data_7LDF
# 
_entry.id   7LDF 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.392 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   7LDF         pdb_00007ldf 10.2210/pdb7ldf/pdb 
WWPDB D_1000254103 ?            ?                   
BMRB  30844        ?            10.13018/BMR30844   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2022-07-13 
2 'Structure model' 1 1 2022-09-14 
3 'Structure model' 1 2 2022-12-14 
4 'Structure model' 1 3 2024-05-15 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory               
2 2 'Structure model' 'Derived calculations' 
3 3 'Structure model' 'Database references'  
4 4 'Structure model' 'Data collection'      
5 4 'Structure model' 'Database references'  
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' pdbx_database_remark    
2 2 'Structure model' pdbx_struct_sheet_hbond 
3 2 'Structure model' struct_conf             
4 2 'Structure model' struct_sheet_range      
5 3 'Structure model' citation                
6 3 'Structure model' citation_author         
7 4 'Structure model' chem_comp_atom          
8 4 'Structure model' chem_comp_bond          
9 4 'Structure model' database_2              
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_pdbx_struct_sheet_hbond.range_1_auth_atom_id'  
2  2 'Structure model' '_pdbx_struct_sheet_hbond.range_1_auth_comp_id'  
3  2 'Structure model' '_pdbx_struct_sheet_hbond.range_1_auth_seq_id'   
4  2 'Structure model' '_pdbx_struct_sheet_hbond.range_1_label_atom_id' 
5  2 'Structure model' '_pdbx_struct_sheet_hbond.range_1_label_comp_id' 
6  2 'Structure model' '_pdbx_struct_sheet_hbond.range_1_label_seq_id'  
7  2 'Structure model' '_pdbx_struct_sheet_hbond.range_2_auth_atom_id'  
8  2 'Structure model' '_pdbx_struct_sheet_hbond.range_2_auth_comp_id'  
9  2 'Structure model' '_pdbx_struct_sheet_hbond.range_2_auth_seq_id'   
10 2 'Structure model' '_pdbx_struct_sheet_hbond.range_2_label_atom_id' 
11 2 'Structure model' '_pdbx_struct_sheet_hbond.range_2_label_comp_id' 
12 2 'Structure model' '_pdbx_struct_sheet_hbond.range_2_label_seq_id'  
13 2 'Structure model' '_struct_conf.beg_auth_comp_id'                  
14 2 'Structure model' '_struct_conf.beg_auth_seq_id'                   
15 2 'Structure model' '_struct_conf.beg_label_comp_id'                 
16 2 'Structure model' '_struct_conf.beg_label_seq_id'                  
17 2 'Structure model' '_struct_conf.end_auth_comp_id'                  
18 2 'Structure model' '_struct_conf.end_auth_seq_id'                   
19 2 'Structure model' '_struct_conf.end_label_comp_id'                 
20 2 'Structure model' '_struct_conf.end_label_seq_id'                  
21 2 'Structure model' '_struct_conf.pdbx_PDB_helix_length'             
22 2 'Structure model' '_struct_sheet_range.beg_auth_comp_id'           
23 2 'Structure model' '_struct_sheet_range.beg_auth_seq_id'            
24 2 'Structure model' '_struct_sheet_range.beg_label_comp_id'          
25 2 'Structure model' '_struct_sheet_range.beg_label_seq_id'           
26 2 'Structure model' '_struct_sheet_range.end_auth_seq_id'            
27 2 'Structure model' '_struct_sheet_range.end_label_seq_id'           
28 3 'Structure model' '_citation.country'                              
29 3 'Structure model' '_citation.journal_abbrev'                       
30 3 'Structure model' '_citation.journal_id_CSD'                       
31 3 'Structure model' '_citation.journal_id_ISSN'                      
32 3 'Structure model' '_citation.journal_volume'                       
33 3 'Structure model' '_citation.page_first'                           
34 3 'Structure model' '_citation.page_last'                            
35 3 'Structure model' '_citation.pdbx_database_id_DOI'                 
36 3 'Structure model' '_citation.pdbx_database_id_PubMed'              
37 3 'Structure model' '_citation.title'                                
38 3 'Structure model' '_citation.year'                                 
39 3 'Structure model' '_citation_author.identifier_ORCID'              
40 3 'Structure model' '_citation_author.name'                          
41 4 'Structure model' '_database_2.pdbx_DOI'                           
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.entry_id                        7LDF 
_pdbx_database_status.recvd_initial_deposition_date   2021-01-13 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.details        
'High resolution NMR solution structure of a de novo designed minimal thioredoxin fold protein' 
_pdbx_database_related.db_id          30844 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_contact_author.id                 2 
_pdbx_contact_author.email              estrauch@uga.edu 
_pdbx_contact_author.name_first         Eva-Maria 
_pdbx_contact_author.name_last          Strauch 
_pdbx_contact_author.name_mi            ? 
_pdbx_contact_author.role               'principal investigator/group leader' 
_pdbx_contact_author.identifier_ORCID   0000-0001-7382-747X 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Urbauer, J.L.' 1 0000-0001-5722-6674 
'Strauch, E.M.' 2 0000-0001-7382-747X 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            13 
_citation.language                  ? 
_citation.page_first                7151 
_citation.page_last                 7151 
_citation.title                     'Sampling of structure and sequence space of small protein folds.' 
