 'Wang, P.' 2 ? 'Sadek, H.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 118 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Identification of tetracycline combinations as EphB1 tyrosine kinase inhibitors for treatment of neuropathic pain.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.2016265118 _citation.pdbx_database_id_PubMed 33627480 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ahmed, M.S.' 1 0000-0002-5600-4698 primary 'Wang, P.' 2 0000-0002-2710-7188 primary 'Nguyen, N.U.N.' 3 ? primary 'Nakada, Y.' 4 ? primary 'Menendez-Montes, I.' 5 ? primary 'Ismail, M.' 6 0000-0003-2562-4357 primary 'Bachoo, R.' 7 ? primary 'Henkemeyer, M.' 8 ? primary 'Sadek, H.A.' 9 ? primary 'Kandil, E.S.' 10 0000-0002-9649-9226 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Ephrin type-B receptor 1' 31823.459 1 2.7.10.1 ? ? ? 2 water nat water 18.015 36 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;ELK,EPH tyrosine kinase 2,EPH-like kinase 6,hEK6,Neuronally-expressed EPH-related tyrosine kinase,NET,Tyrosine-protein kinase receptor EPH-2 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;AKEIDVSFVKIEEVIGAGEFGEVYKGRLKLPGKREI(PTR)VAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGV VTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLS RYLQDDTSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPP MDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLK ; _entity_poly.pdbx_seq_one_letter_code_can ;AKEIDVSFVKIEEVIGAGEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKS RPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQ DDTSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPMDCP AALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 LYS n 1 3 GLU n 1 4 ILE n 1 5 ASP n 1 6 VAL n 1 7 SER n 1 8 PHE n 1 9 VAL n 1 10 LYS n 1 11 ILE n 1 12 GLU n 1 13 GLU n 1 14 VAL n 1 15 ILE n 1 16 GLY n 1 17 ALA n 1 18 GLY n 1 19 GLU n 1 20 PHE n 1 21 GLY n 1 22 GLU n 1 23 VAL n 1 24 TYR n 1 25 LYS n 1 26 GLY n 1 27 ARG n 1 28 LEU n 1 29 LYS n 1 30 LEU n 1 31 PRO n 1 32 GLY n 1 33 LYS n 1 34 ARG n 1 35 GLU n 1 36 ILE n 1 37 PTR n 1 38 VAL n 1 39 ALA n 1 40 ILE n 1 41 LYS n 1 42 THR n 1 43 LEU n 1 44 LYS n 1 45 ALA n 1 46 GLY n 1 47 TYR n 1 48 SER n 1 49 GLU n 1 50 LYS n 1 51 GLN n 1 52 ARG n 1 53 ARG n 1 54 ASP n 1 55 PHE n 1 56 LEU n 1 57 SER n 1 58 GLU n 1 59 ALA n 1 60 SER n 1 61 ILE n 1 62 MET n 1 63 GLY n 1 64 GLN n 1 65 PHE n 1 66 ASP n 1 67 HIS n 1 68 PRO n 1 69 ASN n 1 70 ILE n 1 71 ILE n 1 72 ARG n 1 73 LEU n 1 74 GLU n 1 75 GLY n 1 76 VAL n 1 77 VAL n 1 78 THR n 1 79 LYS n 1 80 SER n 1 81 ARG n 1 82 PRO n 1 83 VAL n 1 84 MET n 1 85 ILE n 1 86 ILE n 1 87 THR n 1 88 GLU n 1 89 PHE n 1 90 MET n 1 91 GLU n 1 92 ASN n 1 93 GLY n 1 94 ALA n 1 95 LEU n 1 96 ASP n 1 97 SER n 1 98 PHE n 1 99 LEU n 1 100 ARG n 1 101 GLN n 1 102 ASN n 1 103 ASP n 1 104 GLY n 1 105 GLN n 1 106 PHE n 1 107 THR n 1 108 VAL n 1 109 ILE n 1 110 GLN n 1 111 LEU n 1 112 VAL n 1 113 GLY n 1 114 MET n 1 115 LEU n 1 116 ARG n 1 117 GLY n 1 118 ILE n 1 119 ALA n 1 120 ALA n 1 121 GLY n 1 122 MET n 1 123 LYS n 1 124 TYR n 1 125 LEU n 1 126 ALA n 1 127 GLU n 1 128 MET n 1 129 ASN n 1 130 TYR n 1 131 VAL n 1 132 HIS n 1 133 ARG n 1 134 ASP n 1 135 LEU n 1 136 ALA n 1 137 ALA n 1 138 ARG n 1 139 ASN n 1 140 ILE n 1 141 LEU n 1 142 VAL n 1 143 ASN n 1 144 SER n 1 145 ASN n 1 146 LEU n 1 147 VAL n 1 148 CYS n 1 149 LYS n 1 150 VAL n 1 151 SER n 1 152 ASP n 1 153 PHE n 1 154 GLY n 1 155 LEU n 1 156 SER n 1 157 ARG n 1 158 TYR n 1 159 LEU n 1 160 GLN n 1 161 ASP n 1 162 ASP n 1 163 THR n 1 164 SER n 1 165 ASP n 1 166 PRO n 1 167 THR n 1 168 TYR n 1 169 THR n 1 170 SER n 1 171 SER n 1 172 LEU n 1 173 GLY n 1 174 GLY n 1 175 LYS n 1 176 ILE n 1 177 PRO n 1 178 VAL n 1 179 ARG n 1 180 TRP n 1 181 THR n 1 182 ALA n 1 183 PRO n 1 184 GLU n 1 185 ALA n 1 186 ILE n 1 187 ALA n 1 188 TYR n 1 189 ARG n 1 190 LYS n 1 191 PHE n 1 192 THR n 1 193 SER n 1 194 ALA n 1 