data_7LAD # _entry.id 7LAD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.352 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7LAD pdb_00007lad 10.2210/pdb7lad/pdb WWPDB D_1000253325 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7LAD _pdbx_database_status.recvd_initial_deposition_date 2021-01-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Buchman, C.D.' 1 ? 'Miller, D.' 2 ? 'Wang, J.' 3 ? 'Jayaraman, S.' 4 ? 'Chen, T.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Am.Chem.Soc. _citation.journal_id_ASTM JACSAT _citation.journal_id_CSD ? _citation.journal_id_ISSN 1520-5126 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 143 _citation.language ? _citation.page_first 18467 _citation.page_last 18480 _citation.title 'Unraveling the Structural Basis of Selective Inhibition of Human Cytochrome P450 3A5.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/jacs.1c07066 _citation.pdbx_database_id_PubMed 34648292 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wang, J.' 1 ? primary 'Buchman, C.D.' 2 0000-0003-2550-649X primary 'Seetharaman, J.' 3 ? primary 'Miller, D.J.' 4 ? primary 'Huber, A.D.' 5 ? primary 'Wu, J.' 6 ? primary 'Chai, S.C.' 7 0000-0002-8257-8599 primary 'Garcia-Maldonado, E.' 8 ? primary 'Wright, W.C.' 9 ? primary 'Chenge, J.' 10 ? primary 'Chen, T.' 11 0000-0001-6420-3809 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7LAD _cell.details ? _cell.formula_units_Z ? _cell.length_a 75.404 _cell.length_a_esd ? _cell.length_b 93.912 _cell.length_b_esd ? _cell.length_c 138.716 _cell.length_c_esd ? _cell.volume 982295.222 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7LAD _symmetry.cell_setting ? _symmetry.Int_Tables_number 23 _symmetry.space_group_name_Hall 'I 2 2' _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Cytochrome P450 3A5' 55069.766 1 1.14.14.1 ? ? ? 2 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487 1 ? ? ? ? 3 non-polymer syn 'Clobetasol propionate' 466.970 1 ? ? ? ? 4 water nat water 18.015 4 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'CYPIIIA5,Cytochrome P450-PCN3' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MDYLYGTRTHGLFKRLGIPGPTPLPLLGNVLSYRQGLWKFDTECYKKYGKMWGTYEGQLPVLAITDPDVIRTVLVKECYS VFTNRRSLGPVGFMKSAISLAEDEEWKRIRSLLSPTFTSGKLKEMFPIIAQYGDVLVRNLRREAEKGKPVTLKDIFGAYS MDVITGTSFGVNIDSLNNPQDPFVESTKKFLKFGFLDPLFLSIILFPFLTPVFEALNVSLFPKDTINFLSKSVNRMKKSR LNDKQKHRLDFLQLMIDSQNSKETESHKALSDLELAAQSIIFIFAGYETTSSVLSFTLYELATHPDVQQKLQKEIDAVLP NKAPPTYDAVVQMEYLDMVVNETLRLFPVAIRLERTCKKDVEINGVFIPKGSMVVIPTYALHHDPKYWTEPEEFRPERFS KKKDSIDPYIYTPFGTGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLDTQGLLQPEKPIVLKVDSRDGHHH H ; _entity_poly.pdbx_seq_one_letter_code_can ;MDYLYGTRTHGLFKRLGIPGPTPLPLLGNVLSYRQGLWKFDTECYKKYGKMWGTYEGQLPVLAITDPDVIRTVLVKECYS VFTNRRSLGPVGFMKSAISLAEDEEWKRIRSLLSPTFTSGKLKEMFPIIAQYGDVLVRNLRREAEKGKPVTLKDIFGAYS MDVITGTSFGVNIDSLNNPQDPFVESTKKFLKFGFLDPLFLSIILFPFLTPVFEALNVSLFPKDTINFLSKSVNRMKKSR LNDKQKHRLDFLQLMIDSQNSKETESHKALSDLELAAQSIIFIFAGYETTSSVLSFTLYELATHPDVQQKLQKEIDAVLP NKAPPTYDAVVQMEYLDMVVNETLRLFPVAIRLERTCKKDVEINGVFIPKGSMVVIPTYALHHDPKYWTEPEEFRPERFS KKKDSIDPYIYTPFGTGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLDTQGLLQPEKPIVLKVDSRDGHHH H ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 TYR n 1 4 LEU n 1 5 TYR n 1 6 GLY n 1 7 THR n 1 8 ARG n 1 9 THR n 1 10 HIS n 1 11 GLY n 1 12 LEU n 1 13 PHE n 1 14 LYS n 1 15 ARG n 1 16 LEU n 1 17 GLY n 1 18 ILE n 1 19 PRO n 1 20 GLY n 1 21 PRO n 1 22 THR n 1 23 PRO n 1 24 LEU n 1 25 PRO n 1 26 LEU n 1 27 LEU n 1 28 GLY n 1 29 ASN n 1 30 VAL n 1 31 LEU n 1 32 SER n 1 33 TYR n 1 34 ARG n 1 35 GLN n 1 36 GLY n 1 37 LEU n 1 38 TRP n 1 39 LYS n 1 40 PHE n 1 41 ASP n 1 42 THR n 1 43 GLU n 1 44 CYS n 1 45 TYR n 1 46 LYS n 1 47 LYS n 1 48 TYR n 1 49 GLY n 1 50 LYS n 1 51 MET n 1 52 TRP n 1 53 GLY n 1 54 THR n 1 55 TYR n 1 56 GLU n 1 57 GLY n 1 58 GLN n 1 59 LEU n 1 60 PRO n 1 61 VAL n 1 62 LEU n 1 63 ALA n 1 64 ILE n 1 65 THR n 1 66 ASP n 1 67 PRO n 1 68 ASP n 1 69 VAL n 1 70 ILE n 1 71 ARG n 1 72 THR n 1 73 VAL n 1 74 LEU n 1 75 VAL n 1 76 LYS n 1 77 GLU n 1 78 CYS n 1 79 TYR n 1 80 SER n 1 81 VAL n 1 82 PHE n 1 83 THR n 1 84 ASN n 1 85 ARG n 1 86 ARG n 1 87 SER n 1 88 LEU n 1 89 GLY n 1 90 PRO n 1 91 VAL n 1 92 GLY n 1 93 PHE n 1 94 MET n 1 95 LYS n 1 96 SER n 1 97 ALA n 1 98 ILE n 1 99 SER n 1 100 LEU n 1 101 ALA n 1 102 GLU n 1 103 ASP n 1 104 GLU n 1 105 GLU n 1 106 TRP n 1 107 LYS n 1 108 ARG n 1 109 ILE n 1 110 ARG n 1 111 SER n 1 112 LEU n 1 113 LEU n 1 114 SER n 1 115 PRO n 1 116 THR n 1 117 PHE n 1 118 THR n 1 119 SER n 1 120 GLY n 1 121 LYS n 1 122 LEU n 1 123 LYS n 1 124 GLU n 1 125 MET n 1 126 PHE n 1 127 PRO n 1 128 ILE n 1 129 ILE n 1 130 ALA n 1 131 GLN n 1 132 TYR n 1 133 GLY n 1 134 ASP n 1 135 VAL n 1 136 LEU n 1 137 VAL n 1 138 ARG n 1 139 ASN n 1 140 LEU n 1 141 ARG n 1 142 ARG n 1 143 GLU n 1 144 ALA n 1 145 GLU n 1 146 LYS n 1 147 GLY n 1 148 LYS n 1 149 PRO n 1 150 VAL n 1 151 THR n 1 152 LEU n 1 153 LYS n 1 154 ASP n 1 155 ILE n 1 156 PHE n 1 157 GLY n 1 158 ALA n 1 159 TYR n 1 160 SER n 1 161 MET n 1 162 ASP n 1 163 VAL n 1 164 ILE n 1 165 THR n 1 166 GLY n 1 167 THR n 1 168 SER n 1 169 PHE n 1 170 GLY n 1 171 VAL n 1 172 ASN n 1 173 ILE n 1 174 ASP n 1 175 SER n 1 176 LEU n 1 177 ASN n 1 178 ASN n 1 179 PRO n 1 180 GLN n 1 181 ASP n 1 182 PRO n 1 183 PHE n 1 184 VAL n 1 185 GLU n 1 186 SER n 1 187 THR n 1 188 LYS n 1 189 LYS n 1 190 PHE n 1 191 LEU n 1 192 LYS n 1 193 PHE n 1 194 GLY n 1 195 PHE n 1 196 LEU n 1 197 ASP n 1 198 PRO n 1 199 LEU n 1 200 PHE n 1 201 LEU n 1 202 SER n 1 203 ILE n 1 204 ILE n 1 205 LEU n 1 206 PHE n 1 207 PRO n 1 208 PHE n 1 209 LEU n 1 210 THR n 1 211 PRO n 1 212 VAL n 1 213 PHE n 1 214 GLU n 1 215 ALA n 1 216 LEU n 1 217 ASN n 1 218 VAL n 1 219 SER n 1 220 LEU n 1 221 PHE n 1 222 PRO n 1 223 LYS n 1 224 ASP n 1 225 THR n 1 226 ILE n 1 227 ASN n 1 228 PHE n 1 229 LEU n 1 230 SER