_citation.year                      2022 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41467-022-34937-8 
_citation.pdbx_database_id_PubMed   36418330 
_citation.pdbx_database_id_patent   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Linsky, T.W.'  1 ?                   
primary 'Noble, K.'     2 ?                   
primary 'Tobin, A.R.'   3 ?                   
primary 'Crow, R.'      4 0000-0001-5989-7930 
primary 'Carter, L.'    5 ?                   
primary 'Urbauer, J.L.' 6 0000-0001-5722-6674 
primary 'Baker, D.'     7 0000-0001-7896-6217 
primary 'Strauch, E.M.' 8 0000-0001-7382-747X 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Minimal thioredoxin fold protein, ems_thioM_802' 
_entity.formula_weight             8366.353 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       MDEVKVHVGDDQFEEVSREIKKAGWKVEVHKHPSNTSQVTVTKGNKQWTFKDPKQAVEFVQKSLEHHHHHH 
_entity_poly.pdbx_seq_one_letter_code_can   MDEVKVHVGDDQFEEVSREIKKAGWKVEVHKHPSNTSQVTVTKGNKQWTFKDPKQAVEFVQKSLEHHHHHH 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  ASP n 
1 3  GLU n 
1 4  VAL n 
1 5  LYS n 
1 6  VAL n 
1 7  HIS n 
1 8  VAL n 
1 9  GLY n 
1 10 ASP n 
1 11 ASP n 
1 12 GLN n 
1 13 PHE n 
1 14 GLU n 
1 15 GLU n 
1 16 VAL n 
1 17 SER n 
1 18 ARG n 
1 19 GLU n 
1 20 ILE n 
1 21 LYS n 
1 22 LYS n 
1 23 ALA n 
1 24 GLY n 
1 25 TRP n 
1 26 LYS n 
1 27 VAL n 
1 28 GLU n 
1 29 VAL n 
1 30 HIS n 
1 31 LYS n 
1 32 HIS n 
1 33 PRO n 
1 34 SER n 
1 35 ASN n 
1 36 THR n 
1 37 SER n 
1 38 GLN n 
1 39 VAL n 
1 40 THR n 
1 41 VAL n 
1 42 THR n 
1 43 LYS n 
1 44 GLY n 
1 45 ASN n 
1 46 LYS n 
1 47 GLN n 
1 48 TRP n 
1 49 THR n 
1 50 PHE n 
1 51 LYS n 
1 52 ASP n 
1 53 PRO n 
1 54 LYS n 
1 55 GLN n 
1 56 ALA n 
1 57 VAL n 
1 58 GLU n 
1 59 PHE n 
1 60 VAL n 
1 61 GLN n 
1 62 LYS n 
1 63 SER n 
1 64 LEU n 
1 65 GLU n 
1 66 HIS n 
1 67 HIS n 
1 68 HIS n 
1 69 HIS n 
1 70 HIS n 
1 71 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   71 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'synthetic construct' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     32630 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  1  1  MET MET A . n 
A 1 2  ASP 2  2  2  ASP ASP A . n 
A 1 3  GLU 3  3  3  GLU GLU A . n 
A 1 4  VAL 4  4  4  VAL VAL A . n 
A 1 5  LYS 5  5  5  LYS LYS A . n 
A 1 6  VAL 6  6  6  VAL VAL A . n 
A 1 7  HIS 7  7  7  HIS HIS A . n 
A 1 8  VAL 8  8  8  VAL VAL A . n 
A 1 9  GLY 9  9  9  GLY GLY A . n 
A 1 10 ASP 10 10 10 ASP ASP A . n 
A 1 11 ASP 11 11 11 ASP ASP A . n 
A 1 12 GLN 12 12 12 GLN GLN A . n 
A 1 13 PHE 13 13 13 PHE PHE A . n 
A 1 14 GLU 14 14 14 GLU GLU A . n 
A 1 15 GLU 15 15 15 GLU GLU A . n 
A 1 16 VAL 16 16 16 VAL VAL A . n 
A 1 17 SER 17 17 17 SER SER A . n 
A 1 18 ARG 18 18 18 ARG ARG A . n 
A 1 19 GLU 19 19 19 GLU GLU A . n 
A 1 20 ILE 20 20 20 ILE ILE A . n 
A 1 21 LYS 21 21 21 LYS LYS A . n 
A 1 22 LYS 22 22 22 LYS LYS A . n 
A 1 23 ALA 23 23 23 ALA ALA A . n 
A 1 24 GLY 24 24 24 GLY GLY A . n 
A 1 25 TRP 25 25 25 TRP TRP A . n 
A 1 26 LYS 26 26 26 LYS LYS A . n 
A 1 27 VAL 27 27 27 VAL VAL A . n 
A 1 28 GLU 28 28 28 GLU GLU A . n 
A 1 29 VAL 29 29 29 VAL VAL A . n 
A 1 30 HIS 30 30 30 HIS HIS A . n 
A 1 31 LYS 31 31 31 LYS LYS A . n 
A 1 32 HIS 32 32 32 HIS HIS A . n 
A 1 33 PRO 33 33 33 PRO PRO A . n 
A 1 34 SER 34 34 34 SER SER A . n 
A 1 35 ASN 35 35 35 ASN ASN A . n 
A 1 36 THR 36 36 36 THR THR A . n 
A 1 37 SER 37 37 37 SER SER A . n 
A 1 38 GLN 38 38 38 GLN GLN A . n 
A 1 39 VAL 39 39 39 VAL VAL A . n 
A 1 40 THR 40 40 40 THR THR A . n 
A 1 41 VAL 41 41 41 VAL VAL A . n 
A 1 42 THR 42 42 42 THR THR A . n 
A 1 43 LYS 43 43 43 LYS LYS A . n 