195 SER n 1 196 ASP n 1 197 VAL n 1 198 TRP n 1 199 SER n 1 200 TYR n 1 201 GLY n 1 202 ILE n 1 203 VAL n 1 204 MET n 1 205 TRP n 1 206 GLU n 1 207 VAL n 1 208 MET n 1 209 SER n 1 210 PHE n 1 211 GLY n 1 212 GLU n 1 213 ARG n 1 214 PRO n 1 215 TYR n 1 216 TRP n 1 217 ASP n 1 218 MET n 1 219 SER n 1 220 ASN n 1 221 GLN n 1 222 ASP n 1 223 VAL n 1 224 ILE n 1 225 ASN n 1 226 ALA n 1 227 ILE n 1 228 GLU n 1 229 GLN n 1 230 ASP n 1 231 TYR n 1 232 ARG n 1 233 LEU n 1 234 PRO n 1 235 PRO n 1 236 PRO n 1 237 MET n 1 238 ASP n 1 239 CYS n 1 240 PRO n 1 241 ALA n 1 242 ALA n 1 243 LEU n 1 244 HIS n 1 245 GLN n 1 246 LEU n 1 247 MET n 1 248 LEU n 1 249 ASP n 1 250 CYS n 1 251 TRP n 1 252 GLN n 1 253 LYS n 1 254 ASP n 1 255 ARG n 1 256 ASN n 1 257 SER n 1 258 ARG n 1 259 PRO n 1 260 ARG n 1 261 PHE n 1 262 ALA n 1 263 GLU n 1 264 ILE n 1 265 VAL n 1 266 ASN n 1 267 THR n 1 268 LEU n 1 269 ASP n 1 270 LYS n 1 271 MET n 1 272 ILE n 1 273 ARG n 1 274 ASN n 1 275 PRO n 1 276 ALA n 1 277 SER n 1 278 LEU n 1 279 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 279 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'EPHB1, ELK, EPHT2, HEK6, NET' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 PTR 'L-peptide linking' n O-PHOSPHOTYROSINE PHOSPHONOTYROSINE 'C9 H12 N O6 P' 261.168 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 611 611 ALA ALA A . n A 1 2 LYS 2 612 612 LYS LYS A . n A 1 3 GLU 3 613 613 GLU GLU A . n A 1 4 ILE 4 614 614 ILE ILE A . n A 1 5 ASP 5 615 615 ASP ASP A . n A 1 6 VAL 6 616 616 VAL VAL A . n A 1 7 SER 7 617 617 SER SER A . n A 1 8 PHE 8 618 618 PHE PHE A . n A 1 9 VAL 9 619 619 VAL VAL A . n A 1 10 LYS 10 620 620 LYS LYS A . n A 1 11 ILE 11 621 621 ILE ILE A . n A 1 12 GLU 12 622 622 GLU GLU A . n A 1 13 GLU 13 623 623 GLU GLU A . n A 1 14 VAL 14 624 624 VAL VAL A . n A 1 15 ILE 15 625 625 ILE ILE A . n A 1 16 GLY 16 626 626 GLY GLY A . n A 1 17 ALA 17 627 627 ALA ALA A . n A 1 18 GLY 18 628 628 GLY GLY A . n A 1 19 GLU 19 629 629 GLU GLU A . n A 1 20 PHE 20 630 630 PHE PHE A . n A 1 21 GLY 21 631 631 GLY GLY A . n A 1 22 GLU 22 632 632 GLU GLU A . n A 1 23 VAL 23 633 633 VAL VAL A . n A 1 24 TYR 24 634 634 TYR TYR A . n A 1 25 LYS 25 635 635 LYS LYS A . n A 1 26 GLY 26 636 636 GLY GLY A . n A 1 27 ARG 27 637 637 ARG ARG A . n A 1 28 LEU 28 638 638 LEU LEU A . n A 1 29 LYS 29 639 639 LYS LYS A . n A 1 30 LEU 30 640 640 LEU LEU A . n A 1 31 PRO 31 641 641 PRO PRO A . n A 1 32 GLY 32 642 642 GLY GLY A . n A 1 33 LYS 33 643 643 LYS LYS A . n A 1 34 ARG 34 644 644 ARG ARG A . n A 1 35 GLU 35 645 645 GLU GLU A . n A 1 36 ILE 36 646 646 ILE ILE A . n A 1 37 PTR 37 647 647 PTR PTR A . n A 1 38 VAL 38 648 648 VAL VAL A . n A 1 39 ALA 39 649 649 ALA ALA A . n A 1 40 ILE 40 650 650 ILE ILE A . n A 1 41 LYS 41 651 651 LYS LYS A . n A 1 42 THR 42 652 652 THR THR A . n A 1 43 LEU 43 653 653 LEU LEU A . n A 1 44 LYS 44 654 654 LYS LYS A . n A 1 45 ALA 45 655 655 ALA ALA A . n A 1 46 GLY 46 656 656 GLY GLY A . n A 1 47 TYR 47 657 657 TYR TYR A . n A 1 48 SER 48 658 658 SER SER A . n A 1 49 GLU 49 659 659 GLU GLU A . n A 1 50 LYS 50 660 660 LYS LYS A . n A 1 51 GLN 51 661 661 GLN GLN A . n A 1 52 ARG 52 662 662 ARG ARG A . n A 1 53 ARG 53 663 663 ARG ARG A . n A 1 54 ASP 54 664 664 ASP ASP A . n A 1 55 PHE 55 665 665 PHE PHE A . n A 1 56 LEU 56 666 666 LEU LEU A . n A 1 57 SER 57 667 667 SER SER A . n A 1 58 GLU 58 668 668 GLU GLU A . n A 1 59 ALA 59 669 669 ALA ALA A . n A 1 60 SER 60 670 670 SER SER A . n A 1 61 ILE 61 671 671 ILE ILE A . n A 1 62 MET 62 672 672 MET MET A . n A 1 63 GLY 63 673 673 GLY GLY A . n A 1 64 GLN 64 674 674 GLN GLN A . n A 1 65 PHE 65 675 675 PHE PHE A . n A 1 66 ASP 66 676 676 ASP ASP A . n A 1 67 HIS 67 677 677 HIS HIS A . n A 1 68 PRO 68 678 678 PRO PRO A . n A 1 69 ASN 69 679 679 ASN ASN A . n A 1 70 ILE 70 680 680 ILE ILE A . n A 1 71 ILE 71 681 681 ILE ILE A . n A 1 72 ARG 72 682 682 ARG ARG A . n A 