n 1 231 LYS n 1 232 SER n 1 233 VAL n 1 234 ASN n 1 235 ARG n 1 236 MET n 1 237 LYS n 1 238 LYS n 1 239 SER n 1 240 ARG n 1 241 LEU n 1 242 ASN n 1 243 ASP n 1 244 LYS n 1 245 GLN n 1 246 LYS n 1 247 HIS n 1 248 ARG n 1 249 LEU n 1 250 ASP n 1 251 PHE n 1 252 LEU n 1 253 GLN n 1 254 LEU n 1 255 MET n 1 256 ILE n 1 257 ASP n 1 258 SER n 1 259 GLN n 1 260 ASN n 1 261 SER n 1 262 LYS n 1 263 GLU n 1 264 THR n 1 265 GLU n 1 266 SER n 1 267 HIS n 1 268 LYS n 1 269 ALA n 1 270 LEU n 1 271 SER n 1 272 ASP n 1 273 LEU n 1 274 GLU n 1 275 LEU n 1 276 ALA n 1 277 ALA n 1 278 GLN n 1 279 SER n 1 280 ILE n 1 281 ILE n 1 282 PHE n 1 283 ILE n 1 284 PHE n 1 285 ALA n 1 286 GLY n 1 287 TYR n 1 288 GLU n 1 289 THR n 1 290 THR n 1 291 SER n 1 292 SER n 1 293 VAL n 1 294 LEU n 1 295 SER n 1 296 PHE n 1 297 THR n 1 298 LEU n 1 299 TYR n 1 300 GLU n 1 301 LEU n 1 302 ALA n 1 303 THR n 1 304 HIS n 1 305 PRO n 1 306 ASP n 1 307 VAL n 1 308 GLN n 1 309 GLN n 1 310 LYS n 1 311 LEU n 1 312 GLN n 1 313 LYS n 1 314 GLU n 1 315 ILE n 1 316 ASP n 1 317 ALA n 1 318 VAL n 1 319 LEU n 1 320 PRO n 1 321 ASN n 1 322 LYS n 1 323 ALA n 1 324 PRO n 1 325 PRO n 1 326 THR n 1 327 TYR n 1 328 ASP n 1 329 ALA n 1 330 VAL n 1 331 VAL n 1 332 GLN n 1 333 MET n 1 334 GLU n 1 335 TYR n 1 336 LEU n 1 337 ASP n 1 338 MET n 1 339 VAL n 1 340 VAL n 1 341 ASN n 1 342 GLU n 1 343 THR n 1 344 LEU n 1 345 ARG n 1 346 LEU n 1 347 PHE n 1 348 PRO n 1 349 VAL n 1 350 ALA n 1 351 ILE n 1 352 ARG n 1 353 LEU n 1 354 GLU n 1 355 ARG n 1 356 THR n 1 357 CYS n 1 358 LYS n 1 359 LYS n 1 360 ASP n 1 361 VAL n 1 362 GLU n 1 363 ILE n 1 364 ASN n 1 365 GLY n 1 366 VAL n 1 367 PHE n 1 368 ILE n 1 369 PRO n 1 370 LYS n 1 371 GLY n 1 372 SER n 1 373 MET n 1 374 VAL n 1 375 VAL n 1 376 ILE n 1 377 PRO n 1 378 THR n 1 379 TYR n 1 380 ALA n 1 381 LEU n 1 382 HIS n 1 383 HIS n 1 384 ASP n 1 385 PRO n 1 386 LYS n 1 387 TYR n 1 388 TRP n 1 389 THR n 1 390 GLU n 1 391 PRO n 1 392 GLU n 1 393 GLU n 1 394 PHE n 1 395 ARG n 1 396 PRO n 1 397 GLU n 1 398 ARG n 1 399 PHE n 1 400 SER n 1 401 LYS n 1 402 LYS n 1 403 LYS n 1 404 ASP n 1 405 SER n 1 406 ILE n 1 407 ASP n 1 408 PRO n 1 409 TYR n 1 410 ILE n 1 411 TYR n 1 412 THR n 1 413 PRO n 1 414 PHE n 1 415 GLY n 1 416 THR n 1 417 GLY n 1 418 PRO n 1 419 ARG n 1 420 ASN n 1 421 CYS n 1 422 ILE n 1 423 GLY n 1 424 MET n 1 425 ARG n 1 426 PHE n 1 427 ALA n 1 428 LEU n 1 429 MET n 1 430 ASN n 1 431 MET n 1 432 LYS n 1 433 LEU n 1 434 ALA n 1 435 LEU n 1 436 ILE n 1 437 ARG n 1 438 VAL n 1 439 LEU n 1 440 GLN n 1 441 ASN n 1 442 PHE n 1 443 SER n 1 444 PHE n 1 445 LYS n 1 446 PRO n 1 447 CYS n 1 448 LYS n 1 449 GLU n 1 450 THR n 1 451 GLN n 1 452 ILE n 1 453 PRO n 1 454 LEU n 1 455 LYS n 1 456 LEU n 1 457 ASP n 1 458 THR n 1 459 GLN n 1 460 GLY n 1 461 LEU n 1 462 LEU n 1 463 GLN n 1 464 PRO n 1 465 GLU n 1 466 LYS n 1 467 PRO n 1 468 ILE n 1 469 VAL n 1 470 LEU n 1 471 LYS n 1 472 VAL n 1 473 ASP n 1 474 SER n 1 475 ARG n 1 476 ASP n 1 477 GLY n 1 478 HIS n 1 479 HIS n 1 480 HIS n 1 481 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 481 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene CYP3A5 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CP3A5_HUMAN _struct_ref.pdbx_db_accession P20815 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;YLYGTRTHGLFKRLGIPGPTPLPLLGNVLSYRQGLWKFDTECYKKYGKMWGTYEGQLPVLAITDPDVIRTVLVKECYSVF TNRRSLGPVGFMKSAISLAEDEEWKRIRSLLSPTFTSGKLKEMFPIIAQYGDVLVRNLRREAEKGKPVTLKDIFGAYSMD VITGTSFGVNIDSLNNPQDPFVESTKKFLKFGFLDPLFLSIILFPFLTPVFEALNVSLFPKDTINFLSKSVNRMKKSRLN DKQKHRLDFLQLMIDSQNSKETESHKALSDLELAAQSIIFIFAGYETTSSVLSFTLYELATHPDVQQKLQKEIDAVLPNK APPTYDAVVQMEYLDMVVNETLRLFPVAIRLERTCKKDVEINGVFIPKGSMVVIPTYALHHDPKYWTEPEEFRPERFSKK KDSIDPYIYTPFGTGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLDTQGLLQPEKPIVLKVDSRDG ; _struct_ref.pdbx_align_begin 23 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7LAD _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 477 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P20815 _struct_ref_seq.db_align_beg 23 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 497 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 23 _struct_ref_seq.pdbx_auth_seq_align_end 497 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7LAD MET A 1 ? UNP P20815 ? ? 'initiating methionine' 21 1 1 7LAD ASP A 2 ? UNP P20815 ? ? 'expression tag' 22 2 1 7LAD HIS A 478 ? UNP P20815 ? ? 'expression tag' 498 3 1 7LAD HIS A 479 ? UNP P20815 ? ? 'expression tag' 499 4 1 7LAD HIS A 480 ? UNP P20815 ? ? 'expression tag' 500 5 1 7LAD HIS A 481 ? UNP P20815 ? ? 'expression tag' 501 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEM non-polymer . 'PROTOPORPHYRIN IX CONTAINING FE' HEME 'C34 H32 Fe N4 O4' 616.487 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 XRD non-polymer . 'Clobetasol propionate' '(8alpha,11beta,14beta,16alpha,17alpha)-21-chloro-9-fluoro-11-hydroxy-16-methyl-3,20-dioxopregna-1,4-dien-17-yl propanoate' 'C25 H32 Cl F O5' 466.970 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7LAD _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.23 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 44.83 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2M ADA, 30% PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-10-30 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9201 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NSLS-II BEAMLINE 17-ID-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9201 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 17-ID-1 _diffrn_source.pdbx_synchrotron_site NSLS-II # _reflns.B_iso_Wilson_estimate 58.58 _reflns.entry_id 7LAD _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.6460 _reflns.d_resolution_low 29.40 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14710 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.9 _reflns.pdbx_Rmerge_I_obs 0.092 