A 1 44 GLY 44 44 44 GLY GLY A . n 
A 1 45 ASN 45 45 45 ASN ASN A . n 
A 1 46 LYS 46 46 46 LYS LYS A . n 
A 1 47 GLN 47 47 47 GLN GLN A . n 
A 1 48 TRP 48 48 48 TRP TRP A . n 
A 1 49 THR 49 49 49 THR THR A . n 
A 1 50 PHE 50 50 50 PHE PHE A . n 
A 1 51 LYS 51 51 51 LYS LYS A . n 
A 1 52 ASP 52 52 52 ASP ASP A . n 
A 1 53 PRO 53 53 53 PRO PRO A . n 
A 1 54 LYS 54 54 54 LYS LYS A . n 
A 1 55 GLN 55 55 55 GLN GLN A . n 
A 1 56 ALA 56 56 56 ALA ALA A . n 
A 1 57 VAL 57 57 57 VAL VAL A . n 
A 1 58 GLU 58 58 58 GLU GLU A . n 
A 1 59 PHE 59 59 59 PHE PHE A . n 
A 1 60 VAL 60 60 60 VAL VAL A . n 
A 1 61 GLN 61 61 61 GLN GLN A . n 
A 1 62 LYS 62 62 62 LYS LYS A . n 
A 1 63 SER 63 63 63 SER SER A . n 
A 1 64 LEU 64 64 64 LEU LEU A . n 
A 1 65 GLU 65 65 65 GLU GLU A . n 
A 1 66 HIS 66 66 66 HIS HIS A . n 
A 1 67 HIS 67 67 67 HIS HIS A . n 
A 1 68 HIS 68 68 68 HIS HIS A . n 
A 1 69 HIS 69 69 69 HIS HIS A . n 
A 1 70 HIS 70 70 70 HIS HIS A . n 
A 1 71 HIS 71 71 71 HIS HIS A . n 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   7LDF 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                     7LDF 
_struct.title                        
'High resolution NMR solution structure of a de novo designed minimal thioredoxin fold protein' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        7LDF 
_struct_keywords.text            'de novo designed, DE NOVO PROTEIN' 
_struct_keywords.pdbx_keywords   'DE NOVO PROTEIN' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    PDB 
_struct_ref.db_code                    7LDF 
_struct_ref.pdbx_db_accession          7LDF 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           1 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              7LDF 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 71 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             7LDF 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  71 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       71 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'native gel electrophoresis' 
_pdbx_struct_assembly_auth_evidence.details                ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   ? 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 ASP A 10 ? ALA A 23 ? ASP A 10 ALA A 23 1 ? 14 
HELX_P HELX_P2 AA2 PRO A 53 ? GLU A 65 ? PRO A 53 GLU A 65 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               AA1 
_struct_sheet.type             ? 
_struct_sheet.number_strands   4 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LYS A 26 ? HIS A 32 ? LYS A 26 HIS A 32 
AA1 2 ASP A 2  ? VAL A 8  ? ASP A 2  VAL A 8  
AA1 3 SER A 37 ? LYS A 43 ? SER A 37 LYS A 43 
AA1 4 LYS A 46 ? PHE A 50 ? LYS A 46 PHE A 50 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O LYS A 26 ? O LYS A 26 N VAL A 4  ? N VAL A 4  
AA1 2 3 O HIS A 7  ? O HIS A 7  N GLN A 38 ? N GLN A 38 
AA1 3 4 N LYS A 43 ? N LYS A 43 O LYS A 46 ? O LYS A 46 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1  O A VAL 60 ? ? H A LEU 64 ? ? 1.55 
2  2  H A VAL 6  ? ? O A GLU 28 ? ? 1.60 
3  4  H A VAL 6  ? ? O A GLU 28 ? ? 1.60 
4  7  H A VAL 6  ? ? O A GLU 28 ? ? 1.59 
5  8  O A VAL 60 ? ? H A LEU 64 ? ? 1.57 
6  9  H A VAL 6  ? ? O A GLU 28 ? ? 1.60 
7  10 H A VAL 6  ? ? O A GLU 28 ? ? 1.59 
8  13 H A VAL 6  ? ? O A GLU 28 ? ? 1.59 
9  14 O A VAL 60 ? ? H A LEU 64 ? ? 1.59 
10 16 H A VAL 6  ? ? O A GLU 28 ? ? 1.58 
11 17 H A VAL 6  ? ? O A GLU 28 ? ? 1.60 
12 20 H A VAL 6  ? ? O A GLU 28 ? ? 1.58 
13 20 O A VAL 60 ? ? H A LEU 64 ? ? 1.59 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 2  SER A 37 ? ? -152.86 79.78  