1 73 LEU 73 683 683 LEU LEU A . n A 1 74 GLU 74 684 684 GLU GLU A . n A 1 75 GLY 75 685 685 GLY GLY A . n A 1 76 VAL 76 686 686 VAL VAL A . n A 1 77 VAL 77 687 687 VAL VAL A . n A 1 78 THR 78 688 688 THR THR A . n A 1 79 LYS 79 689 689 LYS LYS A . n A 1 80 SER 80 690 690 SER SER A . n A 1 81 ARG 81 691 691 ARG ARG A . n A 1 82 PRO 82 692 692 PRO PRO A . n A 1 83 VAL 83 693 693 VAL VAL A . n A 1 84 MET 84 694 694 MET MET A . n A 1 85 ILE 85 695 695 ILE ILE A . n A 1 86 ILE 86 696 696 ILE ILE A . n A 1 87 THR 87 697 697 THR THR A . n A 1 88 GLU 88 698 698 GLU GLU A . n A 1 89 PHE 89 699 699 PHE PHE A . n A 1 90 MET 90 700 700 MET MET A . n A 1 91 GLU 91 701 701 GLU GLU A . n A 1 92 ASN 92 702 702 ASN ASN A . n A 1 93 GLY 93 703 703 GLY GLY A . n A 1 94 ALA 94 704 704 ALA ALA A . n A 1 95 LEU 95 705 705 LEU LEU A . n A 1 96 ASP 96 706 706 ASP ASP A . n A 1 97 SER 97 707 707 SER SER A . n A 1 98 PHE 98 708 708 PHE PHE A . n A 1 99 LEU 99 709 709 LEU LEU A . n A 1 100 ARG 100 710 710 ARG ARG A . n A 1 101 GLN 101 711 711 GLN GLN A . n A 1 102 ASN 102 712 712 ASN ASN A . n A 1 103 ASP 103 713 713 ASP ASP A . n A 1 104 GLY 104 714 714 GLY GLY A . n A 1 105 GLN 105 715 715 GLN GLN A . n A 1 106 PHE 106 716 716 PHE PHE A . n A 1 107 THR 107 717 717 THR THR A . n A 1 108 VAL 108 718 718 VAL VAL A . n A 1 109 ILE 109 719 719 ILE ILE A . n A 1 110 GLN 110 720 720 GLN GLN A . n A 1 111 LEU 111 721 721 LEU LEU A . n A 1 112 VAL 112 722 722 VAL VAL A . n A 1 113 GLY 113 723 723 GLY GLY A . n A 1 114 MET 114 724 724 MET MET A . n A 1 115 LEU 115 725 725 LEU LEU A . n A 1 116 ARG 116 726 726 ARG ARG A . n A 1 117 GLY 117 727 727 GLY GLY A . n A 1 118 ILE 118 728 728 ILE ILE A . n A 1 119 ALA 119 729 729 ALA ALA A . n A 1 120 ALA 120 730 730 ALA ALA A . n A 1 121 GLY 121 731 731 GLY GLY A . n A 1 122 MET 122 732 732 MET MET A . n A 1 123 LYS 123 733 733 LYS LYS A . n A 1 124 TYR 124 734 734 TYR TYR A . n A 1 125 LEU 125 735 735 LEU LEU A . n A 1 126 ALA 126 736 736 ALA ALA A . n A 1 127 GLU 127 737 737 GLU GLU A . n A 1 128 MET 128 738 738 MET MET A . n A 1 129 ASN 129 739 739 ASN ASN A . n A 1 130 TYR 130 740 740 TYR TYR A . n A 1 131 VAL 131 741 741 VAL VAL A . n A 1 132 HIS 132 742 742 HIS HIS A . n A 1 133 ARG 133 743 743 ARG ARG A . n A 1 134 ASP 134 744 744 ASP ASP A . n A 1 135 LEU 135 745 745 LEU LEU A . n A 1 136 ALA 136 746 746 ALA ALA A . n A 1 137 ALA 137 747 747 ALA ALA A . n A 1 138 ARG 138 748 748 ARG ARG A . n A 1 139 ASN 139 749 749 ASN ASN A . n A 1 140 ILE 140 750 750 ILE ILE A . n A 1 141 LEU 141 751 751 LEU LEU A . n A 1 142 VAL 142 752 752 VAL VAL A . n A 1 143 ASN 143 753 753 ASN ASN A . n A 1 144 SER 144 754 754 SER SER A . n A 1 145 ASN 145 755 755 ASN ASN A . n A 1 146 LEU 146 756 756 LEU LEU A . n A 1 147 VAL 147 757 757 VAL VAL A . n A 1 148 CYS 148 758 758 CYS CYS A . n A 1 149 LYS 149 759 759 LYS LYS A . n A 1 150 VAL 150 760 760 VAL VAL A . n A 1 151 SER 151 761 761 SER SER A . n A 1 152 ASP 152 762 762 ASP ASP A . n A 1 153 PHE 153 763 763 PHE PHE A . n A 1 154 GLY 154 764 ? ? ? A . n A 1 155 LEU 155 765 ? ? ? A . n A 1 156 SER 156 766 ? ? ? A . n A 1 157 ARG 157 767 ? ? ? A . n A 1 158 TYR 158 768 ? ? ? A . n A 1 159 LEU 159 769 ? ? ? A . n A 1 160 GLN 160 770 ? ? ? A . n A 1 161 ASP 161 771 ? ? ? A . n A 1 162 ASP 162 772 ? ? ? A . n A 1 163 THR 163 773 ? ? ? A . n A 1 164 SER 164 774 ? ? ? A . n A 1 165 ASP 165 775 ? ? ? A . n A 1 166 PRO 166 776 ? ? ? A . n A 1 167 THR 167 777 ? ? ? A . n A 1 168 TYR 168 778 ? ? ? A . n A 1 169 THR 169 779 ? ? ? A . n A 1 170 SER 170 780 ? ? ? A . n A 1 171 SER 171 781 ? ? ? A . n A 1 172 LEU 172 782 ? ? ? A . n A 1 173 GLY 173 783 ? ? ? A . n A 1 174 GLY 174 784 ? ? ? A . n A 1 175 LYS 175 785 ? ? ? A . n A 1 176 ILE 176 786 786 ILE ILE A . n A 1 177 PRO 177 787 787 PRO PRO A . n A 1 178 VAL 178 788 788 VAL VAL A . n A 1 179 ARG 179 789 789 ARG ARG A . n A 1 180 TRP 180 790 790 TRP TRP A . n A 1 181 THR 181 791 791 THR THR A . n A 1 182 ALA 182 792 792 ALA ALA A . n A 1 183 PRO 183 793 793 PRO PRO A . n A 1 184 GLU 184 794 794 GLU GLU A . n A 1 185 ALA 185 795 795 ALA ALA A . n A 1 186 ILE 186 796 796 ILE ILE A . n A 1 187 ALA 187 797 797 ALA ALA A . n A 1 188 TYR 188 798 798 TYR TYR A . n A 1 189 ARG 189 799 799 ARG ARG A . n A 1 190 LYS 190 800 800 LYS LYS A . n A 1 191 PHE 191 801 801 PHE PHE A . n A 1 192 THR 192 802 802 THR THR A . n A 1 193 SER 193 803 803 SER SER A . n A 1 194 ALA 194 804 804 ALA ALA A . n A 1 195 SER 195 805 805 SER SER A . n A 1 196 ASP 196 806 806 ASP ASP A . n A 1 197 VAL 197 807 807 VAL VAL A . n A 1 198 TRP 198 808 808 TRP TRP A . n A 1 199 SER 199 809 809 SER SER A . n A 1 200 TYR 200 810 810 TYR TYR A . n A 1 201 GLY 201 811 811 GLY GLY A . n A 1 202 ILE 202 812 812 ILE ILE A . n A 1 203 VAL 203 813 813 VAL VAL A . n A 1 204 MET 204 814 814 MET MET A . n A 1 205 TRP 205 815 815 TRP TRP A . n A 1 206 GLU 206 816 816 GLU GLU A . n A 1 207 VAL 207 817 817 VAL VAL A . n A 1 208 MET 208 818 818 MET MET A . n A 1 209 SER 209 819 819 SER SER A . n A 1 210 PHE 210 820 820 PHE PHE A . n A 1 211 GLY 211 821 821 GLY GLY A . n A 1 212 GLU 212 822 822 GLU GLU A . n A 1 213 ARG 213 823 823 ARG ARG A . n A 1 214 PRO 214 824 824 PRO PRO A . n A 1 215 TYR 215 825 825 TYR TYR A . n A 1 216 TRP 216 826 826 TRP TRP A . n A 1 217 ASP 217 827 827 ASP ASP A . n A 1 218 MET 218 828 828 MET MET A . n A 1 219 SER 219 829 829 SER SER A . n A 1 220 ASN 220 830 830 ASN ASN A . n A 1 221 GLN 221 831 831 GLN GLN A . n A 1 222 ASP 222 832 832 ASP ASP A . n A 1 223 VAL 223 833 833 VAL VAL A . n A 1 224 ILE 224 834 834 ILE ILE A . n A 1 225 ASN 225 835 835 ASN ASN A . n A 1 226 ALA 226 836 836 ALA ALA A . n A 1 227 ILE 227 837 837 ILE ILE A . n A 1 228 GLU 228 838 838 GLU GLU A . n A 1 229 GLN 229 839 839 GLN GLN A . n A 1 230 ASP 230 840 840 ASP ASP A . n A 1 231 TYR 231 841 841 TYR TYR A . n A 1 232 ARG 232 842 842 ARG ARG A . n A 1 233 LEU 233 843 843 LEU LEU A . n A 1 234 PRO 234 844 844 PRO PRO A . n A 1 235 PRO 235 845 845 PRO PRO A . n A 1 236 PRO 236 846 846 PRO PRO A . n A 1 237 MET 237 847 847 MET MET A . n A 1 238 ASP 238 848 848 ASP ASP A . n A 1 239 CYS 239 849 849 CYS CYS A . n A 1 240 PRO 240 850 850 PRO PRO A . n A 1 241 ALA 241 851 851 ALA ALA A . n A 1 242 ALA 242 852 852 ALA ALA A . n A 1 243 LEU 243 853 853 LEU LEU A . n A 1 244 HIS 244 854 854 HIS HIS A . n A 1 245 GLN 245 855 855 GLN GLN A . n A 1 246 LEU 246 856 856 LEU LEU A . n A 1 247 MET 247 857 857 MET MET A . n A 1 248 LEU 248 858 858 LEU LEU A . n A 1 249 ASP 249 859 859 ASP ASP A . n A 1 250 CYS 250 860 860 CYS CYS A . n A 1 251 TRP 251 861 861 TRP TRP A . n A 1 252 GLN 252 862 862 GLN GLN A . n A 1 253 LYS 253 863 863 LYS LYS A . n A 1 254 ASP 254 864 864 ASP ASP A . n A 1 255 ARG 255 865 865 ARG ARG A . n A 1 256 ASN 256 866 866 ASN ASN A . n A 1 257 SER 257 867 867 SER SER A . n A 1 258 ARG 258 868 868 ARG ARG A . n A 1 259 PRO 259 869 869 PRO PRO A . n A 1 260 ARG 260 870 870 ARG ARG A . n A 1 261 PHE 261 871 871 PHE PHE A . n A 1 262 ALA 262 872 872 ALA ALA A . n A 1 263 GLU 263 873 873 GLU GLU A . n A 1 264 ILE 264 874 874 ILE ILE A . n A 1 265 VAL 265 875 875 VAL VAL A . n A 1 266 ASN 266 876 876 ASN ASN A . n A 1 267 THR 267 877 877 THR THR A . n A 1 268 LEU 268 878 878 LEU LEU A . n A 1 269 ASP 269 879 879 ASP ASP A . n A 1 270 LYS 270 880 880 LYS LYS A . n A 1 271 MET 271 881 881 MET MET A . n A 1 272 ILE 272 882 882 ILE ILE A . n A 1 273 ARG 273 883 883 ARG ARG A . n A 1 274 ASN 274 884 884 ASN ASN A . n A 1 275 PRO 275 885 885 PRO PRO A . n A 1 276 ALA 276 886 886 ALA ALA A . n A 1 277 SER 277 887 887 SER SER A . n A 1 278 LEU 278 888 888 LEU LEU A . n A 1 279 LYS 279 889 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id PTR _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id PTR _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 