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.65 _reflns_shell.d_res_low 2.71 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.30 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1043 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.801 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.827 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 65.80 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7LAD _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.65 _refine.ls_d_res_low 29.40 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 14703 _refine.ls_number_reflns_R_free 760 _refine.ls_number_reflns_R_work 13943 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.74 _refine.ls_percent_reflns_R_free 5.17 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2511 _refine.ls_R_factor_R_free 0.2783 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2496 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6MJM _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 33.3288 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4016 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.65 _refine_hist.d_res_low 29.40 _refine_hist.number_atoms_solvent 4 _refine_hist.number_atoms_total 3528 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 3449 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 75 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0102 ? 3621 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.1797 ? 4958 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0562 ? 564 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0101 ? 624 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 14.8817 ? 1303 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.65 2.85 . . 152 2716 99.10 . . . 0.4135 . 0.3535 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.85 3.14 . . 152 2756 99.97 . . . 0.3606 . 0.3259 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.14 3.59 . . 152 2763 99.97 . . . 0.3275 . 0.2876 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.59 4.52 . . 152 2797 99.97 . . . 0.2759 . 0.2356 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.52 29.40 . . 152 2911 99.67 . . . 0.2158 . 0.2066 . . . . . . . . . . . # _struct.entry_id 7LAD _struct.title 'Clobetasol propionate bound to CYP3A5' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7LAD _struct_keywords.text 'Cytochrome P450, CYP3A5, MEMBRANE PROTEIN' _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 11 ? LEU A 16 ? GLY A 31 LEU A 36 1 ? 6 HELX_P HELX_P2 AA2 ASN A 29 ? GLN A 35 ? ASN A 49 GLN A 55 5 ? 7 HELX_P HELX_P3 AA3 GLY A 36 ? GLY A 49 ? GLY A 56 GLY A 69 1 ? 14 HELX_P HELX_P4 AA4 ASP A 66 ? VAL A 75 ? ASP A 86 VAL A 95 1 ? 10 HELX_P HELX_P5 AA5 VAL A 91 ? ALA A 97 ? VAL A 111 ALA A 117 5 ? 7 HELX_P HELX_P6 AA6 GLU A 102 ? THR A 118 ? GLU A 122 THR A 138 1 ? 17 HELX_P HELX_P7 AA7 THR A 118 ? GLN A 131 ? THR A 138 GLN A 151 1 ? 14 HELX_P HELX_P8 AA8 GLN A 131 ? LYS A 146 ? GLN A 151 LYS A 166 1 ? 16 HELX_P HELX_P9 AA9 LEU A 152 ? PHE A 169 ? LEU A 172 PHE A 189 1 ? 18 HELX_P HELX_P10 AB1 ASP A 174 ? ASN A 178 ? ASP A 194 ASN A 198 5 ? 5 HELX_P HELX_P11 AB2 ASP A 181 ? LYS A 188 ? ASP A 201 LYS A 208 1 ? 8 HELX_P HELX_P12 AB3 LYS A 189 ? LEU A 191 ? LYS A 209 LEU A 211 5 ? 3 HELX_P HELX_P13 AB4 ASP A 197 ? PHE A 206 ? ASP A 217 PHE A 226 1 ? 10 HELX_P HELX_P14 AB5 LEU A 209 ? LEU A 216 ? LEU A 229 LEU A 236 1 ? 8 HELX_P HELX_P15 AB6 PRO A 222 ? LYS A 237 ? PRO A 242 LYS A 257 1 ? 16 HELX_P HELX_P16 AB7 ASP A 250 ? SER A 258 ? ASP A 270 SER A 278 1 ? 9 HELX_P HELX_P17 AB8 LEU A 273 ? HIS A 304 ? LEU A 293 HIS A 324 1 ? 32 HELX_P HELX_P18 AB9 HIS A 304 ? LEU A 319 ? HIS A 324 LEU A 339 1 ? 16 HELX_P HELX_P19 AC1 PRO A 320 ? ALA A 323 ? PRO A 340 ALA A 343 5 ? 4 HELX_P HELX_P20 AC2 THR A 326 ? MET A 333 ? THR A 346 MET A 353 1 ? 8 HELX_P HELX_P21 AC3 MET A 333 ? PHE A 347 ? MET A 353 PHE A 367 1 ? 15 HELX_P HELX_P22 AC4 PRO A 377 ? HIS A 383 ? PRO A 397 HIS A 403 1 ? 7 HELX_P HELX_P23 AC5 ARG A 395 ? SER A 400 ? ARG A 415 SER A 420 5 ? 6 HELX_P HELX_P24 AC6 GLY A 423 ? ASN A 441 ? GLY A 443 ASN A 461 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id metalc1 _struct_conn.conn_type_id metalc _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 421 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id HEM _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id FE _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 441 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id HEM _struct_conn.ptnr2_auth_seq_id 601 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.285 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ILE _struct_mon_prot_cis.label_seq_id 452 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ILE _struct_mon_prot_cis.auth_seq_id 472 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 453 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 473 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -8.17 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 3 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 MET A 51 ? GLU A 56 ? MET A 71 GLU A 76 AA1 2 LEU A 59 ? ILE A 64 ? LEU A 79 ILE A 84 AA1 3 MET A 373 ? ILE A 376 ? MET A 393 ILE A 396 AA1 4 LEU A 353 ? THR A 356 ? LEU A 373 THR A 376 AA2 1 VAL A 150 ? THR A 151 ? VAL A 170 THR A 171 AA2 2 VAL A 469 ? SER A 474 ? VAL A 489 SER A 494 AA2 3 PHE A 442 ? LYS A 445 ? PHE A 462 LYS A 465 AA3 1 VAL A 361 ? ILE A 363 ? VAL A 381 ILE A 383 AA3 2 VAL A 366 ? ILE A 368 ? VAL A 386 ILE A 388 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 56 ? N GLU A 76 O LEU A 59 ? O LEU A 79 AA1 2 3 N LEU A 62 ? N LEU A 82 O MET A 373 ? O MET A 393 AA1 3 4 O VAL A 374 ? O VAL A 394 N ARG A 355 ? N ARG A 375 AA2 1 2 N VAL A 150 ? N VAL A 170 O LEU A 470 ? O LEU A 490 AA2 2 3 O ASP A 473 ? O ASP A 493 N SER A 443 ? N SER A 463 AA3 1 2 N VAL A 361 ? N VAL A 381 O ILE A 368 ? O ILE A 