data_7N1K # _entry.id 7N1K # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.389 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7N1K pdb_00007n1k 10.2210/pdb7n1k/pdb WWPDB D_1000257157 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-04-06 2 'Structure model' 1 1 2022-05-18 3 'Structure model' 1 2 2022-05-25 4 'Structure model' 1 3 2024-04-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.title' 2 3 'Structure model' '_citation.journal_volume' 3 3 'Structure model' '_citation.page_first' 4 3 'Structure model' '_citation.page_last' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7N1K _pdbx_database_status.recvd_initial_deposition_date 2021-05-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name PDB _pdbx_database_related.details . _pdbx_database_related.db_id 7N1J _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email s.lee@yale.edu _pdbx_contact_author.name_first Sangwon _pdbx_contact_author.name_last Lee _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-9441-6546 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Park, J.S.' 1 0000-0002-1575-1849 'Lee, S.' 2 0000-0002-9441-6546 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Nature _citation.journal_id_ASTM NATUAS _citation.journal_id_CSD 0006 _citation.journal_id_ISSN 1476-4687 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 605 _citation.language ? _citation.page_first 551 _citation.page_last 560 _citation.title 'Design of protein-binding proteins from the target structure alone.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41586-022-04654-9 _citation.pdbx_database_id_PubMed 35332283 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Cao, L.' 1 ? primary 'Coventry, B.' 2 ? primary 'Goreshnik, I.' 3 ? primary 'Huang, B.' 4 ? primary 'Sheffler, W.' 5 ? primary 'Park, J.S.' 6 0000-0002-1575-1849 primary 'Jude, K.M.' 7 0000-0002-3675-5136 primary 'Markovic, I.' 8 ? primary 'Kadam, R.U.' 9 ? primary 'Verschueren, K.H.G.' 10 ? primary 'Verstraete, K.' 11 ? primary 'Walsh, S.T.R.' 12 ? primary 'Bennett, N.' 13 ? primary 'Phal, A.' 14 0000-0001-8405-4150 primary 'Yang, A.' 15 0000-0002-8704-0288 primary 'Kozodoy, L.' 16 ? primary 'DeWitt, M.' 17 ? primary 'Picton, L.' 18 0000-0002-0482-5187 primary 'Miller, L.' 19 ? primary 'Strauch, E.M.' 20 0000-0001-7382-747X primary 'DeBouver, N.D.' 21 0000-0003-2545-6007 primary 'Pires, A.' 22 ? primary 'Bera, A.K.' 23 0000-0001-9473-2912 primary 'Halabiya, S.' 24 ? primary 'Hammerson, B.' 25 ? primary 'Yang, W.' 26 ? primary 'Bernard, S.' 27 ? primary 'Stewart, L.' 28 0000-0003-4264-5125 primary 'Wilson, I.A.' 29 0000-0002-6469-2419 primary 'Ruohola-Baker, H.' 30 0000-0002-5588-4531 primary 'Schlessinger, J.' 31 0000-0002-5085-5969 primary 'Lee, S.' 32 ? primary 'Savvides, S.N.' 33 0000-0003-3420-5947 primary 'Garcia, K.C.' 34 0000-0001-9273-0278 primary 'Baker, D.' 35 0000-0001-7896-6217 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Binder _entity.formula_weight 7535.809 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GGGDRRKEMDKVYRTAFKRITSTPDKEKRKEVVKEATEQLRRIAKDEEEKKKAAYMILFLKTLG _entity_poly.pdbx_seq_one_letter_code_can GGGDRRKEMDKVYRTAFKRITSTPDKEKRKEVVKEATEQLRRIAKDEEEKKKAAYMILFLKTLG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 GLY n 1 3 GLY n 1 4 ASP n 1 5 ARG n 1 6 ARG n 1 7 LYS n 1 8 GLU n 1 9 MET n 1 10 ASP n 1 11 LYS n 1 12 VAL n 1 13 TYR n 1 14 ARG n 1 15 THR n 1 16 ALA n 1 17 PHE n 1 18 LYS n 1 19 ARG n 1 20 ILE n 1 21 THR n 1 22 SER n 1 23 THR n 1 24 PRO n 1 25 ASP n 1 26 LYS n 1 27 GLU n 1 28 LYS n 1 29 ARG n 1 30 LYS n 1 31 GLU n 1 32 VAL n 1 33 VAL n 1 34 LYS n 1 35 GLU n 1 36 ALA n 1 37 THR n 1 38 GLU n 1 39 GLN n 1 40 LEU n 1 41 ARG n 1 42 ARG n 1 43 ILE n 1 44 ALA n 1 45 LYS n 1 46 ASP n 1 47 GLU n 1 48 GLU n 1 49 GLU n 1 50 LYS n 1 51 LYS n 1 52 LYS n 1 53 ALA n 1 54 ALA n 1 55 TYR n 1 56 MET n 1 57 ILE n 1 58 LEU n 1 59 PHE n 1 60 LEU n 1 61 LYS n 1 62 THR n 1 63 LEU n 1 64 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 64 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 ? ? ? A . n A 1 2 GLY 2 -1 ? ? ? A . n A 1 3 GLY 3 0 ? ? ? A . n A 1 4 ASP 4 1 1 ASP ASP A . n A 1 5 ARG 5 2 2 ARG ARG A . n A 1 6 ARG 6 3 3 ARG ARG A . n A 1 7 LYS 7 4 4 LYS LYS A . n A 1 8 GLU 8 5 5 GLU GLU A . n A 1 9 MET 9 6 6 MET MET A . n A 1 10 ASP 10 7 7 ASP ASP A . n A 1 11 LYS 11 8 8 LYS LYS A . n A 1 12 VAL 12 9 9 VAL VAL A . n A 1 13 TYR 13 10 10 TYR TYR A . n A 1 14 ARG 14 11 11 ARG ARG A . n A 1 15 THR 15 12 12 THR THR A . n A 1 16 ALA 16 13 13 ALA ALA A . n A 1 17 PHE 17 14 14 PHE PHE A . n A 1 18 LYS 18 15 15 LYS LYS A . n A 1 19 ARG 19 16 16 ARG ARG A . n A 1 20 ILE 20 17 17 ILE ILE A . n A 1 21 THR 21 18 18 THR THR A . n A 1 22 SER 22 19 19 SER SER A . n A 1 23 THR 23 20 20 THR THR A . n A 1 24 PRO 24 21 21 PRO PRO A . n A 1 25 ASP 25 22 22 ASP ASP A . n A 1 26 LYS 26 23 23 LYS LYS A . n A 1 27 GLU 27 24 24 GLU GLU A . n A 1 28 LYS 28 25 25 LYS LYS A . n A 1 29 ARG 29 26 26 ARG ARG A . n A 1 30 LYS 30 27 27 LYS LYS A . n A 1 31 GLU 31 28 28 GLU GLU A . n A 1 32 VAL 32 29 29 VAL VAL A . n A 1 33 VAL 33 30 30 VAL VAL A . n A 1 34 LYS 34 31 31 LYS LYS A . n A 1 35 GLU 35 32 32 GLU GLU A . n A 1 36 ALA 36 33 33 ALA ALA A . n A 1 37 THR 37 34 34 THR THR A . n A 1 38 GLU 38 35 35 GLU GLU A . n A 1 39 GLN 39 36 36 GLN GLN A . n A 1 40 LEU 40 37 37 LEU LEU A . n A 1 41 ARG 41 38 38 ARG ARG A . n A 1 42 ARG 42 39 39 ARG ARG A . n A 1 43 ILE 43 40 40 ILE ILE A . n A 1 44 ALA 44 41 41 ALA ALA A . n A 1 45 LYS 45 42 42 LYS LYS A . n A 1 46 ASP 46 43 43 ASP ASP A . n A 1 47 GLU 47 44 44 GLU GLU A . n A 1 48 GLU 48 45 45 GLU GLU A . n A 1 49 GLU 49 46 46 GLU GLU A . n A 1 50 LYS 50 47 47 LYS LYS A . n A 1 51 LYS 51 48 48 LYS LYS A . n A 1 52 LYS 52 49 49 LYS LYS A . n A 1 53 ALA 53 50 50 ALA ALA A . n A 1 54 ALA 54 51 51 ALA ALA A . n A 1 55 TYR 55 52 52 TYR TYR A . n A 1 56 MET 56 53 53 MET MET A . n A 1 57 ILE 57 54 54 ILE ILE A . n A 1 58 LEU 58 55 55 LEU LEU A . n A 1 59 PHE 59 56 56 PHE PHE A . n A 1 60 LEU 60 57 57 LEU LEU A . n A 1 61 LYS 61 58 58 LYS LYS A . n A 1 62 THR 62 59 59 THR THR A . n A 1 63 LEU 63 60 60 LEU LEU A . n A 1 64 GLY 64 61 ? ? ? A . n # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASP 1 ? CG ? A ASP 4 CG 2 1 Y 1 A ASP 1 ? OD1 ? A ASP 4 OD1 3 1 Y 1 A ASP 1 ? OD2 ? A ASP 4 OD2 4 1 Y 1 A ARG 2 ? CG ? A ARG 5 CG 5 1 Y 1 A ARG 2 ? CD ? A ARG 5 CD 6 1 Y 1 A ARG 2 ? NE ? A ARG 5 NE 7 1 Y 1 A ARG 2 ? CZ ? A ARG 5 CZ 8 1 Y 1 A ARG 2 ? NH1 ? A ARG 5 NH1 9 1 Y 1 A ARG 2 ? NH2 ? A ARG 5 NH2 10 1 Y 1 A ARG 3 ? CG ? A ARG 6 CG 11 1 Y 1 A ARG 3 ? CD ? A ARG 6 CD 12 1 Y 1 A ARG 3 ? NE ? A ARG 6 NE 13 1 Y 1 A ARG 3 ? CZ ? A ARG 6 CZ 14 1 Y 1 A ARG 3 ? NH1 ? A ARG 6 NH1 15 1 Y 1 A ARG 3 ? NH2 ? A ARG 6 NH2 16 1 Y 1 A LYS 4 ? CG ? A LYS 7 CG 17 1 Y 1 A LYS 4 ? CD ? A LYS 7 CD 18 1 Y 1 A LYS 4 ? CE ? A LYS 7 CE 19 1 Y 1 A LYS 4 ? NZ ? A LYS 7 NZ 20 1 Y 1 A GLU 5 ? CG ? A GLU 8 CG 21 1 Y 1 A GLU 5 ? CD ? A GLU 8 CD 22 1 Y 1 A GLU 5 ? OE1 ? A GLU 8 OE1 23 1 Y 1 A GLU 5 ? OE2 ? A GLU 8 OE2 24 1 Y 1 A ASP 7 ? CG ? A ASP 10 CG 25 1 Y 1 A ASP 7 ? OD1 ? A ASP 10 OD1 26 1 Y 1 A ASP 7 ? OD2 ? A ASP 10 OD2 27 1 Y 1 A LYS 8 ? CG ? A LYS 11 CG 28 1 Y 1 A LYS 8 ? CD ? A LYS 11 CD 29 1 Y 1 A LYS 8 ? CE ? A LYS 11 CE 30 1 Y 1 A LYS 8 ? NZ ? A LYS 11 NZ 31 1 Y 1 A ARG 11 ? CG ? A ARG 14 CG 32 1 Y 1 A ARG 11 ? CD ? A ARG 14 CD 33 1 Y 1 A ARG 11 ? NE ? A ARG 14 NE 34 1 Y 1 A ARG 11 ? CZ ? A ARG 14 CZ 35 1 Y 1 A ARG 11 ? NH1 ? A ARG 14 NH1 36 1 Y 1 A ARG 11 ? NH2 ? A ARG 14 NH2 37 1 Y 1 A LYS 15 ? CG ? A LYS 18 CG 38 1 Y 1 A LYS 15 ? CD ? A LYS 18 CD 39 1 Y 1 A LYS 15 ? CE ? A LYS 18 CE 40 1 Y 1 A LYS 15 ? NZ ? A LYS 18 NZ 41 1 Y 1 A ARG 16 ? CG ? A ARG 19 CG 42 1 Y 1 A ARG 16 ? CD ? A ARG 19 CD 43 1 Y 1 A ARG 16 ? NE ? A ARG 19 NE 44 1 Y 1 A ARG 16 ? CZ ? A ARG 19 CZ 45 1 Y 1 A ARG 16 ? NH1 ? A ARG 19 NH1 46 1 Y 1 A ARG 16 ? NH2 ? A ARG 19 NH2 47 1 Y 1 A THR 18 ? OG1 ? A THR 21 OG1 48 1 Y 1 A THR 18 ? CG2 ? A THR 21 CG2 49 1 Y 1 A ASP 22 ? CG ? A ASP 25 CG 50 1 Y 1 A ASP 22 ? OD1 ? A ASP 25 OD1 51 1 Y 1 A ASP 22 ? OD2 ? A ASP 25 OD2 52 1 Y 1 A LYS 23 ? CG ? A LYS 26 CG 53 1 Y 1 A LYS 23 ? CD ? A LYS 26 CD 54 1 Y 1 A LYS 23 ? CE ? A LYS 26 CE 55 1 Y 1 A LYS 23 ? NZ ? A LYS 26 NZ 56 1 Y 1 A GLU 24 ? CG ? A GLU 27 CG 57 1 Y 1 A GLU 24 ? CD ? A GLU 27 CD 58 1 Y 1 A GLU 24 ? OE1 ? A GLU 27 OE1 59 1 Y 1 A GLU 24 ? OE2 ? A GLU 27 OE2 60 1 Y 1 A LYS 25 ? CG ? A LYS 28 CG 61 1 Y 1 A LYS 25 ? CD ? A LYS 28 CD 62 1 Y 1 A LYS 25 ? CE ? A LYS 28 CE 63 1 Y 1 A LYS 25 ? NZ ? A LYS 28 NZ 64 1 Y 1 A LYS 27 ? CG ? A LYS 30 CG 65 1 Y 1 A LYS 27 ? CD ? A LYS 30 CD 66 1 Y 1 A LYS 27 ? CE ? A LYS 30 CE 67 1 Y 1 A LYS 27 ? NZ ? A LYS 30 NZ 68 1 Y 1 A GLU 28 ? CG ? A GLU 31 CG 69 1 Y 1 A GLU 28 ? CD ? A GLU 31 CD 70 1 Y 1 A GLU 28 ? OE1 ? A GLU 31 OE1 71 1 Y 1 A GLU 28 ? OE2 ? A GLU 31 OE2 72 1 Y 1 A LYS 31 ? CG ? A LYS 34 CG 73 1 Y 1 A LYS 31 ? CD ? A LYS 34 CD 74 1 Y 1 A LYS 31 ? CE ? A LYS 34 CE 75 1 Y 1 A LYS 31 ? NZ ? A LYS 34 NZ 76 1 Y 1 A GLU 32 ? CG ? A GLU 35 CG 77 1 Y 1 A GLU 32 ? CD ? A GLU 35 CD 78 1 Y 1 A GLU 32 ? OE1 ? A GLU 35 OE1 79 1 Y 1 A GLU 32 ? OE2 ? A GLU 35 OE2 80 1 Y 1 A GLU 35 ? CG ? A GLU 38 CG 81 1 Y 1 A GLU 35 ? CD ? A GLU 38 CD 82 1 Y 1 A GLU 35 ? OE1 ? A GLU 38 OE1 83 1 Y 1 A GLU 35 ? OE2 ? A GLU 38 OE2 84 1 Y 1 A GLN 36 ? CG ? A GLN 39 CG 85 1 Y 1 A GLN 36 ? CD ? A GLN 39 CD 86 1 Y 1 A GLN 36 ? OE1 ? A GLN 39 OE1 87 1 Y 1 A GLN 36 ? NE2 ? A GLN 39 NE2 88 1 Y 1 A ARG 38 ? CG ? A ARG 41 CG 89 1 Y 1 A ARG 38 ? CD ? A ARG 41 CD 90 1 Y 1 A ARG 38 ? NE ? A ARG 41 NE 91 1 Y 1 A ARG 38 ? CZ ? A ARG 41 CZ 92 1 Y 1 A ARG 38 ? NH1 ? A ARG 41 NH1 93 1 Y 1 A ARG 38 ? NH2 ? A ARG 41 NH2 94 1 Y 1 A ARG 39 ? CG ? A ARG 42 CG 95 1 Y 1 A ARG 39 ? CD ? A ARG 42 CD 96 1 Y 1 A ARG 39 ? NE ? A ARG 42 NE 97 1 Y 1 A ARG 39 ? CZ ? A ARG 42 CZ 98 1 Y 1 A ARG 39 ? NH1 ? A ARG 42 NH1 99 1 Y 1 A ARG 39 ? NH2 ? A ARG 42 NH2 100 1 Y 1 A ILE 40 ? CG1 ? A ILE 43 CG1 101 1 Y 1 A ILE 40 ? CG2 ? A ILE 43 CG2 102 1 Y 1 A ILE 40 ? CD1 ? A ILE 43 CD1 103 1 Y 1 A LYS 42 ? CG ? A LYS 45 CG 104 1 Y 1 A LYS 42 ? CD ? A LYS 45 CD 105 1 Y 1 A LYS 42 ? CE ? A LYS 45 CE 106 1 Y 1 A LYS 42 ? NZ ? A LYS 45 NZ 107 1 Y 1 A ASP 43 ? CG ? A ASP 46 CG 108 1 Y 1 A ASP 43 ? OD1 ? A ASP 46 OD1 109 1 Y 1 A ASP 43 ? OD2 ? A ASP 46 OD2 110 1 Y 1 A GLU 44 ? CG ? A GLU 47 CG 111 1 Y 1 A GLU 44 ? CD ? A GLU 47 CD 112 1 Y 1 A GLU 44 ? OE1 ? A GLU 47 OE1 113 1 Y 1 A GLU 44 ? OE2 ? A GLU 47 OE2 114 1 Y 1 A GLU 45 ? CG ? A GLU 48 CG 115 1 Y 1 A GLU 45 ? CD ? A GLU 48 CD 116 1 Y 1 A GLU 45 ? OE1 ? A GLU 48 OE1 117 1 Y 1 A GLU 45 ? OE2 ? A GLU 48 OE2 118 1 Y 1 A LYS 47 ? CG ? A LYS 50 CG 119 1 Y 1 A LYS 47 ? CD ? A LYS 50 CD 120 1 Y 1 A LYS 47 ? CE ? A LYS 50 CE 121 1 Y 1 A LYS 47 ? NZ ? A LYS 50 NZ 122 1 Y 1 A LYS 49 ? CG ? A LYS 52 CG 123 1 Y 1 A LYS 49 ? CD ? A LYS 52 CD 124 1 Y 1 A LYS 49 ? CE ? A LYS 52 CE 125 1 Y 1 A LYS 49 ? NZ ? A LYS 52 NZ 126 1 Y 1 A LYS 58 ? CG ? A LYS 61 CG 127 1 Y 1 A LYS 58 ? CD ? A LYS 61 CD 128 1 Y 1 A LYS 58 ? CE ? A LYS 61 CE 129 1 Y 1 A LYS 58 ? NZ ? A LYS 61 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.2_4158 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7N1K _cell.details ? _cell.formula_units_Z ? _cell.length_a 42.482 _cell.length_a_esd ? _cell.length_b 42.482 _cell.length_b_esd ? _cell.length_c 83.143 _cell.length_c_esd ? _cell.volume 150049.862 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7N1K _symmetry.cell_setting ? _symmetry.Int_Tables_number 95 _symmetry.space_group_name_Hall 'P 4cw 2c' _symmetry.space_group_name_H-M 'P 43 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7N1K _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.49 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 50.58 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 295.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;1,6-hexanediol, 1-butanol, 1,2-propanediol, 2-propanol, 1,4-butanediol, 1,3-Propanediol, Tris-BICINE (pH 8.5), MPD, PEG 1000, PEG 3350 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-02-12 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979180 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-E' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.979180 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-E _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7N1K _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.01 _reflns.d_resolution_low 50.0 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 1644 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 93.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.5 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 17.85 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 3.01 _reflns_shell.d_res_low 3.19 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 247 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.990 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 64.05 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7N1K _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.01 _refine.ls_d_res_low 42.48 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 1619 _refine.ls_number_reflns_R_free 81 _refine.ls_number_reflns_R_work 1538 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 93.42 _refine.ls_percent_reflns_R_free 5.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2724 _refine.ls_R_factor_R_free 0.2983 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2714 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.42 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'PREDICTED MODEL' _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 24.1369 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.0000 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 3.01 _refine_hist.d_res_low 42.48 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 381 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 381 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0025 ? 385 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.3688 ? 530 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0323 ? 73 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0053 ? 66 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 2.9056 ? 62 ? f_dihedral_angle_d ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 3.01 _refine_ls_shell.d_res_low 42.48 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 81 _refine_ls_shell.number_reflns_R_work 1538 _refine_ls_shell.percent_reflns_obs 93.42 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2983 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.2714 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7N1K _struct.title 'Crystal structure of a de novo-designed mini-protein targeting FGFR' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7N1K _struct_keywords.text 'Binder, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 7N1K _struct_ref.pdbx_db_accession 7N1K _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7N1K _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 64 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 7N1K _struct_ref_seq.db_align_beg -2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 61 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -2 _struct_ref_seq.pdbx_auth_seq_align_end 61 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 4 ? SER A 22 ? ASP A 1 SER A 19 1 ? 19 HELX_P HELX_P2 AA2 ASP A 25 ? ALA A 44 ? ASP A 22 ALA A 41 1 ? 20 HELX_P HELX_P3 AA3 ASP A 46 ? THR A 62 ? ASP A 43 THR A 59 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x,z+3/4 3 y,-x,z+1/4 4 x,-y,-z+1/2 5 -x,y,-z 6 -x,-y,z+1/2 7 y,x,-z+1/4 8 -y,-x,-z+3/4 # _pdbx_entry_details.entry_id 7N1K _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -2 ? A GLY 1 2 1 Y 1 A GLY -1 ? A GLY 2 3 1 Y 1 A GLY 0 ? A GLY 3 4 1 Y 1 A GLY 61 ? A GLY 64 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 GLN N N N N 57 GLN CA C N S 58 GLN C C N N 59 GLN O O N N 60 GLN CB C N N 61 GLN CG C N N 62 GLN CD C N N 63 GLN OE1 O N N 64 GLN NE2 N N N 65 GLN OXT O N N 66 GLN H H N N 67 GLN H2 H N N 68 GLN HA H N N 69 GLN HB2 H N N 70 GLN HB3 H N N 71 GLN HG2 H N N 72 GLN HG3 H N N 73 GLN HE21 H N N 74 GLN HE22 H N N 75 GLN HXT H N N 76 GLU N N N N 77 GLU CA C N S 78 GLU C C N N 79 GLU O O N N 80 GLU CB C N N 81 GLU CG C N N 82 GLU CD C N N 83 GLU OE1 O N N 84 GLU OE2 O N N 85 GLU OXT O N N 86 GLU H H N N 87 GLU H2 H N N 88 GLU HA H N N 89 GLU HB2 H N N 90 GLU HB3 H N N 91 GLU HG2 H N N 92 GLU HG3 H N N 93 GLU HE2 H N N 94 GLU HXT H N N 95 GLY N N N N 96 GLY CA C N N 97 GLY C C N N 98 GLY O O N N 99 GLY OXT O N N 100 GLY H H N N 101 GLY H2 H N N 102 GLY HA2 H N N 103 GLY HA3 H N N 104 GLY HXT H N N 105 ILE N N N N 106 ILE CA C N S 107 ILE C C N N 108 ILE O O N N 109 ILE CB C N S 110 ILE CG1 C N N 111 ILE CG2 C N N 112 ILE CD1 C N N 113 ILE OXT O N N 114 ILE H H N N 115 ILE H2 H N N 116 ILE HA H N N 117 ILE HB H N N 118 ILE HG12 H N N 119 ILE HG13 H N N 120 ILE HG21 H N N 121 ILE HG22 H N N 122 ILE HG23 H N N 123 ILE HD11 H N N 124 ILE HD12 H N N 125 ILE HD13 H N N 126 ILE HXT H N N 127 LEU N N N N 128 LEU CA C N S 129 LEU C C N N 130 LEU O O N N 131 LEU CB C N N 132 LEU CG C N N 133 LEU CD1 C N N 134 LEU CD2 C N N 135 LEU OXT O N N 136 LEU H H N N 137 LEU H2 H N N 138 LEU HA H N N 139 LEU HB2 H N N 140 LEU HB3 H N N 141 LEU HG H N N 142 LEU HD11 H N N 143 LEU HD12 H N N 144 LEU HD13 H N N 145 LEU HD21 H N N 146 LEU HD22 H N N 147 LEU HD23 H N N 148 LEU HXT H N N 149 LYS N N N N 150 LYS CA C N S 151 LYS C C N N 152 LYS O O N N 153 LYS CB C N N 154 LYS CG C N N 155 LYS CD C N N 156 LYS CE C N N 157 LYS NZ N N N 158 LYS OXT O N N 159 LYS H H N N 160 LYS H2 H N N 161 LYS HA H N N 162 LYS HB2 H N N 163 LYS HB3 H N N 164 LYS HG2 H N N 165 LYS HG3 H N N 166 LYS HD2 H N N 167 LYS HD3 H N N 168 LYS HE2 H N N 169 LYS HE3 H N N 170 LYS HZ1 H N N 171 LYS HZ2 H N N 172 LYS HZ3 H N N 173 LYS HXT H N N 174 MET N N N N 175 MET CA C N S 176 MET C C N N 177 MET O O N N 178 MET CB C N N 179 MET CG C N N 180 MET SD S N N 181 MET CE C N N 182 MET OXT O N N 183 MET H H N N 184 MET H2 H N N 185 MET HA H N N 186 MET HB2 H N N 187 MET HB3 H N N 188 MET HG2 H N N 189 MET HG3 H N N 190 MET HE1 H N N 191 MET HE2 H N N 192 MET HE3 H N N 193 MET HXT H N N 194 PHE N N N N 195 PHE CA C N S 196 PHE C C N N 197 PHE O O N N 198 PHE CB C N N 199 PHE CG C Y N 200 PHE CD1 C Y N 201 PHE CD2 C Y N 202 PHE CE1 C Y N 203 PHE CE2 C Y N 204 PHE CZ C Y N 205 PHE OXT O N N 206 PHE H H N N 207 PHE H2 H N N 208 PHE HA H N N 209 PHE HB2 H N N 210 PHE HB3 H N N 211 PHE HD1 H N N 212 PHE HD2 H N N 213 PHE HE1 H N N 214 PHE HE2 H N N 215 PHE HZ H N N 216 PHE HXT H N N 217 PRO N N N N 218 PRO CA C N S 219 PRO C C N N 220 PRO O O N N 221 PRO CB C N N 222 PRO CG C N N 223 PRO CD C N N 224 PRO OXT O N N 225 PRO H H N N 226 PRO HA H N N 227 PRO HB2 H N N 228 PRO HB3 H N N 229 PRO HG2 H N N 230 PRO HG3 H N N 231 PRO HD2 H N N 232 PRO HD3 H N N 233 PRO HXT H N N 234 SER N N N N 235 SER CA C N S 236 SER C C N N 237 SER O O N N 238 SER CB C N N 239 SER OG O N N 240 SER OXT O N N 241 SER H H N N 242 SER H2 H N N 243 SER HA H N N 244 SER HB2 H N N 245 SER HB3 H N N 246 SER HG H N N 247 SER HXT H N N 248 THR N N N N 249 THR CA C N S 250 THR C C N N 251 THR O O N N 252 THR CB C N R 253 THR OG1 O N N 254 THR CG2 C N N 255 THR OXT O N N 256 THR H H N N 257 THR H2 H N N 258 THR HA H N N 259 THR HB H N N 260 THR HG1 H N N 261 THR HG21 H N N 262 THR HG22 H N N 263 THR HG23 H N N 264 THR HXT H N N 265 TYR N N N N 266 TYR CA C N S 267 TYR C C N N 268 TYR O O N N 269 TYR CB C N N 270 TYR CG C Y N 271 TYR CD1 C Y N 272 TYR CD2 C Y N 273 TYR CE1 C Y N 274 TYR CE2 C Y N 275 TYR CZ C Y N 276 TYR OH O N N 277 TYR OXT O N N 278 TYR H H N N 279 TYR H2 H N N 280 TYR HA H N N 281 TYR HB2 H N N 282 TYR HB3 H N N 283 TYR HD1 H N N 284 TYR HD2 H N N 285 TYR HE1 H N N 286 TYR HE2 H N N 287 TYR HH H N N 288 TYR HXT H N N 289 VAL N N N N 290 VAL CA C N S 291 VAL C C N N 292 VAL O O N N 293 VAL CB C N N 294 VAL CG1 C N N 295 VAL CG2 C N N 296 VAL OXT O N N 297 VAL H H N N 298 VAL H2 H N N 299 VAL HA H N N 300 VAL HB H N N 301 VAL HG11 H N N 302 VAL HG12 H N N 303 VAL HG13 H N N 304 VAL HG21 H N N 305 VAL HG22 H N N 306 VAL HG23 H N N 307 VAL HXT H N N 308 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 GLN N CA sing N N 54 GLN N H sing N N 55 GLN N H2 sing N N 56 GLN CA C sing N N 57 GLN CA CB sing N N 58 GLN CA HA sing N N 59 GLN C O doub N N 60 GLN C OXT sing N N 61 GLN CB CG sing N N 62 GLN CB HB2 sing N N 63 GLN CB HB3 sing N N 64 GLN CG CD sing N N 65 GLN CG HG2 sing N N 66 GLN CG HG3 sing N N 67 GLN CD OE1 doub N N 68 GLN CD NE2 sing N N 69 GLN NE2 HE21 sing N N 70 GLN NE2 HE22 sing N N 71 GLN OXT HXT sing N N 72 GLU N CA sing N N 73 GLU N H sing N N 74 GLU N H2 sing N N 75 GLU CA C sing N N 76 GLU CA CB sing N N 77 GLU CA HA sing N N 78 GLU C O doub N N 79 GLU C OXT sing N N 80 GLU CB CG sing N N 81 GLU CB HB2 sing N N 82 GLU CB HB3 sing N N 83 GLU CG CD sing N N 84 GLU CG HG2 sing N N 85 GLU CG HG3 sing N N 86 GLU CD OE1 doub N N 87 GLU CD OE2 sing N N 88 GLU OE2 HE2 sing N N 89 GLU OXT HXT sing N N 90 GLY N CA sing N N 91 GLY N H sing N N 92 GLY N H2 sing N N 93 GLY CA C sing N N 94 GLY CA HA2 sing N N 95 GLY CA HA3 sing N N 96 GLY C O doub N N 97 GLY C OXT sing N N 98 GLY OXT HXT sing N N 99 ILE N CA sing N N 100 ILE N H sing N N 101 ILE N H2 sing N N 102 ILE CA C sing N N 103 ILE CA CB sing N N 104 ILE CA HA sing N N 105 ILE C O doub N N 106 ILE C OXT sing N N 107 ILE CB CG1 sing N N 108 ILE CB CG2 sing N N 109 ILE CB HB sing N N 110 ILE CG1 CD1 sing N N 111 ILE CG1 HG12 sing N N 112 ILE CG1 HG13 sing N N 113 ILE CG2 HG21 sing N N 114 ILE CG2 HG22 sing N N 115 ILE CG2 HG23 sing N N 116 ILE CD1 HD11 sing N N 117 ILE CD1 HD12 sing N N 118 ILE CD1 HD13 sing N N 119 ILE OXT HXT sing N N 120 LEU N CA sing N N 121 LEU N H sing N N 122 LEU N H2 sing N N 123 LEU CA C sing N N 124 LEU CA CB sing N N 125 LEU CA HA sing N N 126 LEU C O doub N N 127 LEU C OXT sing N N 128 LEU CB CG sing N N 129 LEU CB HB2 sing N N 130 LEU CB HB3 sing N N 131 LEU CG CD1 sing N N 132 LEU CG CD2 sing N N 133 LEU CG HG sing N N 134 LEU CD1 HD11 sing N N 135 LEU CD1 HD12 sing N N 136 LEU CD1 HD13 sing N N 137 LEU CD2 HD21 sing N N 138 LEU CD2 HD22 sing N N 139 LEU CD2 HD23 sing N N 140 LEU OXT HXT sing N N 141 LYS N CA sing N N 142 LYS N H sing N N 143 LYS N H2 sing N N 144 LYS CA C sing N N 145 LYS CA CB sing N N 146 LYS CA HA sing N N 147 LYS C O doub N N 148 LYS C OXT sing N N 149 LYS CB CG sing N N 150 LYS CB HB2 sing N N 151 LYS CB HB3 sing N N 152 LYS CG CD sing N N 153 LYS CG HG2 sing N N 154 LYS CG HG3 sing N N 155 LYS CD CE sing N N 156 LYS CD HD2 sing N N 157 LYS CD HD3 sing N N 158 LYS CE NZ sing N N 159 LYS CE HE2 sing N N 160 LYS CE HE3 sing N N 161 LYS NZ HZ1 sing N N 162 LYS NZ HZ2 sing N N 163 LYS NZ HZ3 sing N N 164 LYS OXT HXT sing N N 165 MET N CA sing N N 166 MET N H sing N N 167 MET N H2 sing N N 168 MET CA C sing N N 169 MET CA CB sing N N 170 MET CA HA sing N N 171 MET C O doub N N 172 MET C OXT sing N N 173 MET CB CG sing N N 174 MET CB HB2 sing N N 175 MET CB HB3 sing N N 176 MET CG SD sing N N 177 MET CG HG2 sing N N 178 MET CG HG3 sing N N 179 MET SD CE sing N N 180 MET CE HE1 sing N N 181 MET CE HE2 sing N N 182 MET CE HE3 sing N N 183 MET OXT HXT sing N N 184 PHE N CA sing N N 185 PHE N H sing N N 186 PHE N H2 sing N N 187 PHE CA C sing N N 188 PHE CA CB sing N N 189 PHE CA HA sing N N 190 PHE C O doub N N 191 PHE C OXT sing N N 192 PHE CB CG sing N N 193 PHE CB HB2 sing N N 194 PHE CB HB3 sing N N 195 PHE CG CD1 doub Y N 196 PHE CG CD2 sing Y N 197 PHE CD1 CE1 sing Y N 198 PHE CD1 HD1 sing N N 199 PHE CD2 CE2 doub Y N 200 PHE CD2 HD2 sing N N 201 PHE CE1 CZ doub Y N 202 PHE CE1 HE1 sing N N 203 PHE CE2 CZ sing Y N 204 PHE CE2 HE2 sing N N 205 PHE CZ HZ sing N N 206 PHE OXT HXT sing N N 207 PRO N CA sing N N 208 PRO N CD sing N N 209 PRO N H sing N N 210 PRO CA C sing N N 211 PRO CA CB sing N N 212 PRO CA HA sing N N 213 PRO C O doub N N 214 PRO C OXT sing N N 215 PRO CB CG sing N N 216 PRO CB HB2 sing N N 217 PRO CB HB3 sing N N 218 PRO CG CD sing N N 219 PRO CG HG2 sing N N 220 PRO CG HG3 sing N N 221 PRO CD HD2 sing N N 222 PRO CD HD3 sing N N 223 PRO OXT HXT sing N N 224 SER N CA sing N N 225 SER N H sing N N 226 SER N H2 sing N N 227 SER CA C sing N N 228 SER CA CB sing N N 229 SER CA HA sing N N 230 SER C O doub N N 231 SER C OXT sing N N 232 SER CB OG sing N N 233 SER CB HB2 sing N N 234 SER CB HB3 sing N N 235 SER OG HG sing N N 236 SER OXT HXT sing N N 237 THR N CA sing N N 238 THR N H sing N N 239 THR N H2 sing N N 240 THR CA C sing N N 241 THR CA CB sing N N 242 THR CA HA sing N N 243 THR C O doub N N 244 THR C OXT sing N N 245 THR CB OG1 sing N N 246 THR CB CG2 sing N N 247 THR CB HB sing N N 248 THR OG1 HG1 sing N N 249 THR CG2 HG21 sing N N 250 THR CG2 HG22 sing N N 251 THR CG2 HG23 sing N N 252 THR OXT HXT sing N N 253 TYR N CA sing N N 254 TYR N H sing N N 255 TYR N H2 sing N N 256 TYR CA C sing N N 257 TYR CA CB sing N N 258 TYR CA HA sing N N 259 TYR C O doub N N 260 TYR C OXT sing N N 261 TYR CB CG sing N N 262 TYR CB HB2 sing N N 263 TYR CB HB3 sing N N 264 TYR CG CD1 doub Y N 265 TYR CG CD2 sing Y N 266 TYR CD1 CE1 sing Y N 267 TYR CD1 HD1 sing N N 268 TYR CD2 CE2 doub Y N 269 TYR CD2 HD2 sing N N 270 TYR CE1 CZ doub Y N 271 TYR CE1 HE1 sing N N 272 TYR CE2 CZ sing Y N 273 TYR CE2 HE2 sing N N 274 TYR CZ OH sing N N 275 TYR OH HH sing N N 276 TYR OXT HXT sing N N 277 VAL N CA sing N N 278 VAL N H sing N N 279 VAL N H2 sing N N 280 VAL CA C sing N N 281 VAL CA CB sing N N 282 VAL CA HA sing N N 283 VAL C O doub N N 284 VAL C OXT sing N N 285 VAL CB CG1 sing N N 286 VAL CB CG2 sing N N 287 VAL CB HB sing N N 288 VAL CG1 HG11 sing N N 289 VAL CG1 HG12 sing N N 290 VAL CG1 HG13 sing N N 291 VAL CG2 HG21 sing N N 292 VAL CG2 HG22 sing N N 293 VAL CG2 HG23 sing N N 294 VAL OXT HXT sing N N 295 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.details 'PREDICTED MODEL' # _space_group.name_H-M_alt 'P 43 2 2' _space_group.name_Hall 'P 4cw 2c' _space_group.IT_number 95 _space_group.crystal_system tetragonal _space_group.id 1 # _atom_sites.entry_id 7N1K _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.023539 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.023539 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012027 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_