901 35 HOH HOH A . B 2 HOH 2 902 19 HOH HOH A . B 2 HOH 3 903 15 HOH HOH A . B 2 HOH 4 904 22 HOH HOH A . B 2 HOH 5 905 13 HOH HOH A . B 2 HOH 6 906 29 HOH HOH A . B 2 HOH 7 907 30 HOH HOH A . B 2 HOH 8 908 20 HOH HOH A . B 2 HOH 9 909 28 HOH HOH A . B 2 HOH 10 910 12 HOH HOH A . B 2 HOH 11 911 4 HOH HOH A . B 2 HOH 12 912 6 HOH HOH A . B 2 HOH 13 913 14 HOH HOH A . B 2 HOH 14 914 7 HOH HOH A . B 2 HOH 15 915 8 HOH HOH A . B 2 HOH 16 916 10 HOH HOH A . B 2 HOH 17 917 11 HOH HOH A . B 2 HOH 18 918 5 HOH HOH A . B 2 HOH 19 919 2 HOH HOH A . B 2 HOH 20 920 23 HOH HOH A . B 2 HOH 21 921 31 HOH HOH A . B 2 HOH 22 922 24 HOH HOH A . B 2 HOH 23 923 36 HOH HOH A . B 2 HOH 24 924 26 HOH HOH A . B 2 HOH 25 925 16 HOH HOH A . B 2 HOH 26 926 27 HOH HOH A . B 2 HOH 27 927 3 HOH HOH A . B 2 HOH 28 928 1 HOH HOH A . B 2 HOH 29 929 33 HOH HOH A . B 2 HOH 30 930 25 HOH HOH A . B 2 HOH 31 931 18 HOH HOH A . B 2 HOH 32 932 32 HOH HOH A . B 2 HOH 33 933 17 HOH HOH A . B 2 HOH 34 934 37 HOH HOH A . B 2 HOH 35 935 34 HOH HOH A . B 2 HOH 36 936 40 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.15.2_3472 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7KPL _cell.details ? _cell.formula_units_Z ? _cell.length_a 33.057 _cell.length_a_esd ? _cell.length_b 91.461 _cell.length_b_esd ? _cell.length_c 97.436 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7KPL _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7KPL _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.50 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 50.77 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M sodium malonate, pH 4.6, 14% PEG3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-11-02 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'double crystal Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97918 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 19-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97918 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 19-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7KPL _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.7 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8602 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.1 _reflns.pdbx_Rmerge_I_obs 0.36 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.69 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.7 _reflns_shell.d_res_low 2.8 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 833 _reflns_shell.percent_possible_all 99.8 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.16 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 102.240 _refine.B_iso_mean 35.8030 _refine.B_iso_min 14.750 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7KPL _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.7050 _refine.ls_d_res_low 48.7180 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8401 _refine.ls_number_reflns_R_free 403 _refine.ls_number_reflns_R_work 7998 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.8000 _refine.ls_percent_reflns_R_free 4.8000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2020 _refine.ls_R_factor_R_free 0.2496 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1997 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'PDB entry 3zfx' _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 23.2400 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3100 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.7050 _refine_hist.d_res_low 48.7180 _refine_hist.number_atoms_solvent 36 _refine_hist.number_atoms_total 2092 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 256 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent 36.78 _refine_hist.pdbx_number_atoms_protein 2056 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.705 3.0961 . . 112 2536 95.0000 . . . 0.2527 0.0000 0.2252 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0961 3.9006 . . 