388 # _atom_sites.entry_id 7LAD _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.013262 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010648 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007209 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CL F FE H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 21 ? ? ? A . n A 1 2 ASP 2 22 ? ? ? A . n A 1 3 TYR 3 23 ? ? ? A . n A 1 4 LEU 4 24 ? ? ? A . n A 1 5 TYR 5 25 ? ? ? A . n A 1 6 GLY 6 26 ? ? ? A . n A 1 7 THR 7 27 27 THR THR A . n A 1 8 ARG 8 28 28 ARG ARG A . n A 1 9 THR 9 29 29 THR THR A . n A 1 10 HIS 10 30 30 HIS HIS A . n A 1 11 GLY 11 31 31 GLY GLY A . n A 1 12 LEU 12 32 32 LEU LEU A . n A 1 13 PHE 13 33 33 PHE PHE A . n A 1 14 LYS 14 34 34 LYS LYS A . n A 1 15 ARG 15 35 35 ARG ARG A . n A 1 16 LEU 16 36 36 LEU LEU A . n A 1 17 GLY 17 37 37 GLY GLY A . n A 1 18 ILE 18 38 38 ILE ILE A . n A 1 19 PRO 19 39 39 PRO PRO A . n A 1 20 GLY 20 40 40 GLY GLY A . n A 1 21 PRO 21 41 41 PRO PRO A . n A 1 22 THR 22 42 42 THR THR A . n A 1 23 PRO 23 43 43 PRO PRO A . n A 1 24 LEU 24 44 44 LEU LEU A . n A 1 25 PRO 25 45 45 PRO PRO A . n A 1 26 LEU 26 46 46 LEU LEU A . n A 1 27 LEU 27 47 47 LEU LEU A . n A 1 28 GLY 28 48 48 GLY GLY A . n A 1 29 ASN 29 49 49 ASN ASN A . n A 1 30 VAL 30 50 50 VAL VAL A . n A 1 31 LEU 31 51 51 LEU LEU A . n A 1 32 SER 32 52 52 SER SER A . n A 1 33 TYR 33 53 53 TYR TYR A . n A 1 34 ARG 34 54 54 ARG ARG A . n A 1 35 GLN 35 55 55 GLN GLN A . n A 1 36 GLY 36 56 56 GLY GLY A . n A 1 37 LEU 37 57 57 LEU LEU A . n A 1 38 TRP 38 58 58 TRP TRP A . n A 1 39 LYS 39 59 59 LYS LYS A . n A 1 40 PHE 40 60 60 PHE PHE A . n A 1 41 ASP 41 61 61 ASP ASP A . n A 1 42 THR 42 62 62 THR THR A . n A 1 43 GLU 43 63 63 GLU GLU A . n A 1 44 CYS 44 64 64 CYS CYS A . n A 1 45 TYR 45 65 65 TYR TYR A . n A 1 46 LYS 46 66 66 LYS LYS A . n A 1 47 LYS 47 67 67 LYS LYS A . n A 1 48 TYR 48 68 68 TYR TYR A . n A 1 49 GLY 49 69 69 GLY GLY A . n A 1 50 LYS 50 70 70 LYS LYS A . n A 1 51 MET 51 71 71 MET MET A . n A 1 52 TRP 52 72 72 TRP TRP A . n A 1 53 GLY 53 73 73 GLY GLY A . n A 1 54 THR 54 74 74 THR THR A . n A 1 55 TYR 55 75 75 TYR TYR A . n A 1 56 GLU 56 76 76 GLU GLU A . n A 1 57 GLY 57 77 77 GLY GLY A . n A 1 58 GLN 58 78 78 GLN GLN A . n A 1 59 LEU 59 79 79 LEU LEU A . n A 1 60 PRO 60 80 80 PRO PRO A . n A 1 61 VAL 61 81 81 VAL VAL A . n A 1 62 LEU 62 82 82 LEU LEU A . n A 1 63 ALA 63 83 83 ALA ALA A . n A 1 64 ILE 64 84 84 ILE ILE A . n A 1 65 THR 65 85 85 THR THR A . n A 1 66 ASP 66 86 86 ASP ASP A . n A 1 67 PRO 67 87 87 PRO PRO A . n A 1 68 ASP 68 88 88 ASP ASP A . n A 1 69 VAL 69 89 89 VAL VAL A . n A 1 70 ILE 70 90 90 ILE ILE A . n A 1 71 ARG 71 91 91 ARG ARG A . n A 1 72 THR 72 92 92 THR THR A . n A 1 73 VAL 73 93 93 VAL VAL A . n A 1 74 LEU 74 94 94 LEU LEU A . n A 1 75 VAL 75 95 95 VAL VAL A . n A 1 76 LYS 76 96 96 LYS LYS A . n A 1 77 GLU 77 97 97 GLU GLU A . n A 1 78 CYS 78 98 98 CYS CYS A . n A 1 79 TYR 79 99 99 TYR TYR A . n A 1 80 SER 80 100 100 SER SER A . n A 1 81 VAL 81 101 101 VAL VAL A . n A 1 82 PHE 82 102 102 PHE PHE A . n A 1 83 THR 83 103 103 THR THR A . n A 1 84 ASN 84 104 104 ASN ASN A . n A 1 85 ARG 85 105 105 ARG ARG A . n A 1 86 ARG 86 106 106 ARG ARG A . n A 1 87 SER 87 107 107 SER SER A . n A 1 88 LEU 88 108 108 LEU LEU A . n A 1 89 GLY 89 109 109 GLY GLY A . n A 1 90 PRO 90 110 110 PRO PRO A . n A 1 91 VAL 91 111 111 VAL VAL A . n A 1 92 GLY 92 112 112 GLY GLY A . n A 1 93 PHE 93 113 113 PHE PHE A . n A 1 94 MET 94 114 114 MET MET A . n A 1 95 LYS 95 115 115 LYS LYS A . n A 1 96 SER 96 116 116 SER SER A . n A 1 97 ALA 97 117 117 ALA ALA A . n A 1 98 ILE 98 118 118 ILE ILE A . n A 1 99 SER 99 119 119 SER SER A . n A 1 100 LEU 100 120 120 LEU LEU A . n A 1 101 ALA 101 121 121 ALA ALA A . n A 1 102 GLU 102 122 122 GLU GLU A . n A 1 103 ASP 103 123 123 ASP ASP A . n A 1 104 GLU 104 124 124 GLU GLU A . n A 1 105 GLU 105 125 125 GLU GLU A . n A 1 106 TRP 106 126 126 TRP TRP A . n A 1 107 LYS 107 127 127 LYS LYS A . n A 1 108 ARG 108 128 128 ARG ARG A . n A 1 109 ILE 109 129 129 ILE ILE A . n A 1 110 ARG 110 130 130 ARG ARG A . n A 1 111 SER 111 131 131 SER SER A . n A 1 112 LEU 112 132 132 LEU LEU A . n A 1 113 LEU 113 133 133 LEU LEU A . n A 1 114 SER 114 134 134 SER SER A . n A 1 115 PRO 115 135 135 PRO PRO A . n A 1 116 THR 116 136 136 THR THR A . n A 1 117 PHE 117 137 137 PHE PHE A . n A 1 118 THR 118 138 138 THR THR A . n A 1 119 SER 119 139 139 SER SER A . n A 1 120 GLY 120 140 140 GLY GLY A . n A 1 121 LYS 121 141 141 LYS LYS A . n A 1 122 LEU 122 142 142 LEU LEU A . n A 1 123 LYS 123 143 143 LYS LYS A . n A 1 124 GLU 124 144 144 GLU GLU A . n A 1 125 MET 125 145 145 MET MET A . n A 1 126 PHE 126 146 146 PHE PHE A . n A 1 127 PRO 127 147 147 PRO PRO A . n A 1 128 ILE 128 148 148 ILE ILE A . n A 1 129 ILE 129 149 149 ILE ILE A . n A 1 130 ALA 130 150 150 ALA ALA A . n A 1 131 GLN 131 151 151 GLN GLN A . n A 1 132 TYR 132 152 152 TYR TYR A . n A 1 133 GLY 133 153 153 GLY GLY A . n A 1 134 ASP 134 154 154 ASP ASP A . n A 1 135 VAL 135 155 155 VAL VAL A . n A 1 136 LEU 136 156 156 LEU LEU A . n A 1 137 VAL 137 157 157 VAL VAL A . n A 1 138 ARG 138 158 158 ARG ARG A . n A 1 139 ASN 139 159 159 ASN ASN A . n A 1 140 LEU 140 160 160 LEU LEU A . n A 1 141 ARG 141 161 161 ARG ARG A . n A 1 142 ARG 142 162 162 ARG ARG A . n A 1 143 GLU 143 163 163 GLU GLU A . n A 1 144 ALA 144 164 164 ALA ALA A . n A 1 145 GLU 145 165 165 GLU GLU A . n A 1 146 LYS 146 166 166 LYS LYS A . n A 1 147 GLY 147 167 167 GLY GLY A . n A 1 148 LYS 148 168 168 LYS LYS A . n A 1 149 PRO 149 169 169 PRO PRO A . n A 1 150 VAL 150 170 170 VAL VAL A . n A 1 151 THR 151 171 171 THR THR A . n A 1 152 LEU 152 172 172 LEU LEU A . n A 1 153 LYS 153 173 173 LYS LYS A . n A 1 154 ASP 154 174 174 ASP ASP A . n A 1 155 ILE 155 175 175 ILE ILE A . n A 1 156 PHE 156 176 176 PHE PHE A . n A 1 157 GLY 157 177 177 GLY GLY