2 6  HIS A 70 ? ? 70.74   -50.35 
3 11 ASP A 2  ? ? 67.57   -0.69  
4 14 HIS A 66 ? ? 60.39   120.38 
5 15 SER A 37 ? ? -156.06 77.67  
6 16 HIS A 66 ? ? 68.88   -54.39 
7 17 HIS A 66 ? ? 62.95   127.29 
8 19 HIS A 66 ? ? 62.51   127.86 
# 
loop_
_pdbx_database_remark.id 
_pdbx_database_remark.text 
650 
;HELIX 
DETERMINATION METHOD: AUTHOR 
;
700 
;SHEET 
DETERMINATION METHOD: AUTHOR 
;
# 
_pdbx_nmr_ensemble.entry_id                                      7LDF 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.representative_conformer                      ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             7LDF 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'10 mM sodium phosphate, 10 mM sodium chloride, 0.6 mM [U-98% 13C; U-98% 15N] ems_thioM_802 (protein), 95% H2O/5% D2O' 
_pdbx_nmr_sample_details.solvent_system   '95% H2O/5% D2O' 
_pdbx_nmr_sample_details.label            'NMR sample ems_thioM_802' 
_pdbx_nmr_sample_details.type             solution 
_pdbx_nmr_sample_details.details          'this is the only sample used for all of the NMR data' 
# 
loop_
_pdbx_nmr_exptl_sample.solution_id 
_pdbx_nmr_exptl_sample.component 
_pdbx_nmr_exptl_sample.concentration 
_pdbx_nmr_exptl_sample.concentration_range 
_pdbx_nmr_exptl_sample.concentration_units 
_pdbx_nmr_exptl_sample.isotopic_labeling 
1 'sodium phosphate'        10  ? mM 'natural abundance'      
1 'sodium chloride'         10  ? mM 'natural abundance'      
1 'ems_thioM_802 (protein)' 0.6 ? mM '[U-98% 13C; U-98% 15N]' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id          1 
_pdbx_nmr_exptl_sample_conditions.temperature            298 
_pdbx_nmr_exptl_sample_conditions.pressure_units         atm 
_pdbx_nmr_exptl_sample_conditions.pressure               1 
_pdbx_nmr_exptl_sample_conditions.pH                     6.8 
_pdbx_nmr_exptl_sample_conditions.ionic_strength         '10 mM' 
_pdbx_nmr_exptl_sample_conditions.details                'only one sample was used for all NMR experiments' 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_err     ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units   'Not defined' 
_pdbx_nmr_exptl_sample_conditions.label                  sample_conditions_1 
_pdbx_nmr_exptl_sample_conditions.pH_err                 ? 
_pdbx_nmr_exptl_sample_conditions.pH_units               pH 
_pdbx_nmr_exptl_sample_conditions.pressure_err           ? 
_pdbx_nmr_exptl_sample_conditions.temperature_err        ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units      K 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.spectrometer_id 
_pdbx_nmr_exptl.sample_state 
1  1 1 '2D 1H-15N HSQC'                     1 isotropic 
2  1 1 '2D 1H-13C HSQC'                     1 isotropic 
3  1 1 '2D 1H-13C HSQC aromatic'            1 isotropic 
4  1 1 '3D HNCA'                            1 isotropic 
5  1 1 '3D HN(CO)CA'                        1 isotropic 
6  1 1 '3D HNCACB'                          1 isotropic 
7  1 1 '3D CBCA(CO)NH'                      1 isotropic 
8  1 1 '3D HNCO'                            1 isotropic 
9  1 1 '3D HN(CA)CO'                        1 isotropic 
10 1 1 '3D HBHA(CO)NH'                      1 isotropic 
11 1 1 '3D HCCH-TOCSY'                      1 isotropic 
12 1 1 '3D HCCH-COSY'                       1 isotropic 
17 1 1 '3D C(CO)NH'                         1 isotropic 
16 1 1 '3D H(CCO)NH'                        1 isotropic 
15 1 1 '2D HBCBCGCDHD'                      1 isotropic 
14 1 1 '3D 1H-15N NOESY'                    1 isotropic 
13 1 1 '3D 1H-13C NOESY aliphatic'          1 isotropic 