162 2644 99.0000 . . . 0.2584 0.0000 0.2021 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.9006 48.7 . . 129 2818 99.0000 . . . 0.2412 0.0000 0.1894 . . . . . . . . . . . # _struct.entry_id 7KPL _struct.title 'Crystal structure of hEphB1 in apo form' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7KPL _struct_keywords.text 'HEPHB1, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code EPHB1_HUMAN _struct_ref.pdbx_db_accession P54762 _struct_ref.pdbx_db_isoform P54762-5 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AKEIDVSFVKIEEVIGAGEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKS RPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQ DDTSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPMDCP AALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLK ; _struct_ref.pdbx_align_begin 172 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7KPL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 279 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P54762 _struct_ref_seq.db_align_beg 172 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 450 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 611 _struct_ref_seq.pdbx_auth_seq_align_end 889 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 12830 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 5 ? SER A 7 ? ASP A 615 SER A 617 5 ? 3 HELX_P HELX_P2 AA2 SER A 48 ? GLY A 63 ? SER A 658 GLY A 673 1 ? 16 HELX_P HELX_P3 AA3 ALA A 94 ? GLN A 101 ? ALA A 704 GLN A 711 1 ? 8 HELX_P HELX_P4 AA4 THR A 107 ? MET A 128 ? THR A 717 MET A 738 1 ? 22 HELX_P HELX_P5 AA5 ALA A 136 ? ARG A 138 ? ALA A 746 ARG A 748 5 ? 3 HELX_P HELX_P6 AA6 PRO A 177 ? THR A 181 ? PRO A 787 THR A 791 5 ? 5 HELX_P HELX_P7 AA7 ALA A 182 ? TYR A 188 ? ALA A 792 TYR A 798 1 ? 7 HELX_P HELX_P8 AA8 THR A 192 ? SER A 209 ? THR A 802 SER A 819 1 ? 18 HELX_P HELX_P9 AA9 SER A 219 ? GLN A 229 ? SER A 829 GLN A 839 1 ? 11 HELX_P HELX_P10 AB1 PRO A 240 ? TRP A 251 ? PRO A 850 TRP A 861 1 ? 12 HELX_P HELX_P11 AB2 ASP A 254 ? ARG A 258 ? ASP A 864 ARG A 868 5 ? 5 HELX_P HELX_P12 AB3 ARG A 260 ? ASN A 274 ? ARG A 870 ASN A 884 1 ? 15 HELX_P HELX_P13 AB4 PRO A 275 ? LEU A 278 ? PRO A 885 LEU A 888 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ILE 36 C ? ? ? 1_555 A PTR 37 N ? ? A ILE 646 A PTR 647 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale2 covale both ? A PTR 37 C ? ? ? 1_555 A VAL 38 N ? ? A PTR 647 A VAL 648 1_555 ? ? ? ? ? ? ? 1.323 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id PTR _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 37 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id . _pdbx_modification_feature.modified_residue_label_asym_id . _pdbx_modification_feature.modified_residue_label_seq_id . _pdbx_modification_feature.modified_residue_label_alt_id . _pdbx_modification_feature.auth_comp_id PTR _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 647 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id . _pdbx_modification_feature.modified_residue_auth_asym_id . _pdbx_modification_feature.modified_residue_auth_seq_id . _pdbx_modification_feature.modified_residue_PDB_ins_code . _pdbx_modification_feature.modified_residue_symmetry . _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id TYR _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id PTR _pdbx_modification_feature.type Phosphorylation _pdbx_modification_feature.category 'Named protein modification' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ARG _struct_mon_prot_cis.label_seq_id 81 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ARG _struct_mon_prot_cis.auth_seq_id 691 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 82 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 692 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -0.82 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 9 ? ALA A 17 ? VAL A 619 ALA A 627 AA1 2 GLU A 22 ? LEU A 28 ? GLU A 632 LEU