A . n A 1 158 ALA 158 178 178 ALA ALA A . n A 1 159 TYR 159 179 179 TYR TYR A . n A 1 160 SER 160 180 180 SER SER A . n A 1 161 MET 161 181 181 MET MET A . n A 1 162 ASP 162 182 182 ASP ASP A . n A 1 163 VAL 163 183 183 VAL VAL A . n A 1 164 ILE 164 184 184 ILE ILE A . n A 1 165 THR 165 185 185 THR THR A . n A 1 166 GLY 166 186 186 GLY GLY A . n A 1 167 THR 167 187 187 THR THR A . n A 1 168 SER 168 188 188 SER SER A . n A 1 169 PHE 169 189 189 PHE PHE A . n A 1 170 GLY 170 190 190 GLY GLY A . n A 1 171 VAL 171 191 191 VAL VAL A . n A 1 172 ASN 172 192 192 ASN ASN A . n A 1 173 ILE 173 193 193 ILE ILE A . n A 1 174 ASP 174 194 194 ASP ASP A . n A 1 175 SER 175 195 195 SER SER A . n A 1 176 LEU 176 196 196 LEU LEU A . n A 1 177 ASN 177 197 197 ASN ASN A . n A 1 178 ASN 178 198 198 ASN ASN A . n A 1 179 PRO 179 199 199 PRO PRO A . n A 1 180 GLN 180 200 200 GLN GLN A . n A 1 181 ASP 181 201 201 ASP ASP A . n A 1 182 PRO 182 202 202 PRO PRO A . n A 1 183 PHE 183 203 203 PHE PHE A . n A 1 184 VAL 184 204 204 VAL VAL A . n A 1 185 GLU 185 205 205 GLU GLU A . n A 1 186 SER 186 206 206 SER SER A . n A 1 187 THR 187 207 207 THR THR A . n A 1 188 LYS 188 208 208 LYS LYS A . n A 1 189 LYS 189 209 209 LYS LYS A . n A 1 190 PHE 190 210 210 PHE PHE A . n A 1 191 LEU 191 211 211 LEU LEU A . n A 1 192 LYS 192 212 212 LYS LYS A . n A 1 193 PHE 193 213 213 PHE PHE A . n A 1 194 GLY 194 214 214 GLY GLY A . n A 1 195 PHE 195 215 215 PHE PHE A . n A 1 196 LEU 196 216 216 LEU LEU A . n A 1 197 ASP 197 217 217 ASP ASP A . n A 1 198 PRO 198 218 218 PRO PRO A . n A 1 199 LEU 199 219 219 LEU LEU A . n A 1 200 PHE 200 220 220 PHE PHE A . n A 1 201 LEU 201 221 221 LEU LEU A . n A 1 202 SER 202 222 222 SER SER A . n A 1 203 ILE 203 223 223 ILE ILE A . n A 1 204 ILE 204 224 224 ILE ILE A . n A 1 205 LEU 205 225 225 LEU LEU A . n A 1 206 PHE 206 226 226 PHE PHE A . n A 1 207 PRO 207 227 227 PRO PRO A . n A 1 208 PHE 208 228 228 PHE PHE A . n A 1 209 LEU 209 229 229 LEU LEU A . n A 1 210 THR 210 230 230 THR THR A . n A 1 211 PRO 211 231 231 PRO PRO A . n A 1 212 VAL 212 232 232 VAL VAL A . n A 1 213 PHE 213 233 233 PHE PHE A . n A 1 214 GLU 214 234 234 GLU GLU A . n A 1 215 ALA 215 235 235 ALA ALA A . n A 1 216 LEU 216 236 236 LEU LEU A . n A 1 217 ASN 217 237 237 ASN ASN A . n A 1 218 VAL 218 238 238 VAL VAL A . n A 1 219 SER 219 239 239 SER SER A . n A 1 220 LEU 220 240 240 LEU LEU A . n A 1 221 PHE 221 241 241 PHE PHE A . n A 1 222 PRO 222 242 242 PRO PRO A . n A 1 223 LYS 223 243 243 LYS LYS A . n A 1 224 ASP 224 244 244 ASP ASP A . n A 1 225 THR 225 245 245 THR THR A . n A 1 226 ILE 226 246 246 ILE ILE A . n A 1 227 ASN 227 247 247 ASN ASN A . n A 1 228 PHE 228 248 248 PHE PHE A . n A 1 229 LEU 229 249 249 LEU LEU A . n A 1 230 SER 230 250 250 SER SER A . n A 1 231 LYS 231 251 251 LYS LYS A . n A 1 232 SER 232 252 252 SER SER A . n A 1 233 VAL 233 253 253 VAL VAL A . n A 1 234 ASN 234 254 254 ASN ASN A . n A 1 235 ARG 235 255 255 ARG ARG A . n A 1 236 MET 236 256 256 MET MET A . n A 1 237 LYS 237 257 257 LYS LYS A . n A 1 238 LYS 238 258 ? ? ? A . n A 1 239 SER 239 259 ? ? ? A . n A 1 240 ARG 240 260 ? ? ? A . n A 1 241 LEU 241 261 ? ? ? A . n A 1 242 ASN 242 262 ? ? ? A . n A 1 243 ASP 243 263 ? ? ? A . n A 1 244 LYS 244 264 ? ? ? A . n A 1 245 GLN 245 265 ? ? ? A . n A 1 246 LYS 246 266 ? ? ? A . n A 1 247 HIS 247 267 ? ? ? A . n A 1 248 ARG 248 268 ? ? ? A . n A 1 249 LEU 249 269 269 LEU LEU A . n A 1 250 ASP 250 270 270 ASP ASP A . n A 1 251 PHE 251 271 271 PHE PHE A . n A 1 252 LEU 252 272 272 LEU LEU A . n A 1 253 GLN 253 273 273 GLN GLN A . n A 1 254 LEU 254 274 274 LEU LEU A . n A 1 255 MET 255 275 275 MET MET A . n A 1 256 ILE 256 276 276 ILE ILE A . n A 1 257 ASP 257 277 277 ASP ASP A . n A 1 258 SER 258 278 278 SER SER A . n A 1 259 GLN 259 279 ? ? ? A . n A 1 260 ASN 260 280 ? ? ? A . n A 1 261 SER 261 281 ? ? ? A . n A 1 262 LYS 262 282 ? ? ? A . n A 1 263 GLU 263 283 ? ? ? A . n A 1 264 THR 264 284 ? ? ? A . n A 1 265 GLU 265 285 ? ? ? A . n A 1 266 SER 266 286 ? ? ? A . n A 1 267 HIS 267 287 ? ? ? A . n A 1 268 LYS 268 288 ? ? ? A . n A 1 269 ALA 269 289 ? ? ? A . n A 1 270 LEU 270 290 ? ? ? A . n A 1 271 SER 271 291 291 SER SER A . n A 1 272 ASP 272 292 292 ASP ASP A . n A 1 273 LEU 273 293 293 LEU LEU A . n A 1 274 GLU 274 294 294 GLU GLU A . n A 1 275 LEU 275 295 295 LEU LEU A . n A 1 276 ALA 276 296 296 ALA ALA A . n A 1 277 ALA 277 297 297 ALA ALA A . n A 1 278 GLN 278 298 298 GLN GLN A . n A 1 279 SER 279 299 299 SER SER A . n A 1 280 ILE 280 300 300 ILE ILE A . n A 1 281 ILE 281 301 301 ILE ILE A . n A 1 282 PHE 282 302 302 PHE PHE A . n A 1 283 ILE 283 303 303 ILE ILE A . n A 1 284 PHE 284 304 304 PHE PHE A . n A 1 285 ALA 285 305 305 ALA ALA A . n A 1 286 GLY 286 306 306 GLY GLY A . n A 1 287 TYR 287 307 307 TYR TYR A . n A 1 288 GLU 288 308 308 GLU GLU A . n A 1 289 THR 289 309 309 THR THR A . n A 1 290 THR 290 310 310 THR THR A . n A 1 291 SER 291 311 311 SER SER A . n A 1 292 SER 292 312 312 SER SER A . n A 1 293 VAL 293 313 313 VAL VAL A . n A 1 294 LEU 294 314 314 LEU LEU A . n A 1 295 SER 295 315 315 SER SER A . n A 1 296 PHE 296 316 316 PHE PHE A . n A 1 297 THR 297 317 317 THR THR A . n A 1 298 LEU 298 318 318 LEU LEU A . n A 1 299 TYR 299 319 319 TYR TYR A . n A 1 300 GLU 300 320 320 GLU GLU A . n A 1 301 LEU 301 321 321 LEU LEU A . n A 1 302 ALA 302 322 322 ALA ALA A . n A 1 303 THR 303 323 323 THR THR A . n A 1 304 HIS 304 324 324 HIS HIS A . n A 1 305 PRO 305 325 325 PRO PRO A . n A 1 306 ASP 306 326 326 ASP ASP A . n A 1 307 VAL 307 327 327 VAL VAL A . n A 1 308 GLN 308 328 328 GLN GLN A . n A 1 309 GLN 309 329 329 GLN GLN A . n A 1 310 LYS 310 330 330 LYS LYS A . n A 1 311 LEU 311 331 331 LEU LEU A . n A 1 312 GLN 312 332 332 GLN GLN A . n A 1 313 LYS 313 333 333 LYS LYS A . n A 1 314 GLU 314 334 334 GLU GLU A . n A 1 315 ILE 315 335 335 ILE ILE A . n A 