18 1 1 '3D 1H-13C NOESY aromatic'           1 isotropic 
20 1 1 '3D 1H-TOCSY relayed ct 1H-13C HMQC' 1 isotropic 
# 
_pdbx_nmr_refine.entry_id           7LDF 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            
'the structures are based on a total of 1253 restraints, 1137 NOE-derived distance restraints and 116 dihedral angle restraints' 
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.ordinal 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
1 refinement                  CNS   1.3  'Brunger, Adams, Clore, Gros, Nilges and Read'             
2 'structure calculation'     CNS   ?    'Brunger, Adams, Clore, Gros, Nilges and Read'             
3 'structure calculation'     CYANA 2.1  'Guntert, Mumenthaler and Wuthrich'                        
4 'peak picking'              Felix 2007 'Accelrys Software Inc., now Felix NMR, Inc., Steve Unger' 
5 'chemical shift assignment' Felix 2007 'Accelrys Software Inc., now Felix NMR, Inc., Steve Unger' 
6 processing                  Felix 2007 'Accelrys Software Inc., now Felix NMR, Inc., Steve Unger' 
7 collection                  VnmrJ 4.2  'VnmrJ, Agilent'                                           
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
GLN N    N N N 74  
GLN CA   C N S 75  
GLN C    C N N 76  
GLN O    O N N 77  
GLN CB   C N N 78  
GLN CG   C N N 79  
GLN CD   C N N 80  
GLN OE1  O N N 81  
GLN NE2  N N N 82  
GLN OXT  O N N 83  
GLN H    H N N 84  
GLN H2   H N N 85  
GLN HA   H N N 86  
GLN HB2  H N N 87  
GLN HB3  H N N 88  
GLN HG2  H N N 89  
GLN HG3  H N N 90  
GLN HE21 H N N 91  
GLN HE22 H N N 92  
GLN HXT  H N N 93  
GLU N    N N N 94  
GLU CA   C N S 95  
GLU C    C N N 96  
GLU O    O N N 97  
GLU CB   C N N 98  
GLU CG   C N N 99  
GLU CD   C N N 100 
GLU OE1  O N N 101 
GLU OE2  O N N 102 
GLU OXT  O N N 103 
GLU H    H N N 104 
GLU H2   H N N 105 
GLU HA   H N N 106 
GLU HB2  H N N 107 
GLU HB3  H N N 108 
GLU HG2  H N N 109 
GLU HG3  H N N 110 
GLU HE2  H N N 111 
GLU HXT  H N N 112 
GLY N    N N N 113 
GLY CA   C N N 114 
GLY C    C N N 115 
GLY O    O N N 116 
GLY OXT  O N N 117 
GLY H    H N N 118 
GLY H2   H N N 119 
GLY HA2  H N N 120 
GLY HA3  H N N 121 
GLY HXT  H N N 122 
HIS N    N N N 123 
HIS CA   C N S 124 
HIS C    C N N 125 
HIS O    O N N 126 
HIS CB   C N N 127 
HIS CG   C Y N 128 
HIS ND1  N Y N 129 
HIS CD2  C Y N 130 
HIS CE1  C Y N 131 
HIS NE2  N Y N 132 
HIS OXT  O N N 133 
HIS H    H N N 134 
HIS H2   H N N 135 
HIS HA   H N N 136 
HIS HB2  H N N 137 
HIS HB3  H N N 138 
HIS HD1  H N N 139 
HIS HD2  H N N 140 
HIS HE1  H N N 141 
HIS HE2  H N N 142 
HIS HXT  H N N 143 
ILE N    N N N 144 
ILE CA   C N S 145 
ILE C    C N N 146 
ILE O    O N N 147 
ILE CB   C N S 148 
ILE CG1  C N N 149 
ILE CG2  C N N 150 
ILE CD1  C N N 151 
ILE OXT  O N N 152 
ILE H    H N N 153 
ILE H2   H N N 154 
ILE HA   H N N 155 
ILE HB   H N N 156 
ILE HG12 H N N 157 
ILE HG13 H N N 158 
ILE HG21 H N N 159 
ILE HG22 H N N 160 
ILE HG23 H N N 161 
ILE HD11 H N N 162 
ILE HD12 H N N 163 
ILE HD13 H N N 164 
ILE HXT  H N N 165 
LEU N    N N N 166 
LEU CA   C N S 167 
LEU C    C N N 168 
LEU O    O N N 169 
LEU CB   C N N 170 
LEU CG   C N N 171 
LEU CD1  C N N 172 
LEU CD2  C N N 173 
LEU OXT  O N N 174 
LEU H    H N N 175 
LEU H2   H N N 176 
LEU HA   H N N 177 
LEU HB2  H N N 178 
LEU HB3  H N N 179 
LEU HG   H N N 180 
LEU HD11 H N N 181 
LEU HD12 H N N 182 
LEU HD13 H N N 183 
LEU HD21 H N N 184 
LEU HD22 H N N 185 
LEU HD23 H N N 186 
LEU HXT  H N N 187 
LYS N    N N N 188 
LYS CA   C N S 189 
LYS C    C N N 190 
LYS O    O N N 191 
LYS CB   C N N 192 
LYS CG   C N N 193 
LYS CD   C N N 194 
LYS CE   C N N 195 
LYS NZ   N N N 196 
LYS OXT  O N N 197 
LYS H    H N N 198 
LYS H2   H N N 199 
LYS HA   H N N 200 
LYS HB2  H N N 201 
LYS HB3  H N N 202 
LYS HG2  H N N 203 
LYS HG3  H N N 204 
LYS HD2  H N N 205 
LYS HD3  H N N 206 
LYS HE2  H N N 207 
LYS HE3  H N N 208 
LYS HZ1  H N N 209 
LYS HZ2  H N N 210 
LYS HZ3  H N N 211 
LYS HXT  H N N 212 
MET N    N N N 213 
MET CA   C N S 214 
MET C    C N N 215 
MET O    O N N 216 
MET CB   C N N 217 
MET CG   C N N 218 
MET SD   S N N 219 
MET CE   C N N 220 
MET OXT  O N N 221 
MET H    H N N 222 
MET H2   H N N 223 
MET HA   H N N 224 
MET HB2  H N N 225 
MET HB3  H N N 226 
MET HG2  H N N 227 
MET HG3  H N N 228 
MET HE1  H N N 229 
MET HE2  H N N 230 
MET HE3  H N N 231 
MET HXT  H N N 232 
PHE N    N N N 233 
PHE CA   C N S 234 
PHE C    C N N 235 
PHE O    O N N 236 
PHE CB   C N N 237 
PHE CG   C Y N 238 
PHE CD1  C Y N 239 
PHE CD2  C Y N 240 
PHE CE1  C Y N 241 
PHE CE2  C Y N 242 
PHE CZ   C Y N 243 
PHE OXT  O N N 244 
PHE H    H N N 245 
PHE H2   H N N 246 
PHE HA   H N N 247 
PHE HB2  H N N 248 
PHE HB3  H N N 249 
PHE HD1  H N N 250 
PHE HD2  H N N 251 
PHE HE1  H N N 252 
PHE HE2  H N N 253 
PHE HZ   H N N 254 
PHE HXT  H N N 255 
PRO N    N N N 256 
PRO CA   C N S 257 
PRO C    C N N 258 
PRO O    O N N 259 
PRO CB   C N N 260 
PRO CG   C N N 261 
PRO CD   C N N 262 
PRO OXT  O N N 263 
PRO H    H N N 264 
PRO HA   H N N 265 
PRO HB2  H N N 266 
PRO HB3  H N N 267 
PRO HG2  H N N 268 
PRO HG3  H N N 269 
PRO HD2  H N N 270 
PRO HD3  H N N 271 
PRO HXT  H N N 272 
SER N    N N N 273 
SER CA   C N S 274 
SER C    C N N 275 
SER O    O N N 276 
SER CB   C N N 277 
SER OG   O N N 278 
SER OXT  O N N 279 
SER H    H N N 280 
SER H2   H N N 281 
SER HA   H N N 282 
SER HB2  H N N 283 
SER HB3  H N N 284 
SER HG   H N N 285 
SER HXT  H N N 286 
THR N    N N N 287 
THR CA   C N S 288 
THR C    C N N 289 
THR O    O N N 290 
THR CB   C N R 291 
THR OG1  O N N 292 
THR CG2  C N N 293 
THR OXT  O N N 294 
THR H    H N N 295 
THR H2   H N N 296 
THR HA   H N N 297 
THR HB   H N N 298 
THR HG1  H N N 299 
THR HG21 H N N 300 
THR HG22 H N N 301 
THR HG23 H N N 302 
THR HXT  H N N 303 
TRP N    N N N 304 
TRP CA   C N S 305 
TRP C    C N N 306 
TRP O    O N N 307 
TRP CB   C N N 308 
TRP CG   C Y N 309 
TRP CD1  C Y N 310 
TRP CD2  C Y N 311 
TRP NE1  N Y N 312 
TRP CE2  C Y N 313 
TRP CE3  C Y N 314 
TRP CZ2  C Y N 315 
TRP CZ3  C Y N 316 
TRP CH2  C Y N 317 
TRP OXT  O N N 318 
TRP H    H N N 319 
TRP H2   H N N 320 
TRP HA   H N N 321 
TRP HB2  H N N 322 
TRP HB3  H N N 323 
TRP HD1  H N N 324 
TRP HE1  H N N 325 
TRP HE3  H N N 326 
TRP HZ2  H N N 327 
TRP HZ3  H N N 328 
TRP HH2  H N N 329 
TRP HXT  H N N 330 
VAL N    N N N 331 
VAL CA   C N S 332 
VAL C    C N N 333 
VAL O    O N N 334 
VAL CB   C N N 335 
VAL CG1  C N N 336 
VAL CG2  C N N 337 
VAL OXT  O N N 338 
VAL H    H N N 339 
VAL H2   H N N 340 
VAL HA   H N N 341 
VAL HB   H N N 342 
VAL HG11 H N N 343 
VAL HG12 H N N 344 
VAL HG13 H N N 345 
VAL HG21 H N N 346 
VAL HG22 H N N 347 
VAL HG23 H N N 348 
VAL HXT  H N N 349 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
GLN N   CA   sing N N 70  
GLN N   H    sing N N 71  
GLN N   H2   sing N N 72  
GLN CA  C    sing N N 73  
GLN CA  CB   sing N N 74  
GLN CA  HA   sing N N 75  
GLN C   O    doub N N 76  
GLN C   OXT  sing N N 77  
GLN CB  CG   sing N N 78  
GLN CB  HB2  sing N N 79  
GLN CB  HB3  sing N N 80  
GLN CG  CD   sing N N 81  
GLN CG  HG2  sing N N 82  
GLN CG  HG3  sing N N 83  
GLN CD  OE1  doub N N 84  
GLN CD  NE2  sing N N 85  
GLN NE2 HE21 sing N N 86  
GLN NE2 HE22 sing N N 87  
GLN OXT HXT  sing N N 88  
GLU N   CA   sing N N 89  
GLU N   H    sing N N 90  
GLU N   H2   sing N N 91  
GLU CA  C    sing N N 92  
GLU CA  CB   sing N N 93  
GLU CA  HA   sing N N 94  
GLU C   O    doub N N 95  
GLU C   OXT  sing N N 96  
GLU CB  CG   sing N N 97  
GLU CB  HB2  sing N N 98  
GLU CB  HB3  sing N N 99  
GLU CG  CD   sing N N 100 
GLU CG  HG2  sing N N 101 
GLU CG  HG3  sing N N 102 
GLU CD  OE1  doub N N 103 
GLU CD  OE2  sing N N 104 
GLU OE2 HE2  sing N N 105 
GLU OXT HXT  sing N N 106 
GLY N   CA   sing N N 107 
GLY N   H    sing N N 108 
GLY N   H2   sing N N 109 
GLY CA  C    sing N N 110 
GLY CA  HA2  sing N N 111 
GLY CA  HA3  sing N N 112 
GLY C   O    doub N N 113 
GLY C   OXT  sing N N 114 
GLY OXT HXT  sing N N 115 
HIS N   CA   sing N N 116 
HIS N   H    sing N N 117 
HIS N   H2   sing N N 118 
HIS CA  C    sing N N 119 
HIS CA  CB   sing N N 120 
HIS CA  HA   sing N N 121 
HIS C   O    doub N N 122 
HIS C   OXT  sing N N 123 
HIS CB  CG   sing N N 124 
HIS CB  HB2  sing N N 125 
HIS CB  HB3  sing N N 126 
HIS CG  ND1  sing Y N 127 
HIS CG  CD2  doub Y N 128 
HIS ND1 CE1  doub Y N 129 
HIS ND1 HD1  sing N N 130 
HIS CD2 NE2  sing Y N 131 
HIS CD2 HD2  sing N N 132 
HIS CE1 NE2  sing Y N 133 
HIS CE1 HE1  sing N N 134 
HIS NE2 HE2  sing N N 135 
HIS OXT HXT  sing N N 136 
ILE N   CA   sing N N 137 
ILE N   H    sing N N 138 
ILE N   H2   sing N N 139 
ILE CA  C    sing N N 140 
ILE CA  CB   sing N N 141 
ILE CA  HA   sing N N 142 
ILE C   O    doub N N 143 
ILE C   OXT  sing N N 144 
ILE CB  CG1  sing N N 145 
ILE CB  CG2  sing N N 146 
ILE CB  HB   sing N N 147 
ILE CG1 CD1  sing N N 148 
ILE CG1 HG12 sing N N 149 
ILE CG1 HG13 sing N N 150 
ILE CG2 HG21 sing N N 151 
ILE CG2 HG22 sing N N 152 
ILE CG2 HG23 sing N N 153 
ILE CD1 HD11 sing N N 154 
ILE CD1 HD12 sing N N 155 
ILE CD1 HD13 sing N N 156 
ILE OXT HXT  sing N N 157 
LEU N   CA   sing N N 158 
LEU N   H    sing N N 159 
LEU N   H2   sing N N 160 
LEU CA  C    sing N N 161 
LEU CA  CB   sing N N 162 
LEU CA  HA   sing N N 163 
LEU C   O    doub N N 164 
LEU C   OXT  sing N N 165 
LEU CB  CG   sing N N 166 
LEU CB  HB2  sing N N 167 
LEU CB  HB3  sing N N 168 
LEU CG  CD1  sing N N 169 
LEU CG  CD2  sing N N 170 
LEU CG  HG   sing N N 171 
LEU CD1 HD11 sing N N 172 
LEU CD1 HD12 sing N N 173 
LEU CD1 HD13 sing N N 174 
LEU CD2 HD21 sing N N 175 
LEU CD2 HD22 sing N N 176 
LEU CD2 HD23 sing N N 177 
LEU OXT HXT  sing N N 178 
LYS N   CA   sing N N 179 
LYS N   H    sing N N 180 
LYS N   H2   sing N N 181 
LYS CA  C    sing N N 182 
LYS CA  CB   sing N N 183 
LYS CA  HA   sing N N 184 
LYS C   O    doub N N 185 
LYS C   OXT  sing N N 186 
LYS CB  CG   sing N N 187 
LYS CB  HB2  sing N N 188 
LYS CB  HB3  sing N N 189 
LYS CG  CD   sing N N 190 
LYS CG  HG2  sing N N 191 
LYS CG  HG3  sing N N 192 
LYS CD  CE   sing N N 193 
LYS CD  HD2  sing N N 194 
LYS CD  HD3  sing N N 195 
LYS CE  NZ   sing N N 196 
LYS CE  HE2  sing N N 197 
LYS CE  HE3  sing N N 198 
LYS NZ  HZ1  sing N N 199 
LYS NZ  HZ2  sing N N 200 
LYS NZ  HZ3  sing N N 201 
LYS OXT HXT  sing N N 202 
MET N   CA   sing N N 203 
MET N   H    sing N N 204 
MET N   H2   sing N N 205 
MET CA  C    sing N N 206 
MET CA  CB   sing N N 207 
MET CA  HA   sing N N 208 
MET C   O    doub N N 209 
MET C   OXT  sing N N 210 
MET CB  CG   sing N N 211 
MET CB  HB2  sing N N 212 
MET CB  HB3  sing N N 213 
MET CG  SD   sing N N 214 
MET CG  HG2  sing N N 215 
MET CG  HG3  sing N N 216 
MET SD  CE   sing N N 217 
MET CE  HE1  sing N N 218 
MET CE  HE2  sing N N 219 
MET CE  HE3  sing N N 220 
MET OXT HXT  sing N N 221 
PHE N   CA   sing N N 222 
PHE N   H    sing N N 223 
PHE N   H2   sing N N 224 
PHE CA  C    sing N N 225 
PHE CA  CB   sing N N 226 
PHE CA  HA   sing N N 227 
PHE C   O    doub N N 228 
PHE C   OXT  sing N N 229 
PHE CB  CG   sing N N 230 
PHE CB  HB2  sing N N 231 
PHE CB  HB3  sing N N 232 
PHE CG  CD1  doub Y N 233 
PHE CG  CD2  sing Y N 234 
PHE CD1 CE1  sing Y N 235 
PHE CD1 HD1  sing N N 236 
PHE CD2 CE2  doub Y N 237 
PHE CD2 HD2  sing N N 238 
PHE CE1 CZ   doub Y N 239 
PHE CE1 HE1  sing N N 240 
PHE CE2 CZ   sing Y N 241 
PHE CE2 HE2  sing N N 242 
PHE CZ  HZ   sing N N 243 
PHE OXT HXT  sing N N 244 
PRO N   CA   sing N N 245 
PRO N   CD   sing N N 246 
PRO N   H    sing N N 247 
PRO CA  C    sing N N 248 
PRO CA  CB   sing N N 249 
PRO CA  HA   sing N N 250 
PRO C   O    doub N N 251 
PRO C   OXT  sing N N 252 
PRO CB  CG   sing N N 253 
PRO CB  HB2  sing N N 254 
PRO CB  HB3  sing N N 255 
PRO CG  CD   sing N N 256 
PRO CG  HG2  sing N N 257 
PRO CG  HG3  sing N N 258 
PRO CD  HD2  sing N N 259 
PRO CD  HD3  sing N N 260 
PRO OXT HXT  sing N N 261 
SER N   CA   sing N N 262 
SER N   H    sing N N 263 
SER N   H2   sing N N 264 
SER CA  C    sing N N 265 
SER CA  CB   sing N N 266 
SER CA  HA   sing N N 267 
SER C   O    doub N N 268 
SER C   OXT  sing N N 269 
SER CB  OG   sing N N 270 
SER CB  HB2  sing N N 271 
SER CB  HB3  sing N N 272 
SER OG  HG   sing N N 273 
SER OXT HXT  sing N N 274 
THR N   CA   sing N N 275 
THR N   H    sing N N 276 
THR N   H2   sing N N 277 
THR CA  C    sing N N 278 
THR CA  CB   sing N N 279 
THR CA  HA   sing N N 280 
THR C   O    doub N N 281 
THR C   OXT  sing N N 282 
THR CB  OG1  sing N N 283 
THR CB  CG2  sing N N 284 
THR CB  HB   sing N N 285 
THR OG1 HG1  sing N N 286 
THR CG2 HG21 sing N N 287 
THR CG2 HG22 sing N N 288 
THR CG2 HG23 sing N N 289 
THR OXT HXT  sing N N 290 
TRP N   CA   sing N N 291 
TRP N   H    sing N N 292 
TRP N   H2   sing N N 293 
TRP CA  C    sing N N 294 
TRP CA  CB   sing N N 295 
TRP CA  HA   sing N N 296 
TRP C   O    doub N N 297 
TRP C   OXT  sing N N 298 
TRP CB  CG   sing N N 299 
TRP CB  HB2  sing N N 300 
TRP CB  HB3  sing N N 301 
TRP CG  CD1  doub Y N 302 
TRP CG  CD2  sing Y N 303 
TRP CD1 NE1  sing Y N 304 
TRP CD1 HD1  sing N N 305 
TRP CD2 CE2  doub Y N 306 
TRP CD2 CE3  sing Y N 307 
TRP NE1 CE2  sing Y N 308 
TRP NE1 HE1  sing N N 309 
TRP CE2 CZ2  sing Y N 310 
TRP CE3 CZ3  doub Y N 311 
TRP CE3 HE3  sing N N 312 
TRP CZ2 CH2  doub Y N 313 
TRP CZ2 HZ2  sing N N 314 
TRP CZ3 CH2  sing Y N 315 
TRP CZ3 HZ3  sing N N 316 
TRP CH2 HH2  sing N N 317 
TRP OXT HXT  sing N N 318 
VAL N   CA   sing N N 319 
VAL N   H    sing N N 320 
VAL N   H2   sing N N 321 
VAL CA  C    sing N N 322 
VAL CA  CB   sing N N 323 
VAL CA  HA   sing N N 324 
VAL C   O    doub N N 325 
VAL C   OXT  sing N N 326 
VAL CB  CG1  sing N N 327 
VAL CB  CG2  sing N N 328 
VAL CB  HB   sing N N 329 
VAL CG1 HG11 sing N N 330 
VAL CG1 HG12 sing N N 331 
VAL CG1 HG13 sing N N 332 
VAL CG2 HG21 sing N N 333 
VAL CG2 HG22 sing N N 334 
VAL CG2 HG23 sing N N 335 
VAL OXT HXT  sing N N 336 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' R01AI140245 1 
'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' R21AI143399 2 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             DD2 
_pdbx_nmr_spectrometer.type              ? 
_pdbx_nmr_spectrometer.manufacturer      Agilent 
_pdbx_nmr_spectrometer.field_strength    600 
_pdbx_nmr_spectrometer.details           ? 
# 
_atom_sites.entry_id                    7LDF 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_