A 638 AA1 3 ILE A 36 ? THR A 42 ? ILE A 646 THR A 652 AA1 4 MET A 84 ? GLU A 88 ? MET A 694 GLU A 698 AA1 5 LEU A 73 ? VAL A 77 ? LEU A 683 VAL A 687 AA2 1 ILE A 140 ? VAL A 142 ? ILE A 750 VAL A 752 AA2 2 CYS A 148 ? VAL A 150 ? CYS A 758 VAL A 760 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 13 ? N GLU A 623 O LYS A 25 ? O LYS A 635 AA1 2 3 N GLU A 22 ? N GLU A 632 O THR A 42 ? O THR A 652 AA1 3 4 N ALA A 39 ? N ALA A 649 O THR A 87 ? O THR A 697 AA1 4 5 O ILE A 86 ? O ILE A 696 N GLY A 75 ? N GLY A 685 AA2 1 2 N LEU A 141 ? N LEU A 751 O LYS A 149 ? O LYS A 759 # _pdbx_entry_details.entry_id 7KPL _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 622 ? ? -102.42 -134.66 2 1 ILE A 625 ? ? -144.99 15.50 3 1 ARG A 743 ? ? 62.20 -0.14 4 1 SER A 761 ? ? -122.50 -147.19 5 1 ASP A 762 ? ? 60.66 72.80 6 1 PRO A 787 ? ? -69.07 87.68 7 1 TRP A 826 ? ? 51.40 -116.94 8 1 ASP A 840 ? ? 70.05 37.79 9 1 ASN A 884 ? ? -110.84 62.32 10 1 SER A 887 ? ? -33.50 -39.95 # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id PTR _pdbx_struct_mod_residue.label_seq_id 37 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id PTR _pdbx_struct_mod_residue.auth_seq_id 647 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id TYR _pdbx_struct_mod_residue.details 'modified residue' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 764 ? A GLY 154 2 1 Y 1 A LEU 765 ? A LEU 155 3 1 Y 1 A SER 766 ? A SER 156 4 1 Y 1 A ARG 767 ? A ARG 157 5 1 Y 1 A TYR 768 ? A TYR 158 6 1 Y 1 A LEU 769 ? A LEU 159 7 1 Y 1 A GLN 770 ? A GLN 160 8 1 Y 1 A ASP 771 ? A ASP 161 9 1 Y 1 A ASP 772 ? A ASP 162 10 1 Y 1 A THR 773 ? A THR 163 11 1 Y 1 A SER 774 ? A SER 164 12 1 Y 1 A ASP 775 ? A ASP 165 13 1 Y 1 A PRO 776 ? A PRO 166 14 1 Y 1 A THR 777 ? A THR 167 15 1 Y 1 A TYR 778 ? A TYR 168 16 1 Y 1 A THR 779 ? A THR 169 17 1 Y 1 A SER 780 ? A SER 170 18 1 Y 1 A SER 781 ? A SER 171 19 1 Y 1 A LEU 782 ? A LEU 172 20 1 Y 1 A GLY 783 ? A GLY 173 21 1 Y 1 A GLY 784 ? A GLY 174 22 1 Y 1 A LYS 785 ? A LYS 175 23 1 Y 1 A LYS 889 ? A LYS 279 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 PTR N N N N 290 PTR CA C N S 291 PTR C C N N 292 PTR O O N N 293 PTR OXT O N N 294 PTR CB C N N 295 PTR CG C Y N 296 PTR CD1 C Y N 297 PTR CD2 C Y N 298 PTR CE1 C Y N 299 PTR CE2 C Y N 300 PTR CZ C Y N 301 PTR OH O N N 302 PTR P P N N 303 PTR O1P O N N 304 PTR O2P O N N 305 PTR O3P O N N 306 PTR H H N N 307 PTR H2 H N N 308 PTR HA H N N 309 PTR HXT H N N 310 PTR HB2 H N N 311 PTR HB3 H N N 312 PTR HD1 H N N 313 PTR HD2 H N N 314 PTR HE1 H N N 315 PTR HE2 H N N 316 PTR HO2P H N N 317 PTR HO3P H N N 318 SER N N N N 319 SER CA C N S 320 SER C C N N 321 SER O O N N 322 SER CB C N N 323 SER OG O N N 324 SER OXT O N N 325 SER H H N N 326 SER H2 H N N 327 SER HA H N N 328 SER HB2 H N N 329 SER HB3 H N N 330 SER HG H N N 331 SER HXT H N N 332 THR N N N N 333 THR CA C N S 334 THR C C N N 335 THR O O N N 336 THR CB C N R 337 THR OG1 O N N 338 THR CG2 C N N 339 THR OXT O N N 340 THR H H N N 341 THR H2 H N N 342 THR HA H N N 343 THR HB H N N 344 THR HG1 H N N 345 THR HG21 H N N 346 THR HG22 H N N 347 THR HG23 H N N 348 THR HXT H N N 349 TRP N N N N 350 TRP CA C N S 351 TRP C C N N 352 TRP O O N N 353 TRP CB C N N 354 TRP CG C Y N 355 TRP CD1 C Y N 356 TRP CD2 C Y N 357 TRP NE1 N Y N 358 TRP CE2 C Y N 359 TRP CE3 C Y N 360 TRP CZ2 C Y N 361 TRP CZ3 C Y N 362 TRP CH2 C Y N 363 TRP OXT O N N 364 TRP H H N N 365 TRP H2 H N N 366 TRP HA H N N 367 TRP HB2 H N N 368 TRP HB3 H N N 369 TRP HD1 H N N 370 TRP HE1 H N N 371 TRP HE3 H N N 372 TRP HZ2 H N N 373 TRP HZ3 H N N 374 TRP HH2 H N N 375 TRP HXT H N N 376 TYR N N N N 377 TYR CA C N S 378 TYR C C N N 379 TYR O O N N 380 TYR CB C N N 381 TYR CG C Y N 382 TYR CD1 C Y N 383 TYR CD2 C Y N 384 TYR CE1 C Y N 385 TYR CE2 C Y N 386 TYR CZ C Y N 387 TYR OH O N N 388 TYR OXT O N N 389 TYR H H N N 390 TYR H2 H N N 391 TYR HA H N N 392 TYR HB2 H N N 393 TYR HB3 H N N 