1 316 ASP 316 336 336 ASP ASP A . n A 1 317 ALA 317 337 337 ALA ALA A . n A 1 318 VAL 318 338 338 VAL VAL A . n A 1 319 LEU 319 339 339 LEU LEU A . n A 1 320 PRO 320 340 340 PRO PRO A . n A 1 321 ASN 321 341 341 ASN ASN A . n A 1 322 LYS 322 342 342 LYS LYS A . n A 1 323 ALA 323 343 343 ALA ALA A . n A 1 324 PRO 324 344 344 PRO PRO A . n A 1 325 PRO 325 345 345 PRO PRO A . n A 1 326 THR 326 346 346 THR THR A . n A 1 327 TYR 327 347 347 TYR TYR A . n A 1 328 ASP 328 348 348 ASP ASP A . n A 1 329 ALA 329 349 349 ALA ALA A . n A 1 330 VAL 330 350 350 VAL VAL A . n A 1 331 VAL 331 351 351 VAL VAL A . n A 1 332 GLN 332 352 352 GLN GLN A . n A 1 333 MET 333 353 353 MET MET A . n A 1 334 GLU 334 354 354 GLU GLU A . n A 1 335 TYR 335 355 355 TYR TYR A . n A 1 336 LEU 336 356 356 LEU LEU A . n A 1 337 ASP 337 357 357 ASP ASP A . n A 1 338 MET 338 358 358 MET MET A . n A 1 339 VAL 339 359 359 VAL VAL A . n A 1 340 VAL 340 360 360 VAL VAL A . n A 1 341 ASN 341 361 361 ASN ASN A . n A 1 342 GLU 342 362 362 GLU GLU A . n A 1 343 THR 343 363 363 THR THR A . n A 1 344 LEU 344 364 364 LEU LEU A . n A 1 345 ARG 345 365 365 ARG ARG A . n A 1 346 LEU 346 366 366 LEU LEU A . n A 1 347 PHE 347 367 367 PHE PHE A . n A 1 348 PRO 348 368 368 PRO PRO A . n A 1 349 VAL 349 369 369 VAL VAL A . n A 1 350 ALA 350 370 370 ALA ALA A . n A 1 351 ILE 351 371 371 ILE ILE A . n A 1 352 ARG 352 372 372 ARG ARG A . n A 1 353 LEU 353 373 373 LEU LEU A . n A 1 354 GLU 354 374 374 GLU GLU A . n A 1 355 ARG 355 375 375 ARG ARG A . n A 1 356 THR 356 376 376 THR THR A . n A 1 357 CYS 357 377 377 CYS CYS A . n A 1 358 LYS 358 378 378 LYS LYS A . n A 1 359 LYS 359 379 379 LYS LYS A . n A 1 360 ASP 360 380 380 ASP ASP A . n A 1 361 VAL 361 381 381 VAL VAL A . n A 1 362 GLU 362 382 382 GLU GLU A . n A 1 363 ILE 363 383 383 ILE ILE A . n A 1 364 ASN 364 384 384 ASN ASN A . n A 1 365 GLY 365 385 385 GLY GLY A . n A 1 366 VAL 366 386 386 VAL VAL A . n A 1 367 PHE 367 387 387 PHE PHE A . n A 1 368 ILE 368 388 388 ILE ILE A . n A 1 369 PRO 369 389 389 PRO PRO A . n A 1 370 LYS 370 390 390 LYS LYS A . n A 1 371 GLY 371 391 391 GLY GLY A . n A 1 372 SER 372 392 392 SER SER A . n A 1 373 MET 373 393 393 MET MET A . n A 1 374 VAL 374 394 394 VAL VAL A . n A 1 375 VAL 375 395 395 VAL VAL A . n A 1 376 ILE 376 396 396 ILE ILE A . n A 1 377 PRO 377 397 397 PRO PRO A . n A 1 378 THR 378 398 398 THR THR A . n A 1 379 TYR 379 399 399 TYR TYR A . n A 1 380 ALA 380 400 400 ALA ALA A . n A 1 381 LEU 381 401 401 LEU LEU A . n A 1 382 HIS 382 402 402 HIS HIS A . n A 1 383 HIS 383 403 403 HIS HIS A . n A 1 384 ASP 384 404 404 ASP ASP A . n A 1 385 PRO 385 405 405 PRO PRO A . n A 1 386 LYS 386 406 406 LYS LYS A . n A 1 387 TYR 387 407 407 TYR TYR A . n A 1 388 TRP 388 408 408 TRP TRP A . n A 1 389 THR 389 409 409 THR THR A . n A 1 390 GLU 390 410 410 GLU GLU A . n A 1 391 PRO 391 411 411 PRO PRO A . n A 1 392 GLU 392 412 412 GLU GLU A . n A 1 393 GLU 393 413 413 GLU GLU A . n A 1 394 PHE 394 414 414 PHE PHE A . n A 1 395 ARG 395 415 415 ARG ARG A . n A 1 396 PRO 396 416 416 PRO PRO A . n A 1 397 GLU 397 417 417 GLU GLU A . n A 1 398 ARG 398 418 418 ARG ARG A . n A 1 399 PHE 399 419 419 PHE PHE A . n A 1 400 SER 400 420 420 SER SER A . n A 1 401 LYS 401 421 421 LYS LYS A . n A 1 402 LYS 402 422 422 LYS LYS A . n A 1 403 LYS 403 423 423 LYS LYS A . n A 1 404 ASP 404 424 424 ASP ASP A . n A 1 405 SER 405 425 425 SER SER A . n A 1 406 ILE 406 426 426 ILE ILE A . n A 1 407 ASP 407 427 427 ASP ASP A . n A 1 408 PRO 408 428 428 PRO PRO A . n A 1 409 TYR 409 429 429 TYR TYR A . n A 1 410 ILE 410 430 430 ILE ILE A . n A 1 411 TYR 411 431 431 TYR TYR A . n A 1 412 THR 412 432 432 THR THR A . n A 1 413 PRO 413 433 433 PRO PRO A . n A 1 414 PHE 414 434 434 PHE PHE A . n A 1 415 GLY 415 435 435 GLY GLY A . n A 1 416 THR 416 436 436 THR THR A . n A 1 417 GLY 417 437 437 GLY GLY A . n A 1 418 PRO 418 438 438 PRO PRO A . n A 1 419 ARG 419 439 439 ARG ARG A . n A 1 420 ASN 420 440 440 ASN ASN A . n A 1 421 CYS 421 441 441 CYS CYS A . n A 1 422 ILE 422 442 442 ILE ILE A . n A 1 423 GLY 423 443 443 GLY GLY A . n A 1 424 MET 424 444 444 MET MET A . n A 1 425 ARG 425 445 445 ARG ARG A . n A 1 426 PHE 426 446 446 PHE PHE A . n A 1 427 ALA 427 447 447 ALA ALA A . n A 1 428 LEU 428 448 448 LEU LEU A . n A 1 429 MET 429 449 449 MET MET A . n A 1 430 ASN 430 450 450 ASN ASN A . n A 1 431 MET 431 451 451 MET MET A . n A 1 432 LYS 432 452 452 LYS LYS A . n A 1 433 LEU 433 453 453 LEU LEU A . n A 1 434 ALA 434 454 454 ALA ALA A . n A 1 435 LEU 435 455 455 LEU LEU A . n A 1 436 ILE 436 456 456 ILE ILE A . n A 1 437 ARG 437 457 457 ARG ARG A . n A 1 438 VAL 438 458 458 VAL VAL A . n A 1 439 LEU 439 459 459 LEU LEU A . n A 1 440 GLN 440 460 460 GLN GLN A . n A 1 441 ASN 441 461 461 ASN ASN A . n A 1 442 PHE 442 462 462 PHE PHE A . n A 1 443 SER 443 463 463 SER SER A . n A 1 444 PHE 444 464 464 PHE PHE A . n A 1 445 LYS 445 465 465 LYS LYS A . n A 1 446 PRO 446 466 466 PRO PRO A . n A 1 447 CYS 447 467 467 CYS CYS A . n A 1 448 LYS 448 468 468 LYS LYS A . n A 1 449 GLU 449 469 469 GLU GLU A . n A 1 450 THR 450 470 470 THR THR A . n A 1 451 GLN 451 471 471 GLN GLN A . n A 1 452 ILE 452 472 472 ILE ILE A . n A 1 453 PRO 453 473 473 PRO PRO A . n A 1 454 LEU 454 474 474 LEU LEU A . n A 1 455 LYS 455 475 475 LYS LYS A . n A 1 456 LEU 456 476 476 LEU LEU A . n A 1 457 ASP 457 477 477 ASP ASP A . n A 1 458 THR 458 478 478 THR THR A . n A 1 459 GLN 459 479 479 GLN GLN A . n A 1 460 GLY 460 480 480 GLY GLY A . n A 1 461 LEU 461 481 481 LEU LEU A . n A 1 462 LEU 462 482 482 LEU LEU A . n A 1 463 GLN 463 483 483 GLN GLN A . n A 1 464 PRO 464 484 484 PRO PRO A . n A 1 465 GLU 465 485 485 GLU GLU A . n A 1 466 LYS 466 486 486 LYS LYS A . n A 1 467 PRO 467 487 487 PRO PRO A . n A 1 468 ILE 468 488 488 ILE ILE A . n A 1 469 VAL 469 489 489 VAL VAL A . n A 1 470 LEU 470 490 490 LEU LEU A . n A 1 471 LYS 471 491 491 LYS LYS A . n A 1 472 VAL 472 492 492 VAL VAL A . n A 1 473 ASP 473 493 493 ASP ASP A . n A 1 474 SER 474 494 494 SER SER A . n A 1 475 ARG 475 495 495 ARG ARG A . n A 1 476 ASP 476 496 496 ASP ASP A . n A 1 477 GLY 477 497 ? ? ? A . n A 1 478 HIS 478 498 ? ? ? A . n A 1 479 HIS 479 499 ? ? ? A . n A 1 480 HIS 480 500 ? ? ? A . n A 1 481 HIS 481 501 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HEM 1 601 601 HEM HEM A . C 3 XRD 1 602 701 XRD CBZ A . D 4 HOH 1 701 4 HOH HOH A . D 4 HOH 2 702 1 HOH HOH A . D 4 HOH 3 703 3 HOH HOH A . D 4 HOH 4 704 2 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 421 ? A CYS 441 ? 1_555 FE ? B HEM . ? A HEM 601 ? 1_555 NA ? B HEM . ? A HEM 601 ? 1_555 105.5 ? 2 SG ? A CYS 421 ? A CYS 441 ? 1_555 FE ? B HEM . ? A HEM 601 ? 1_555 NB ? B HEM . ? A HEM 601 ? 1_555 95.9 ? 3 NA ? B HEM . ? A HEM 601 ? 1_555 FE ? B HEM . ? A HEM 601 ? 1_555 NB ? B HEM . ? A HEM 601 ? 1_555 89.7 ? 4 SG ? A CYS 421 ? A CYS 441 ? 1_555 FE ? B HEM . ? A HEM 601 ? 1_555 NC ? B HEM . ? A HEM 601 ? 1_555 79.6 ? 5 NA ? B HEM . ? A HEM 601 ? 1_555 FE ? B HEM . ? A HEM 601 ? 1_555 NC ? B HEM . ? A HEM 601 ? 1_555 173.5 ? 6 NB ? B HEM . ? A HEM 601 ? 1_555 FE ? B HEM . ? A HEM 601 ? 1_555 NC ? B HEM . ? A HEM 601 ? 1_555 93.8 ? 7 SG ? A CYS 421 ? A CYS 441 ? 1_555 FE ? B HEM . ? A HEM 601 ? 1_555 ND ? B HEM . ? A HEM 601 ? 1_555 89.6 ? 8 NA ? B HEM . ? A HEM 601 ? 1_555 FE ? B HEM . ? A HEM 601 ? 1_555 ND ? B HEM . ? A HEM 601 ? 1_555 89.3 ? 9 NB ? B HEM . ? A HEM 601 ? 1_555 FE ? B HEM . ? A HEM 601 ? 1_555 ND ? B HEM . ? A HEM 601 ? 1_555 174.5 ? 10 NC ? B HEM . ? A HEM 601 ? 1_555 FE ? B HEM . ? A HEM 601 ? 1_555 ND ? B HEM . ? A HEM 601 ? 1_555 86.8 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-10-27 2 'Structure model' 1 1 2021-11-17 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Derived calculations' 3 2 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp 2 2 'Structure model' citation 3 2 'Structure model' entity 4 2 'Structure model' pdbx_entity_nonpoly # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_chem_comp.name' 2 2 'Structure model' '_chem_comp.pdbx_synonyms' 3 2 'Structure model' '_citation.journal_volume' 4 2 'Structure model' '_citation.page_first' 5 2 'Structure model' '_citation.page_last' 6 2 'Structure model' '_entity.pdbx_description' 7 2 'Structure model' '_pdbx_entity_nonpoly.name' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 13.5922567168 1.68853443926 23.933669603 0.357106736797 ? -0.00546768206025 ? -0.0406360522852 ? 0.228623026357 ? -0.0538451975905 ? 0.377296252994 ? 0.00456407282842 ? 0.00895213619846 ? -0.00049756668805 ? -0.00190149050231 ? -0.0156409994238 ? 0.0340869475785 ? 0.0355740760922 ? 0.225589029212 ? -0.262017744337 ? 0.0156458067672 ? 0.0550938559546 ? -0.146391990956 ? 0.0369735571161 ? -0.023567250563 ? -1.68936789481e-08 ? 2 'X-RAY DIFFRACTION' ? refined 17.3673930211 24.3610028365 6.66802549901 0.0837473730105 ? -0.199322435985 ? 0.126431323301 ? 0.68744481829 ? -0.196216902194 ? 0.0296962287374 ? 0.0795115092133 ? 0.310277034822 ? -0.0856350651422 ? 0.0153022986973 ? 0.224924861011 ? 0.172764231792 ? -0.780560522078 ? 1.0554444299 ? 0.599474332559 ? 0.539687506618 ? 0.465262539957 ? 0.205558092552 ? -0.219290360378 ? 0.191577217761 ? 2.29086508262e-10 ? 3 'X-RAY DIFFRACTION' ? refined 23.1454272927 26.9104006127 23.0268439651 0.182792094205 ? -0.124440244754 ? -0.119597699425 ? 0.161920485049 ? -0.115040419219 ? 0.161421137739 ? 0.35637377575 ? 0.269308477567 ? 0.163318313993 ? 0.0611432493111 ? 0.0930373682752 ? -0.0251607801102 ? -0.199568900019 ? 0.638120599845 ? 0.37593771845 ? 0.549384971263 ? 0.348469321948 ? 0.290925469886 ? 0.0283580522467 ? -0.018425808013 ? 1.68493449239e-09 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 A 1 A 27 ? A 58 A 84 ? ? ;chain 'A' and (resid 27 through 84 ) ; 2 'X-RAY DIFFRACTION' 2 A 59 A 85 ? A 244 A 293 ? ? ;chain 'A' and (resid 85 through 293 ) ; 3 'X-RAY DIFFRACTION' 3 A 245 A 294 ? A 447 A 496 ? ? ;chain 'A' and (resid 294 through 496 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19_4092 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 # _pdbx_entry_details.entry_id 7LAD _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 46 ? ? 72.81 -54.93 2 1 VAL A 95 ? ? -128.29 -58.99 3 1 VAL A 101 ? ? -120.45 -75.00 4 1 ARG A 105 ? ? -93.68 -84.85 5 1 PRO A 110 ? ? -66.51 91.96 6 1 LYS A 115 ? ? -59.52 -6.08 7 1 ASP A 123 ? ? 40.64 -121.35 8 1 ASN A 198 ? ? -142.68 59.34 9 1 LYS A 208 ? ? -59.19 -6.27 10 1 PHE A 215 ? ? 66.27 -37.01 11 1 PRO A 242 ? ? -68.37 94.37 12 1 ASP A 270 ? ? -164.40 -169.79 13 1 PRO A 368 ? ? -60.54 91.45 14 1 ILE A 371 ? ? 60.59 -56.49 15 1 SER A 425 ? ? -49.89 154.07 16 1 PRO A 428 ? ? -68.10 0.71 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 34 ? CG ? A LYS 14 CG 2 1 Y 1 A LYS 34 ? CD ? A LYS 14 CD 3 1 Y 1 A LYS 34 ? CE ? A LYS 14 CE 4 1 Y 1 A LYS 34 ? NZ ? A LYS 14 NZ 5 1 Y 1 A THR 42 ? OG1 ? A THR 22 OG1 6 1 Y 1 A THR 42 ? CG2 ? A THR 22 CG2 7 1 Y 1 A GLU 63 ? CG ? A GLU 43 CG 8 1 Y 1 A GLU 63 ? CD ? A GLU 43 CD 9 1 Y 1 A GLU 63 ? OE1 ? A GLU 43 OE1 10 1 Y 1 A GLU 63 ? OE2 ? A GLU 43 OE2 11 1 Y 1 A LYS 70 ? CG ? A LYS 50 CG 12 1 Y 1 A LYS 70 ? CD ? A LYS 50 CD 13 1 Y 1 A LYS 70 ? CE ? A LYS 50 CE 14 1 Y 1 A LYS 70 ? NZ ? A LYS 50 NZ 15 1 Y 1 A LYS 96 ? CG ? A LYS 76 CG 16 1 Y 1 A LYS 96 ? CD ? A LYS 76 CD 17 1 Y 1 A LYS 96 ? CE ? A LYS 76 CE 18 1 Y 1 A LYS 96 ? NZ ? A LYS 76 NZ 19 1 Y 1 A ASN 104 ? CG ? A ASN 84 CG 20 1 Y 1 A ASN 104 ? OD1 ? A ASN 84 OD1 21 1 Y 1 A ASN 104 ? ND2 ? A ASN 84 ND2 22 1 Y 1 A LYS 115 ? CG ? A LYS 95 CG 23 1 Y 1 A LYS 115 ? CD ? A LYS 95 CD 24 1 Y 1 A LYS 115 ? CE ? A LYS 95 CE 25 1 Y 1 A LYS 115 ? NZ ? A LYS 95 NZ 26 1 Y 1 A GLU 125 ? CG ? A GLU 105 CG 27 1 Y 1 A GLU 125 ? CD ? A GLU 105 CD 28 1 Y 1 A GLU 125 ? OE1 ? A GLU 