394 TYR HD1 H N N 395 TYR HD2 H N N 396 TYR HE1 H N N 397 TYR HE2 H N N 398 TYR HH H N N 399 TYR HXT H N N 400 VAL N N N N 401 VAL CA C N S 402 VAL C C N N 403 VAL O O N N 404 VAL CB C N N 405 VAL CG1 C N N 406 VAL CG2 C N N 407 VAL OXT O N N 408 VAL H H N N 409 VAL H2 H N N 410 VAL HA H N N 411 VAL HB H N N 412 VAL HG11 H N N 413 VAL HG12 H N N 414 VAL HG13 H N N 415 VAL HG21 H N N 416 VAL HG22 H N N 417 VAL HG23 H N N 418 VAL HXT H N N 419 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 PTR N CA sing N N 277 PTR N H sing N N 278 PTR N H2 sing N N 279 PTR CA C sing N N 280 PTR CA CB sing N N 281 PTR CA HA sing N N 282 PTR C O doub N N 283 PTR C OXT sing N N 284 PTR OXT HXT sing N N 285 PTR CB CG sing N N 286 PTR CB HB2 sing N N 287 PTR CB HB3 sing N N 288 PTR CG CD1 doub Y N 289 PTR CG CD2 sing Y N 290 PTR CD1 CE1 sing Y N 291 PTR CD1 HD1 sing N N 292 PTR CD2 CE2 doub Y N 293 PTR CD2 HD2 sing N N 294 PTR CE1 CZ doub Y N 295 PTR CE1 HE1 sing N N 296 PTR CE2 CZ sing Y N 297 PTR CE2 HE2 sing N N 298 PTR CZ OH sing N N 299 PTR OH P sing N N 300 PTR P O1P doub N N 301 PTR P O2P sing N N 302 PTR P O3P sing N N 303 PTR O2P HO2P sing N N 304 PTR O3P HO3P sing N N 305 SER N CA sing N N 306 SER N H sing N N 307 SER N H2 sing N N 308 SER CA C sing N N 309 SER CA CB sing N N 310 SER CA HA sing N N 311 SER C O doub N N 312 SER C OXT sing N N 313 SER CB OG sing N N 314 SER CB HB2 sing N N 315 SER CB HB3 sing N N 316 SER OG HG sing N N 317 SER OXT HXT sing N N 318 THR N CA sing N N 319 THR N H sing N N 320 THR N H2 sing N N 321 THR CA C sing N N 322 THR CA CB sing N N 323 THR CA HA sing N N 324 THR C O doub N N 325 THR C OXT sing N N 326 THR CB OG1 sing N N 327 THR CB CG2 sing N N 328 THR CB HB sing N N 329 THR OG1 HG1 sing N N 330 THR CG2 HG21 sing N N 331 THR CG2 HG22 sing N N 332 THR CG2 HG23 sing N N 333 THR OXT HXT sing N N 334 TRP N CA sing N N 335 TRP N H sing N N 336 TRP N H2 sing N N 337 TRP CA C sing N N 338 TRP CA CB sing N N 339 TRP CA HA sing N N 340 TRP C O doub N N 341 TRP C OXT sing N N 342 TRP CB CG sing N N 343 TRP CB HB2 sing N N 344 TRP CB HB3 sing N N 345 TRP CG CD1 doub Y N 346 TRP CG CD2 sing Y N 347 TRP CD1 NE1 sing Y N 348 TRP CD1 HD1 sing N N 349 TRP CD2 CE2 doub Y N 350 TRP CD2 CE3 sing Y N 351 TRP NE1 CE2 sing Y N 352 TRP NE1 HE1 sing N N 353 TRP CE2 CZ2 sing Y N 354 TRP CE3 CZ3 doub Y N 355 TRP CE3 HE3 sing N N 356 TRP CZ2 CH2 doub Y N 357 TRP CZ2 HZ2 sing N N 358 TRP CZ3 CH2 sing Y N 359 TRP CZ3 HZ3 sing N N 360 TRP CH2 HH2 sing N N 361 TRP OXT HXT sing N N 362 TYR N CA sing N N 363 TYR N H sing N N 364 TYR N H2 sing N N 365 TYR CA C sing N N 366 TYR CA CB sing N N 367 TYR CA HA sing N N 368 TYR C O doub N N 369 TYR C OXT sing N N 370 TYR CB CG sing N N 371 TYR CB HB2 sing N N 372 TYR CB HB3 sing N N 373 TYR CG CD1 doub Y N 374 TYR CG CD2 sing Y N 375 TYR CD1 CE1 sing Y N 376 TYR CD1 HD1 sing N N 377 TYR CD2 CE2 doub Y N 378 TYR CD2 HD2 sing N N 379 TYR CE1 CZ doub Y N 380 TYR CE1 HE1 sing N N 381 TYR CE2 CZ sing Y N 382 TYR CE2 HE2 sing N N 383 TYR CZ OH sing N N 384 TYR OH HH sing N N 385 TYR OXT HXT sing N N 386 VAL N CA sing N N 387 VAL N H sing N N 388 VAL N H2 sing N N 389 VAL CA C sing N N 390 VAL CA CB sing N N 391 VAL CA HA sing N N 392 VAL C O doub N N 393 VAL C OXT sing N N 394 VAL CB CG1 sing N N 395 VAL CB CG2 sing N N 396 VAL CB HB sing N N 397 VAL CG1 HG11 sing N N 398 VAL CG1 HG12 sing N N 399 VAL CG1 HG13 sing N N 400 VAL CG2 HG21 sing N N 401 VAL CG2 HG22 sing N N 402 VAL CG2 HG23 sing N N 403 VAL OXT HXT sing N N 404 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3ZFX _pdbx_initial_refinement_model.details 'PDB entry 3zfx' # _atom_sites.entry_id 7KPL _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.030251 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010934 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010263 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O P S # loop_