105 OE1 29 1 Y 1 A GLU 125 ? OE2 ? A GLU 105 OE2 30 1 Y 1 A LYS 127 ? CG ? A LYS 107 CG 31 1 Y 1 A LYS 127 ? CD ? A LYS 107 CD 32 1 Y 1 A LYS 127 ? CE ? A LYS 107 CE 33 1 Y 1 A LYS 127 ? NZ ? A LYS 107 NZ 34 1 Y 1 A LEU 132 ? CG ? A LEU 112 CG 35 1 Y 1 A LEU 132 ? CD1 ? A LEU 112 CD1 36 1 Y 1 A LEU 132 ? CD2 ? A LEU 112 CD2 37 1 Y 1 A LYS 141 ? CG ? A LYS 121 CG 38 1 Y 1 A LYS 141 ? CD ? A LYS 121 CD 39 1 Y 1 A LYS 141 ? CE ? A LYS 121 CE 40 1 Y 1 A LYS 141 ? NZ ? A LYS 121 NZ 41 1 Y 1 A LYS 143 ? CG ? A LYS 123 CG 42 1 Y 1 A LYS 143 ? CD ? A LYS 123 CD 43 1 Y 1 A LYS 143 ? CE ? A LYS 123 CE 44 1 Y 1 A LYS 143 ? NZ ? A LYS 123 NZ 45 1 Y 1 A MET 145 ? CG ? A MET 125 CG 46 1 Y 1 A MET 145 ? SD ? A MET 125 SD 47 1 Y 1 A MET 145 ? CE ? A MET 125 CE 48 1 Y 1 A GLN 151 ? CG ? A GLN 131 CG 49 1 Y 1 A GLN 151 ? CD ? A GLN 131 CD 50 1 Y 1 A GLN 151 ? OE1 ? A GLN 131 OE1 51 1 Y 1 A GLN 151 ? NE2 ? A GLN 131 NE2 52 1 Y 1 A ARG 162 ? CG ? A ARG 142 CG 53 1 Y 1 A ARG 162 ? CD ? A ARG 142 CD 54 1 Y 1 A ARG 162 ? NE ? A ARG 142 NE 55 1 Y 1 A ARG 162 ? CZ ? A ARG 142 CZ 56 1 Y 1 A ARG 162 ? NH1 ? A ARG 142 NH1 57 1 Y 1 A ARG 162 ? NH2 ? A ARG 142 NH2 58 1 Y 1 A GLU 165 ? CG ? A GLU 145 CG 59 1 Y 1 A GLU 165 ? CD ? A GLU 145 CD 60 1 Y 1 A GLU 165 ? OE1 ? A GLU 145 OE1 61 1 Y 1 A GLU 165 ? OE2 ? A GLU 145 OE2 62 1 Y 1 A LYS 168 ? CG ? A LYS 148 CG 63 1 Y 1 A LYS 168 ? CD ? A LYS 148 CD 64 1 Y 1 A LYS 168 ? CE ? A LYS 148 CE 65 1 Y 1 A LYS 168 ? NZ ? A LYS 148 NZ 66 1 Y 1 A ASN 192 ? CG ? A ASN 172 CG 67 1 Y 1 A ASN 192 ? OD1 ? A ASN 172 OD1 68 1 Y 1 A ASN 192 ? ND2 ? A ASN 172 ND2 69 1 Y 1 A GLN 200 ? CG ? A GLN 180 CG 70 1 Y 1 A GLN 200 ? CD ? A GLN 180 CD 71 1 Y 1 A GLN 200 ? OE1 ? A GLN 180 OE1 72 1 Y 1 A GLN 200 ? NE2 ? A GLN 180 NE2 73 1 Y 1 A ASP 201 ? CG ? A ASP 181 CG 74 1 Y 1 A ASP 201 ? OD1 ? A ASP 181 OD1 75 1 Y 1 A ASP 201 ? OD2 ? A ASP 181 OD2 76 1 Y 1 A GLU 205 ? CG ? A GLU 185 CG 77 1 Y 1 A GLU 205 ? CD ? A GLU 185 CD 78 1 Y 1 A GLU 205 ? OE1 ? A GLU 185 OE1 79 1 Y 1 A GLU 205 ? OE2 ? A GLU 185 OE2 80 1 Y 1 A LYS 208 ? CG ? A LYS 188 CG 81 1 Y 1 A LYS 208 ? CD ? A LYS 188 CD 82 1 Y 1 A LYS 208 ? CE ? A LYS 188 CE 83 1 Y 1 A LYS 208 ? NZ ? A LYS 188 NZ 84 1 Y 1 A LYS 212 ? CG ? A LYS 192 CG 85 1 Y 1 A LYS 212 ? CD ? A LYS 192 CD 86 1 Y 1 A LYS 212 ? CE ? A LYS 192 CE 87 1 Y 1 A LYS 212 ? NZ ? A LYS 192 NZ 88 1 Y 1 A LEU 216 ? CG ? A LEU 196 CG 89 1 Y 1 A LEU 216 ? CD1 ? A LEU 196 CD1 90 1 Y 1 A LEU 216 ? CD2 ? A LEU 196 CD2 91 1 Y 1 A LEU 221 ? CG ? A LEU 201 CG 92 1 Y 1 A LEU 221 ? CD1 ? A LEU 201 CD1 93 1 Y 1 A LEU 221 ? CD2 ? A LEU 201 CD2 94 1 Y 1 A LYS 243 ? CG ? A LYS 223 CG 95 1 Y 1 A LYS 243 ? CD ? A LYS 223 CD 96 1 Y 1 A LYS 243 ? CE ? A LYS 223 CE 97 1 Y 1 A LYS 243 ? NZ ? A LYS 223 NZ 98 1 Y 1 A ASP 244 ? CG ? A ASP 224 CG 99 1 Y 1 A ASP 244 ? OD1 ? A ASP 224 OD1 100 1 Y 1 A ASP 244 ? OD2 ? A ASP 224 OD2 101 1 Y 1 A LYS 251 ? CG ? A LYS 231 CG 102 1 Y 1 A LYS 251 ? CD ? A LYS 231 CD 103 1 Y 1 A LYS 251 ? CE ? A LYS 231 CE 104 1 Y 1 A LYS 251 ? NZ ? A LYS 231 NZ 105 1 Y 1 A ARG 255 ? CG ? A ARG 235 CG 106 1 Y 1 A ARG 255 ? CD ? A ARG 235 CD 107 1 Y 1 A ARG 255 ? NE ? A ARG 235 NE 108 1 Y 1 A ARG 255 ? CZ ? A ARG 235 CZ 109 1 Y 1 A ARG 255 ? NH1 ? A ARG 235 NH1 110 1 Y 1 A ARG 255 ? NH2 ? A ARG 235 NH2 111 1 Y 1 A LEU 269 ? CG ? A LEU 249 CG 112 1 Y 1 A LEU 269 ? CD1 ? A LEU 249 CD1 113 1 Y 1 A LEU 269 ? CD2 ? A LEU 249 CD2 114 1 Y 1 A ASP 270 ? CG ? A ASP 250 CG 115 1 Y 1 A ASP 270 ? OD1 ? A ASP 250 OD1 116 1 Y 1 A ASP 270 ? OD2 ? A ASP 250 OD2 117 1 Y 1 A LEU 272 ? CG ? A LEU 252 CG 118 1 Y 1 A LEU 272 ? CD1 ? A LEU 252 CD1 119 1 Y 1 A LEU 272 ? CD2 ? A LEU 252 CD2 120 1 Y 1 A GLN 273 ? CG ? A GLN 253 CG 121 1 Y 1 A GLN 273 ? CD ? A GLN 253 CD 122 1 Y 1 A GLN 273 ? OE1 ? A GLN 253 OE1 123 1 Y 1 A GLN 273 ? NE2 ? A GLN 253 NE2 124 1 Y 1 A LYS 333 ? CG ? A LYS 313 CG 125 1 Y 1 A LYS 333 ? CD ? A LYS 313 CD 126 1 Y 1 A LYS 333 ? CE ? A LYS 313 CE 127 1 Y 1 A LYS 333 ? NZ ? A LYS 313 NZ 128 1 Y 1 A GLN 352 ? CG ? A GLN 332 CG 129 1 Y 1 A GLN 352 ? CD ? A GLN 332 CD 130 1 Y 1 A GLN 352 ? OE1 ? A GLN 332 OE1 131 1 Y 1 A GLN 352 ? NE2 ? A GLN 332 NE2 132 1 Y 1 A LYS 379 ? CG ? A LYS 359 CG 133 1 Y 1 A LYS 379 ? CD ? A LYS 359 CD 134 1 Y 1 A LYS 379 ? CE ? A LYS 359 CE 135 1 Y 1 A LYS 379 ? NZ ? A LYS 359 NZ 136 1 Y 1 A LYS 468 ? CG ? A LYS 448 CG 137 1 Y 1 A LYS 468 ? CD ? A LYS 448 CD 138 1 Y 1 A LYS 468 ? CE ? A LYS 448 CE 139 1 Y 1 A LYS 468 ? NZ ? A LYS 448 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 21 ? A MET 1 2 1 Y 1 A ASP 22 ? A ASP 2 3 1 Y 1 A TYR 23 ? A TYR 3 4 1 Y 1 A LEU 24 ? A LEU 4 5 1 Y 1 A TYR 25 ? A TYR 5 6 1 Y 1 A GLY 26 ? A GLY 6 7 1 Y 1 A LYS 258 ? A LYS 238 8 1 Y 1 A SER 259 ? A SER 239 9 1 Y 1 A ARG 260 ? A ARG 240 10 1 Y 1 A LEU 261 ? A LEU 241 11 1 Y 1 A ASN 262 ? A ASN 242 12 1 Y 1 A ASP 263 ? A ASP 243 13 1 Y 1 A LYS 264 ? A LYS 244 14 1 Y 1 A GLN 265 ? A GLN 245 15 1 Y 1 A LYS 266 ? A LYS 246 16 1 Y 1 A HIS 267 ? A HIS 247 17 1 Y 1 A ARG 268 ? A ARG 248 18 1 Y 1 A GLN 279 ? A GLN 259 19 1 Y 1 A ASN 280 ? A ASN 260 20 1 Y 1 A SER 281 ? A SER 261 21 1 Y 1 A LYS 282 ? A LYS 262 22 1 Y 1 A GLU 283 ? A GLU 263 23 1 Y 1 A THR 284 ? A THR 264 24 1 Y 1 A GLU 285 ? A GLU 265 25 1 Y 1 A SER 286 ? A SER 266 26 1 Y 1 A HIS 287 ? A HIS 267 27 1 Y 1 A LYS 288 ? A LYS 268 28 1 Y 1 A ALA 289 ? A ALA 269 29 1 Y 1 A LEU 290 ? A LEU 270 30 1 Y 1 A GLY 497 ? A GLY 477 31 1 Y 1 A HIS 498 ? A HIS 478 32 1 Y 1 A HIS 499 ? A HIS 479 33 1 Y 1 A HIS 500 ? A HIS 480 34 1 Y 1 A HIS 501 ? A HIS 481 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number R35GM118041 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 XRD ? ? XRD ? ? 'SUBJECT OF INVESTIGATION' ? 2 HEM ? ? HEM ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'PROTOPORPHYRIN IX CONTAINING FE' HEM 3 'Clobetasol propionate' XRD 4 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #