data_7N41 # _entry.id 7N41 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7N41 pdb_00007n41 10.2210/pdb7n41/pdb WWPDB D_1000257303 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7N41 _pdbx_database_status.recvd_initial_deposition_date 2021-06-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Martinez, O.E.' 1 ? 'Cascio, D.' 2 ? 'Clubb, R.T.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Biol.Chem. _citation.journal_id_ASTM JBCHA3 _citation.journal_id_CSD 0071 _citation.journal_id_ISSN 1083-351X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 298 _citation.language ? _citation.page_first 101464 _citation.page_last 101464 _citation.title 'Insight into the molecular basis of substrate recognition by the wall teichoic acid glycosyltransferase TagA.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jbc.2021.101464 _citation.pdbx_database_id_PubMed 34864059 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Martinez, O.E.' 1 ? primary 'Mahoney, B.J.' 2 ? primary 'Goring, A.K.' 3 ? primary 'Yi, S.W.' 4 ? primary 'Tran, D.P.' 5 ? primary 'Cascio, D.' 6 ? primary 'Phillips, M.L.' 7 ? primary 'Muthana, M.M.' 8 ? primary 'Chen, X.' 9 ? primary 'Jung, M.E.' 10 ? primary 'Loo, J.A.' 11 ? primary 'Clubb, R.T.' 12 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7N41 _cell.details ? _cell.formula_units_Z ? _cell.length_a 113.640 _cell.length_a_esd ? _cell.length_b 113.640 _cell.length_b_esd ? _cell.length_c 118.550 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 18 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7N41 _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase' 27906.801 3 2.4.1.187 'C111A, I203E, L209Q, L212K, I216E' TagA ? 2 non-polymer syn ;(2R,3S,4R,5S,6R)-3-acetamido-4,5-dihydroxy-6-(hydroxymethyl)oxan-2-yl [(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxyoxolan-2-yl]methyl dihydrogen diphosphate (non-preferred name) ; 607.354 3 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;N-acetylmannosaminyltransferase,UDP-N-acetylmannosamine transferase,UDP-N-acetylmannosamine:N-acetylglucosaminyl pyrophosphorylundecaprenol N-acetylmannosaminyltransferase ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MERLDIFGVPIDRVTMIQAVDILNNFLQENRLHIVATPNAEIVMMAQKDKEYMEILNNTDLNVPDGSGIVFASKVFKKPL PERVAGFDLMLEFIKGISSKGVKIYLLGAAAQVAEQARANLEKLYPGVKIVGTHHGYFTEEEENKIIEEINNKGAEVLFV ALGAPKQEKWIYKNKDKLKVKIAMGVGGSFDVIAGKVKRAPYEYRKLGQEWKYRLEKEPWRYKRMMALPKFAIKVLLHKR EVVR ; _entity_poly.pdbx_seq_one_letter_code_can ;MERLDIFGVPIDRVTMIQAVDILNNFLQENRLHIVATPNAEIVMMAQKDKEYMEILNNTDLNVPDGSGIVFASKVFKKPL PERVAGFDLMLEFIKGISSKGVKIYLLGAAAQVAEQARANLEKLYPGVKIVGTHHGYFTEEEENKIIEEINNKGAEVLFV ALGAPKQEKWIYKNKDKLKVKIAMGVGGSFDVIAGKVKRAPYEYRKLGQEWKYRLEKEPWRYKRMMALPKFAIKVLLHKR EVVR ; _entity_poly.pdbx_strand_id A,B,C _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 ARG n 1 4 LEU n 1 5 ASP n 1 6 ILE n 1 7 PHE n 1 8 GLY n 1 9 VAL n 1 10 PRO n 1 11 ILE n 1 12 ASP n 1 13 ARG n 1 14 VAL n 1 15 THR n 1 16 MET n 1 17 ILE n 1 18 GLN n 1 19 ALA n 1 20 VAL n 1 21 ASP n 1 22 ILE n 1 23 LEU n 1 24 ASN n 1 25 ASN n 1 26 PHE n 1 27 LEU n 1 28 GLN n 1 29 GLU n 1 30 ASN n 1 31 ARG n 1 32 LEU n 1 33 HIS n 1 34 ILE n 1 35 VAL n 1 36 ALA n 1 37 THR n 1 38 PRO n 1 39 ASN n 1 40 ALA n 1 41 GLU n 1 42 ILE n 1 43 VAL n 1 44 MET n 1 45 MET n 1 46 ALA n 1 47 GLN n 1 48 LYS n 1 49 ASP n 1 50 LYS n 1 51 GLU n 1 52 TYR n 1 53 MET n 1 54 GLU n 1 55 ILE n 1 56 LEU n 1 57 ASN n 1 58 ASN n 1 59 THR n 1 60 ASP n 1 61 LEU n 1 62 ASN n 1 63 VAL n 1 64 PRO n 1 65 ASP n 1 66 GLY n 1 67 SER n 1 68 GLY n 1 69 ILE n 1 70 VAL n 1 71 PHE n 1 72 ALA n 1 73 SER n 1 74 LYS n 1 75 VAL n 1 76 PHE n 1 77 LYS n 1 78 LYS n 1 79 PRO n 1 80 LEU n 1 81 PRO n 1 82 GLU n 1 83 ARG n 1 84 VAL n 1 85 ALA n 1 86 GLY n 1 87 PHE n 1 88 ASP n 1 89 LEU n 1 90 MET n 1 91 LEU n 1 92 GLU n 1 93 PHE n 1 94 ILE n 1 95 LYS n 1 96 GLY n 1 97 ILE n 1 98 SER n 1 99 SER n 1 100 LYS n 1 101 GLY n 1 102 VAL n 1 103 LYS n 1 104 ILE n 1 105 TYR n 1 106 LEU n 1 107 LEU n 1 108 GLY n 1 109 ALA n 1 110 ALA n 1 111 ALA n 1 112 GLN n 1 113 VAL n 1 114 ALA n 1 115 GLU n 1 116 GLN n 1 117 ALA n 1 118 ARG n 1 119 ALA n 1 120 ASN n 1 121 LEU n 1 122 GLU n 1 123 LYS n 1 124 LEU n 1 125 TYR n 1 126 PRO n 1 127 GLY n 1 128 VAL n 1 129 LYS n 1 130 ILE n 1 131 VAL n 1 132 GLY n 1 133 THR n 1 134 HIS n 1 135 HIS n 1 136 GLY n 1 137 TYR n 1 138 PHE n 1 139 THR n 1 140 GLU n 1 141 GLU n 1 142 GLU n 1 143 GLU n 1 144 ASN n 1 145 LYS n 1 146 ILE n 1 147 ILE n 1 148 GLU n 1 149 GLU n 1 150 ILE n 1 151 ASN n 1 152 ASN n 1 153 LYS n 1 154 GLY n 1 155 ALA n 1 156 GLU n 1 157 VAL n 1 158 LEU n 1 159 PHE n 1 160 VAL n 1 161 ALA n 1 162 LEU n 1 163 GLY n 1 164 ALA n 1 165 PRO n 1 166 LYS n 1 167 GLN n 1 168 GLU n 1 169 LYS n 1 170 TRP n 1 171 ILE n 1 172 TYR n 1 173 LYS n 1 174 ASN n 1 175 LYS n 1 176 ASP n 1 177 LYS n 1 178 LEU n 1 179 LYS n 1 180 VAL n 1 181 LYS n 1 182 ILE n 1 183 ALA n 1 184 MET n 1 185 GLY n 1 186 VAL n 1 187 GLY n 1 188 GLY n 1 189 SER n 1 190 PHE n 1 191 ASP n 1 192 VAL n 1 193 ILE n 1 194 ALA n 1 195 GLY n 1 196 LYS n 1 197 VAL n 1 198 LYS n 1 199 ARG n 1 200 ALA n 1 201 PRO n 1 202 TYR n 1 203 GLU n 1 204 TYR n 1 205 ARG n 1 206 LYS n 1 207 LEU n 1 208 GLY n 1 209 GLN n 1 210 GLU n 1 211 TRP n 1 212 LYS n 1 213 TYR n 1 214 ARG n 1 215 LEU n 1 216 GLU n 1 217 LYS n 1 218 GLU n 1 219 PRO n 1 220 TRP n 1 221 ARG n 1 222 TYR n 1 223 LYS n 1 224 ARG n 1 225 MET n 1 226 MET n 1 227 ALA n 1 228 LEU n 1 229 PRO n 1 230 LYS n 1 231 PHE n 1 232 ALA n 1 233 ILE n 1 234 LYS n 1 235 VAL n 1 236 LEU n 1 237 LEU n 1 238 HIS n 1 239 LYS n 1 240 ARG n 1 241 GLU n 1 242 VAL n 1 243 VAL n 1 244 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 244 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Thit_1850 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'DSM 9252 / Ab9' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermoanaerobacter italicus (strain DSM 9252 / Ab9)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 580331 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pMAPLe4 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code D3T4E0_THEIA _struct_ref.pdbx_db_accession D3T4E0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MERLDIFGVPIDRVTMIQAVDILNNFLQENRLHIVATPNAEIVMMAQKDKEYMEILNNTDLNVPDGSGIVFASKVFKKPL PERVAGFDLMLEFIKGISSKGVKIYLLGAACQVAEQARANLEKLYPGVKIVGTHHGYFTEEEENKIIEEINNKGAEVLFV ALGAPKQEKWIYKNKDKLKVKIAMGVGGSFDVIAGKVKRAPYIYRKLGLEWLYRLIKEPWRYKRMMALPKFAIKVLLHKR EVVR ; _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7N41 A 1 ? 244 ? D3T4E0 1 ? 244 ? 1 244 2 1 7N41 B 1 ? 244 ? D3T4E0 1 ? 244 ? 1 244 3 1 7N41 C 1 ? 244 ? D3T4E0 1 ? 244 ? 1 244 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7N41 ALA A 111 ? UNP D3T4E0 CYS 111 'engineered mutation' 111 1 1 7N41 GLU A 203 ? UNP D3T4E0 ILE 203 'engineered mutation' 203 2 1 7N41 GLN A 209 ? UNP D3T4E0 LEU 209 'engineered mutation' 209 3 1 7N41 LYS A 212 ? UNP D3T4E0 LEU 212 'engineered mutation' 212 4 1 7N41 GLU A 216 ? UNP D3T4E0 ILE 216 'engineered mutation' 216 5 2 7N41 ALA B 111 ? UNP D3T4E0 CYS 111 'engineered mutation' 111 6 2 7N41 GLU B 203 ? UNP D3T4E0 ILE 203 'engineered mutation' 203 7 2 7N41 GLN B 209 ? UNP D3T4E0 LEU 209 'engineered mutation' 209 8 2 7N41 LYS B 212 ? UNP D3T4E0 LEU 212 'engineered mutation' 212 9 2 7N41 GLU B 216 ? UNP D3T4E0 ILE 216 'engineered mutation' 216 10 3 7N41 ALA C 111 ? UNP D3T4E0 CYS 111 'engineered mutation' 111 11 3 7N41 GLU C 203 ? UNP D3T4E0 ILE 203 'engineered mutation' 203 12 3 7N41 GLN C 209 ? UNP D3T4E0 LEU 209 'engineered mutation' 209 13 3 7N41 LYS C 212 ? UNP D3T4E0 LEU 212 'engineered mutation' 212 14 3 7N41 GLU C 216 ? UNP D3T4E0 ILE 216 'engineered mutation' 216 15 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 UD9 non-polymer . ;(2R,3S,4R,5S,6R)-3-acetamido-4,5-dihydroxy-6-(hydroxymethyl)oxan-2-yl [(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxyoxolan-2-yl]methyl dihydrogen diphosphate (non-preferred name) ; UDP-N-acetyl-alpha-D-mannosamine 'C17 H27 N3 O17 P2' 607.354 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7N41 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.64 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 53.40 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '10% PEG-8000, 20% ethylene glycol, 0.05M Tris, 0.04 Potassium phosphate monobasic' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-04-16 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9791 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-C' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9791 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-C _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 84.290 _reflns.entry_id 7N41 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.300 _reflns.d_resolution_low 98.420 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13697 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.366 _reflns.pdbx_Rmerge_I_obs 0.074 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14.740 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.911 _reflns.pdbx_scaling_rejects 1 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.080 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 100887 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 3.300 3.390 ? 1.470 ? 7227 1002 ? 1000 99.800 ? ? ? ? 1.196 ? ? ? ? ? ? ? ? 7.227 ? ? ? ? 1.288 ? ? 1 1 0.648 ? ? ? ? ? ? ? ? ? ? 3.390 3.480 ? 2.190 ? 7112 966 ? 965 99.900 ? ? ? ? 0.858 ? ? ? ? ? ? ? ? 7.370 ? ? ? ? 0.923 ? ? 2 1 0.768 ? ? ? ? ? ? ? ? ? ? 3.480 3.580 ? 2.980 ? 6401 952 ? 950 99.800 ? ? ? ? 0.610 ? ? ? ? ? ? ? ? 6.738 ? ? ? ? 0.662 ? ? 3 1 0.847 ? ? ? ? ? ? ? ? ? ? 3.580 3.690 ? 3.570 ? 5906 908 ? 907 99.900 ? ? ? ? 0.490 ? ? ? ? ? ? ? ? 6.512 ? ? ? ? 0.534 ? ? 4 1 0.903 ? ? ? ? ? ? ? ? ? ? 3.690 3.810 ? 5.640 ? 6905 907 ? 907 100.000 ? ? ? ? 0.341 ? ? ? ? ? ? ? ? 7.613 ? ? ? ? 0.365 ? ? 5 1 0.958 ? ? ? ? ? ? ? ? ? ? 3.810 3.940 ? 7.700 ? 6902 863 ? 863 100.000 ? ? ? ? 0.259 ? ? ? ? ? ? ? ? 7.998 ? ? ? ? 0.277 ? ? 6 1 0.976 ? ? ? ? ? ? ? ? ? ? 3.940 4.090 ? 9.970 ? 6607 825 ? 825 100.000 ? ? ? ? 0.191 ? ? ? ? ? ? ? ? 8.008 ? ? ? ? 0.204 ? ? 7 1 0.987 ? ? ? ? ? ? ? ? ? ? 4.090 4.260 ? 13.370 ? 6375 800 ? 800 100.000 ? ? ? ? 0.137 ? ? ? ? ? ? ? ? 7.969 ? ? ? ? 0.147 ? ? 8 1 0.993 ? ? ? ? ? ? ? ? ? ? 4.260 4.450 ? 15.950 ? 6085 776 ? 775 99.900 ? ? ? ? 0.120 ? ? ? ? ? ? ? ? 7.852 ? ? ? ? 0.128 ? ? 9 1 0.994 ? ? ? ? ? ? ? ? ? ? 4.450 4.670 ? 19.310 ? 5663 741 ? 741 100.000 ? ? ? ? 0.097 ? ? ? ? ? ? ? ? 7.642 ? ? ? ? 0.104 ? ? 10 1 0.995 ? ? ? ? ? ? ? ? ? ? 4.670 4.920 ? 21.150 ? 5312 710 ? 710 100.000 ? ? ? ? 0.088 ? ? ? ? ? ? ? ? 7.482 ? ? ? ? 0.095 ? ? 11 1 0.995 ? ? ? ? ? ? ? ? ? ? 4.920 5.220 ? 21.800 ? 5143 678 ? 678 100.000 ? ? ? ? 0.087 ? ? ? ? ? ? ? ? 7.586 ? ? ? ? 0.093 ? ? 12 1 0.996 ? ? ? ? ? ? ? ? ? ? 5.220 5.580 ? 21.500 ? 4698 627 ? 627 100.000 ? ? ? ? 0.084 ? ? ? ? ? ? ? ? 7.493 ? ? ? ? 0.090 ? ? 13 1 0.995 ? ? ? ? ? ? ? ? ? ? 5.580 6.030 ? 22.770 ? 4370 597 ? 596 99.800 ? ? ? ? 0.075 ? ? ? ? ? ? ? ? 7.332 ? ? ? ? 0.081 ? ? 14 1 0.997 ? ? ? ? ? ? ? ? ? ? 6.030 6.600 ? 24.930 ? 3780 552 ? 552 100.000 ? ? ? ? 0.063 ? ? ? ? ? ? ? ? 6.848 ? ? ? ? 0.068 ? ? 15 1 0.996 ? ? ? ? ? ? ? ? ? ? 6.600 7.380 ? 27.950 ? 2919 490 ? 483 98.600 ? ? ? ? 0.052 ? ? ? ? ? ? ? ? 6.043 ? ? ? ? 0.057 ? ? 16 1 0.997 ? ? ? ? ? ? ? ? ? ? 7.380 8.520 ? 36.090 ? 3346 450 ? 450 100.000 ? ? ? ? 0.045 ? ? ? ? ? ? ? ? 7.436 ? ? ? ? 0.048 ? ? 17 1 0.998 ? ? ? ? ? ? ? ? ? ? 8.520 10.440 ? 39.870 ? 2843 381 ? 381 100.000 ? ? ? ? 0.040 ? ? ? ? ? ? ? ? 7.462 ? ? ? ? 0.042 ? ? 18 1 0.999 ? ? ? ? ? ? ? ? ? ? 10.440 14.760 ? 39.920 ? 2122 305 ? 305 100.000 ? ? ? ? 0.037 ? ? ? ? ? ? ? ? 6.957 ? ? ? ? 0.040 ? ? 19 1 0.999 ? ? ? ? ? ? ? ? ? ? 14.760 98.420 ? 39.110 ? 1171 184 ? 182 98.900 ? ? ? ? 0.033 ? ? ? ? ? ? ? ? 6.434 ? ? ? ? 0.037 ? ? 20 1 0.998 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 187.300 _refine.B_iso_mean 87.8769 _refine.B_iso_min 26.290 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7N41 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.3000 _refine.ls_d_res_low 98.4200 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13694 _refine.ls_number_reflns_R_free 681 _refine.ls_number_reflns_R_work 13013 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.8500 _refine.ls_percent_reflns_R_free 4.9700 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1976 _refine.ls_R_factor_R_free 0.2537 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1946 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.360 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 7MPK _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 27.1300 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4500 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 3.3000 _refine_hist.d_res_low 98.4200 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 4612 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 589 _refine_hist.pdbx_B_iso_mean_ligand 101.72 _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 4456 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 156 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.pdbx_weight _refine_ls_restr_ncs.pdbx_ens_id 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 1 TORSIONAL ? A 1749 3.838 ? 1 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 2 TORSIONAL ? B 1749 3.838 ? 1 'X-RAY DIFFRACTION' 3 ? ? ? ? ? 3 TORSIONAL ? C 1749 3.838 ? 1 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 3.3000 3.5600 2699 . 147 2552 100.0000 . . . 0.3178 0.0000 0.2550 . . . . . . . 5 . . . 'X-RAY DIFFRACTION' 3.5600 3.9100 2693 . 141 2552 100.0000 . . . 0.2699 0.0000 0.2126 . . . . . . . 5 . . . 'X-RAY DIFFRACTION' 3.9100 4.4800 2703 . 118 2585 100.0000 . . . 0.2759 0.0000 0.1782 . . . . . . . 5 . . . 'X-RAY DIFFRACTION' 4.4800 5.6400 2751 . 123 2628 100.0000 . . . 0.2650 0.0000 0.1865 . . . . . . . 5 . . . 'X-RAY DIFFRACTION' 5.6400 98.4200 2848 . 152 2696 100.0000 . . . 0.2147 0.0000 0.1839 . . . . . . . 5 . . . # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 ;(chain A and (resid 2 through 28 or (resid 29 and (name N or name CA or name C or name O or name CB )) or resid 30 through 49 or (resid 50 and (name N or name CA or name C or name O or name CB )) or resid 51 through 76 or (resid 77 and (name N or name CA or name C or name O or name CB )) or resid 78 through 96 or (resid 97 and (name N or name CA or name C or name O )) or resid 98 through 102 or (resid 103 and (name N or name CA or name C or name O or name CB )) or resid 104 through 114 or (resid 115 through 119 and (name N or name CA or name C or name O or name CB )) or resid 120 or (resid 121 through 125 and (name N or name CA or name C or name O or name CB )) or resid 126 through 127 or (resid 128 and (name N or name CA or name C or name O )) or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 147 or (resid 148 and (name N or name CA or name C or name O or name CB )) or resid 149 through 155 or (resid 156 and (name N or name CA or name C or name O )) or resid 157 or (resid 158 and (name N or name CA or name C or name O )) or resid 159 through 165 or (resid 166 and (name N or name CA or name C or name O or name CB )) or resid 167 through 195)) ; 1 2 ;(chain B and (resid 2 through 28 or (resid 29 and (name N or name CA or name C or name O or name CB )) or resid 30 through 49 or (resid 50 and (name N or name CA or name C or name O or name CB )) or resid 51 through 53 or (resid 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 91 or (resid 92 and (name N or name CA or name C or name O or name CB )) or resid 93 through 96 or (resid 97 and (name N or name CA or name C or name O )) or resid 98 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 101 through 102 or (resid 103 and (name N or name CA or name C or name O or name CB )) or resid 104 through 114 or (resid 115 through 119 and (name N or name CA or name C or name O or name CB )) or resid 120 or (resid 121 through 125 and (name N or name CA or name C or name O or name CB )) or resid 126 through 127 or (resid 128 and (name N or name CA or name C or name O )) or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 155 or (resid 156 and (name N or name CA or name C or name O )) or resid 157 or (resid 158 and (name N or name CA or name C or name O )) or resid 159 through 165 or (resid 166 and (name N or name CA or name C or name O or name CB )) or resid 167 through 195)) ; 1 3 ;(chain C and ((resid 2 and (name N or name CA or name C or name O or name CB )) or resid 3 through 76 or (resid 77 and (name N or name CA or name C or name O or name CB )) or resid 78 through 91 or (resid 92 and (name N or name CA or name C or name O or name CB )) or resid 93 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 101 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 147 or (resid 148 and (name N or name CA or name C or name O or name CB )) or resid 149 through 195)) ; # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 1 A GLU 2 . A GLN 28 . A GLU 2 A GLN 28 ? ;(chain A and (resid 2 through 28 or (resid 29 and (name N or name CA or name C or name O or name CB )) or resid 30 through 49 or (resid 50 and (name N or name CA or name C or name O or name CB )) or resid 51 through 76 or (resid 77 and (name N or name CA or name C or name O or name CB )) or resid 78 through 96 or (resid 97 and (name N or name CA or name C or name O )) or resid 98 through 102 or (resid 103 and (name N or name CA or name C or name O or name CB )) or resid 104 through 114 or (resid 115 through 119 and (name N or name CA or name C or name O or name CB )) or resid 120 or (resid 121 through 125 and (name N or name CA or name C or name O or name CB )) or resid 126 through 127 or (resid 128 and (name N or name CA or name C or name O )) or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 147 or (resid 148 and (name N or name CA or name C or name O or name CB )) or resid 149 through 155 or (resid 156 and (name N or name CA or name C or name O )) or resid 157 or (resid 158 and (name N or name CA or name C or name O )) or resid 159 through 165 or (resid 166 and (name N or name CA or name C or name O or name CB )) or resid 167 through 195)) ; 1 1 2 A GLU 29 . A GLU 29 . A GLU 29 A GLU 29 ? ;(chain A and (resid 2 through 28 or (resid 29 and (name N or name CA or name C or name O or name CB )) or resid 30 through 49 or (resid 50 and (name N or name CA or name C or name O or name CB )) or resid 51 through 76 or (resid 77 and (name N or name CA or name C or name O or name CB )) or resid 78 through 96 or (resid 97 and (name N or name CA or name C or name O )) or resid 98 through 102 or (resid 103 and (name N or name CA or name C or name O or name CB )) or resid 104 through 114 or (resid 115 through 119 and (name N or name CA or name C or name O or name CB )) or resid 120 or (resid 121 through 125 and (name N or name CA or name C or name O or name CB )) or resid 126 through 127 or (resid 128 and (name N or name CA or name C or name O )) or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 147 or (resid 148 and (name N or name CA or name C or name O or name CB )) or resid 149 through 155 or (resid 156 and (name N or name CA or name C or name O )) or resid 157 or (resid 158 and (name N or name CA or name C or name O )) or resid 159 through 165 or (resid 166 and (name N or name CA or name C or name O or name CB )) or resid 167 through 195)) ; 1 1 3 A GLU 2 . A VAL 197 . A GLU 2 A VAL 197 ? ;(chain A and (resid 2 through 28 or (resid 29 and (name N or name CA or name C or name O or name CB )) or resid 30 through 49 or (resid 50 and (name N or name CA or name C or name O or name CB )) or resid 51 through 76 or (resid 77 and (name N or name CA or name C or name O or name CB )) or resid 78 through 96 or (resid 97 and (name N or name CA or name C or name O )) or resid 98 through 102 or (resid 103 and (name N or name CA or name C or name O or name CB )) or resid 104 through 114 or (resid 115 through 119 and (name N or name CA or name C or name O or name CB )) or resid 120 or (resid 121 through 125 and (name N or name CA or name C or name O or name CB )) or resid 126 through 127 or (resid 128 and (name N or name CA or name C or name O )) or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 147 or (resid 148 and (name N or name CA or name C or name O or name CB )) or resid 149 through 155 or (resid 156 and (name N or name CA or name C or name O )) or resid 157 or (resid 158 and (name N or name CA or name C or name O )) or resid 159 through 165 or (resid 166 and (name N or name CA or name C or name O or name CB )) or resid 167 through 195)) ; 1 1 4 A GLU 2 . A VAL 197 . A GLU 2 A VAL 197 ? ;(chain A and (resid 2 through 28 or (resid 29 and (name N or name CA or name C or name O or name CB )) or resid 30 through 49 or (resid 50 and (name N or name CA or name C or name O or name CB )) or resid 51 through 76 or (resid 77 and (name N or name CA or name C or name O or name CB )) or resid 78 through 96 or (resid 97 and (name N or name CA or name C or name O )) or resid 98 through 102 or (resid 103 and (name N or name CA or name C or name O or name CB )) or resid 104 through 114 or (resid 115 through 119 and (name N or name CA or name C or name O or name CB )) or resid 120 or (resid 121 through 125 and (name N or name CA or name C or name O or name CB )) or resid 126 through 127 or (resid 128 and (name N or name CA or name C or name O )) or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 147 or (resid 148 and (name N or name CA or name C or name O or name CB )) or resid 149 through 155 or (resid 156 and (name N or name CA or name C or name O )) or resid 157 or (resid 158 and (name N or name CA or name C or name O )) or resid 159 through 165 or (resid 166 and (name N or name CA or name C or name O or name CB )) or resid 167 through 195)) ; 1 1 5 A GLU 2 . A VAL 197 . A GLU 2 A VAL 197 ? ;(chain A and (resid 2 through 28 or (resid 29 and (name N or name CA or name C or name O or name CB )) or resid 30 through 49 or (resid 50 and (name N or name CA or name C or name O or name CB )) or resid 51 through 76 or (resid 77 and (name N or name CA or name C or name O or name CB )) or resid 78 through 96 or (resid 97 and (name N or name CA or name C or name O )) or resid 98 through 102 or (resid 103 and (name N or name CA or name C or name O or name CB )) or resid 104 through 114 or (resid 115 through 119 and (name N or name CA or name C or name O or name CB )) or resid 120 or (resid 121 through 125 and (name N or name CA or name C or name O or name CB )) or resid 126 through 127 or (resid 128 and (name N or name CA or name C or name O )) or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 147 or (resid 148 and (name N or name CA or name C or name O or name CB )) or resid 149 through 155 or (resid 156 and (name N or name CA or name C or name O )) or resid 157 or (resid 158 and (name N or name CA or name C or name O )) or resid 159 through 165 or (resid 166 and (name N or name CA or name C or name O or name CB )) or resid 167 through 195)) ; 1 2 1 B GLU 2 . B GLN 28 . B GLU 2 B GLN 28 ? ;(chain B and (resid 2 through 28 or (resid 29 and (name N or name CA or name C or name O or name CB )) or resid 30 through 49 or (resid 50 and (name N or name CA or name C or name O or name CB )) or resid 51 through 53 or (resid 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 91 or (resid 92 and (name N or name CA or name C or name O or name CB )) or resid 93 through 96 or (resid 97 and (name N or name CA or name C or name O )) or resid 98 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 101 through 102 or (resid 103 and (name N or name CA or name C or name O or name CB )) or resid 104 through 114 or (resid 115 through 119 and (name N or name CA or name C or name O or name CB )) or resid 120 or (resid 121 through 125 and (name N or name CA or name C or name O or name CB )) or resid 126 through 127 or (resid 128 and (name N or name CA or name C or name O )) or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 155 or (resid 156 and (name N or name CA or name C or name O )) or resid 157 or (resid 158 and (name N or name CA or name C or name O )) or resid 159 through 165 or (resid 166 and (name N or name CA or name C or name O or name CB )) or resid 167 through 195)) ; 1 2 2 B GLU 29 . B GLU 29 . B GLU 29 B GLU 29 ? ;(chain B and (resid 2 through 28 or (resid 29 and (name N or name CA or name C or name O or name CB )) or resid 30 through 49 or (resid 50 and (name N or name CA or name C or name O or name CB )) or resid 51 through 53 or (resid 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 91 or (resid 92 and (name N or name CA or name C or name O or name CB )) or resid 93 through 96 or (resid 97 and (name N or name CA or name C or name O )) or resid 98 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 101 through 102 or (resid 103 and (name N or name CA or name C or name O or name CB )) or resid 104 through 114 or (resid 115 through 119 and (name N or name CA or name C or name O or name CB )) or resid 120 or (resid 121 through 125 and (name N or name CA or name C or name O or name CB )) or resid 126 through 127 or (resid 128 and (name N or name CA or name C or name O )) or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 155 or (resid 156 and (name N or name CA or name C or name O )) or resid 157 or (resid 158 and (name N or name CA or name C or name O )) or resid 159 through 165 or (resid 166 and (name N or name CA or name C or name O or name CB )) or resid 167 through 195)) ; 1 2 3 B GLU 2 . B ARG 199 . B GLU 2 B ARG 199 ? ;(chain B and (resid 2 through 28 or (resid 29 and (name N or name CA or name C or name O or name CB )) or resid 30 through 49 or (resid 50 and (name N or name CA or name C or name O or name CB )) or resid 51 through 53 or (resid 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 91 or (resid 92 and (name N or name CA or name C or name O or name CB )) or resid 93 through 96 or (resid 97 and (name N or name CA or name C or name O )) or resid 98 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 101 through 102 or (resid 103 and (name N or name CA or name C or name O or name CB )) or resid 104 through 114 or (resid 115 through 119 and (name N or name CA or name C or name O or name CB )) or resid 120 or (resid 121 through 125 and (name N or name CA or name C or name O or name CB )) or resid 126 through 127 or (resid 128 and (name N or name CA or name C or name O )) or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 155 or (resid 156 and (name N or name CA or name C or name O )) or resid 157 or (resid 158 and (name N or name CA or name C or name O )) or resid 159 through 165 or (resid 166 and (name N or name CA or name C or name O or name CB )) or resid 167 through 195)) ; 1 3 1 C GLU 2 . C GLU 2 . C GLU 2 C GLU 2 ? ;(chain C and ((resid 2 and (name N or name CA or name C or name O or name CB )) or resid 3 through 76 or (resid 77 and (name N or name CA or name C or name O or name CB )) or resid 78 through 91 or (resid 92 and (name N or name CA or name C or name O or name CB )) or resid 93 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 101 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 147 or (resid 148 and (name N or name CA or name C or name O or name CB )) or resid 149 through 195)) ; 1 3 2 C MET 1 . C GLY 195 . C MET 1 C GLY 195 ? ;(chain C and ((resid 2 and (name N or name CA or name C or name O or name CB )) or resid 3 through 76 or (resid 77 and (name N or name CA or name C or name O or name CB )) or resid 78 through 91 or (resid 92 and (name N or name CA or name C or name O or name CB )) or resid 93 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 101 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 147 or (resid 148 and (name N or name CA or name C or name O or name CB )) or resid 149 through 195)) ; 1 3 3 C MET 1 . C GLY 195 . C MET 1 C GLY 195 ? ;(chain C and ((resid 2 and (name N or name CA or name C or name O or name CB )) or resid 3 through 76 or (resid 77 and (name N or name CA or name C or name O or name CB )) or resid 78 through 91 or (resid 92 and (name N or name CA or name C or name O or name CB )) or resid 93 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 101 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 147 or (resid 148 and (name N or name CA or name C or name O or name CB )) or resid 149 through 195)) ; 1 3 4 C MET 1 . C GLY 195 . C MET 1 C GLY 195 ? ;(chain C and ((resid 2 and (name N or name CA or name C or name O or name CB )) or resid 3 through 76 or (resid 77 and (name N or name CA or name C or name O or name CB )) or resid 78 through 91 or (resid 92 and (name N or name CA or name C or name O or name CB )) or resid 93 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 101 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 147 or (resid 148 and (name N or name CA or name C or name O or name CB )) or resid 149 through 195)) ; 1 3 5 C MET 1 . C GLY 195 . C MET 1 C GLY 195 ? ;(chain C and ((resid 2 and (name N or name CA or name C or name O or name CB )) or resid 3 through 76 or (resid 77 and (name N or name CA or name C or name O or name CB )) or resid 78 through 91 or (resid 92 and (name N or name CA or name C or name O or name CB )) or resid 93 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 101 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 147 or (resid 148 and (name N or name CA or name C or name O or name CB )) or resid 149 through 195)) ; # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 7N41 _struct.title 'Crystal structure of TagA with UDP-ManNAc' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7N41 _struct_keywords.text 'GLYCOSYLTRANSFERASE, WALL TEICHOIC ACID ENZYME, BETA-N-2 ACETYLMANNOSAMINYLTRANSFERASE, TRANSFERASE, UDP-N-ACETYLMANNOSAMINE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 2 ? E N N 2 ? F N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 15 ? LEU A 27 ? THR A 15 LEU A 27 1 ? 13 HELX_P HELX_P2 AA2 ASN A 39 ? ASP A 49 ? ASN A 39 ASP A 49 1 ? 11 HELX_P HELX_P3 AA3 ASP A 49 ? ASN A 57 ? ASP A 49 ASN A 57 1 ? 9 HELX_P HELX_P4 AA4 GLY A 66 ? SER A 73 ? GLY A 66 SER A 73 1 ? 8 HELX_P HELX_P5 AA5 LYS A 74 ? PHE A 76 ? LYS A 74 PHE A 76 5 ? 3 HELX_P HELX_P6 AA6 ALA A 85 ? GLY A 101 ? ALA A 85 GLY A 101 1 ? 17 HELX_P HELX_P7 AA7 GLN A 112 ? TYR A 125 ? GLN A 112 TYR A 125 1 ? 14 HELX_P HELX_P8 AA8 THR A 139 ? LYS A 153 ? THR A 139 LYS A 153 1 ? 15 HELX_P HELX_P9 AA9 PRO A 165 ? ASN A 174 ? PRO A 165 ASN A 174 1 ? 10 HELX_P HELX_P10 AB1 GLY A 188 ? ALA A 194 ? GLY A 188 ALA A 194 1 ? 7 HELX_P HELX_P11 AB2 THR B 15 ? GLN B 28 ? THR B 15 GLN B 28 1 ? 14 HELX_P HELX_P12 AB3 ASN B 39 ? ASP B 49 ? ASN B 39 ASP B 49 1 ? 11 HELX_P HELX_P13 AB4 ASP B 49 ? THR B 59 ? ASP B 49 THR B 59 1 ? 11 HELX_P HELX_P14 AB5 GLY B 66 ? SER B 73 ? GLY B 66 SER B 73 1 ? 8 HELX_P HELX_P15 AB6 LYS B 74 ? PHE B 76 ? LYS B 74 PHE B 76 5 ? 3 HELX_P HELX_P16 AB7 ALA B 85 ? SER B 98 ? ALA B 85 SER B 98 1 ? 14 HELX_P HELX_P17 AB8 GLN B 112 ? TYR B 125 ? GLN B 112 TYR B 125 1 ? 14 HELX_P HELX_P18 AB9 THR B 139 ? LYS B 153 ? THR B 139 LYS B 153 1 ? 15 HELX_P HELX_P19 AC1 PRO B 165 ? ASN B 174 ? PRO B 165 ASN B 174 1 ? 10 HELX_P HELX_P20 AC2 GLY B 188 ? ALA B 194 ? GLY B 188 ALA B 194 1 ? 7 HELX_P HELX_P21 AC3 THR C 15 ? ASN C 25 ? THR C 15 ASN C 25 1 ? 11 HELX_P HELX_P22 AC4 PHE C 26 ? GLU C 29 ? PHE C 26 GLU C 29 5 ? 4 HELX_P HELX_P23 AC5 ASN C 39 ? ASP C 49 ? ASN C 39 ASP C 49 1 ? 11 HELX_P HELX_P24 AC6 ASP C 49 ? ASN C 57 ? ASP C 49 ASN C 57 1 ? 9 HELX_P HELX_P25 AC7 GLY C 66 ? SER C 73 ? GLY C 66 SER C 73 1 ? 8 HELX_P HELX_P26 AC8 LYS C 74 ? PHE C 76 ? LYS C 74 PHE C 76 5 ? 3 HELX_P HELX_P27 AC9 ALA C 85 ? GLY C 101 ? ALA C 85 GLY C 101 1 ? 17 HELX_P HELX_P28 AD1 GLN C 112 ? TYR C 125 ? GLN C 112 TYR C 125 1 ? 14 HELX_P HELX_P29 AD2 THR C 139 ? LYS C 153 ? THR C 139 LYS C 153 1 ? 15 HELX_P HELX_P30 AD3 PRO C 165 ? ASN C 174 ? PRO C 165 ASN C 174 1 ? 10 HELX_P HELX_P31 AD4 GLY C 188 ? ALA C 194 ? GLY C 188 ALA C 194 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ALA 164 A . ? ALA 164 A PRO 165 A ? PRO 165 A 1 -1.36 2 ALA 164 B . ? ALA 164 B PRO 165 B ? PRO 165 B 1 2.54 3 ALA 164 C . ? ALA 164 C PRO 165 C ? PRO 165 C 1 2.79 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 6 ? AA3 ? 2 ? AA4 ? 6 ? AA5 ? 2 ? AA6 ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? parallel AA2 3 4 ? parallel AA2 4 5 ? parallel AA2 5 6 ? parallel AA3 1 2 ? anti-parallel AA4 1 2 ? parallel AA4 2 3 ? parallel AA4 3 4 ? parallel AA4 4 5 ? parallel AA4 5 6 ? parallel AA5 1 2 ? anti-parallel AA6 1 2 ? parallel AA6 2 3 ? parallel AA6 3 4 ? parallel AA6 4 5 ? parallel AA6 5 6 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 3 ? ILE A 6 ? ARG A 3 ILE A 6 AA1 2 VAL A 9 ? ASP A 12 ? VAL A 9 ASP A 12 AA2 1 LEU A 61 ? ASN A 62 ? LEU A 61 ASN A 62 AA2 2 HIS A 33 ? ALA A 36 ? HIS A 33 ALA A 36 AA2 3 ILE A 182 ? GLY A 185 ? ILE A 182 GLY A 185 AA2 4 VAL A 157 ? ALA A 161 ? VAL A 157 ALA A 161 AA2 5 ILE A 104 ? GLY A 108 ? ILE A 104 GLY A 108 AA2 6 ILE A 130 ? HIS A 134 ? ILE A 130 HIS A 134 AA3 1 ARG B 3 ? ILE B 6 ? ARG B 3 ILE B 6 AA3 2 VAL B 9 ? ASP B 12 ? VAL B 9 ASP B 12 AA4 1 LEU B 61 ? ASN B 62 ? LEU B 61 ASN B 62 AA4 2 HIS B 33 ? ALA B 36 ? HIS B 33 ALA B 36 AA4 3 ILE B 182 ? GLY B 185 ? ILE B 182 GLY B 185 AA4 4 VAL B 157 ? ALA B 161 ? VAL B 157 ALA B 161 AA4 5 ILE B 104 ? GLY B 108 ? ILE B 104 GLY B 108 AA4 6 ILE B 130 ? HIS B 134 ? ILE B 130 HIS B 134 AA5 1 ARG C 3 ? ILE C 6 ? ARG C 3 ILE C 6 AA5 2 VAL C 9 ? ASP C 12 ? VAL C 9 ASP C 12 AA6 1 LEU C 61 ? ASN C 62 ? LEU C 61 ASN C 62 AA6 2 HIS C 33 ? ALA C 36 ? HIS C 33 ALA C 36 AA6 3 ILE C 182 ? GLY C 185 ? ILE C 182 GLY C 185 AA6 4 VAL C 157 ? ALA C 161 ? VAL C 157 ALA C 161 AA6 5 ILE C 104 ? GLY C 108 ? ILE C 104 GLY C 108 AA6 6 ILE C 130 ? HIS C 134 ? ILE C 130 HIS C 134 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 4 ? N LEU A 4 O ILE A 11 ? O ILE A 11 AA2 1 2 O LEU A 61 ? O LEU A 61 N ALA A 36 ? N ALA A 36 AA2 2 3 N HIS A 33 ? N HIS A 33 O ALA A 183 ? O ALA A 183 AA2 3 4 O ILE A 182 ? O ILE A 182 N LEU A 158 ? N LEU A 158 AA2 4 5 O VAL A 157 ? O VAL A 157 N TYR A 105 ? N TYR A 105 AA2 5 6 N GLY A 108 ? N GLY A 108 O HIS A 134 ? O HIS A 134 AA3 1 2 N LEU B 4 ? N LEU B 4 O ILE B 11 ? O ILE B 11 AA4 1 2 O LEU B 61 ? O LEU B 61 N ALA B 36 ? N ALA B 36 AA4 2 3 N HIS B 33 ? N HIS B 33 O ALA B 183 ? O ALA B 183 AA4 3 4 O ILE B 182 ? O ILE B 182 N LEU B 158 ? N LEU B 158 AA4 4 5 O ALA B 161 ? O ALA B 161 N LEU B 107 ? N LEU B 107 AA4 5 6 N LEU B 106 ? N LEU B 106 O GLY B 132 ? O GLY B 132 AA5 1 2 N LEU C 4 ? N LEU C 4 O ILE C 11 ? O ILE C 11 AA6 1 2 O LEU C 61 ? O LEU C 61 N ALA C 36 ? N ALA C 36 AA6 2 3 N HIS C 33 ? N HIS C 33 O ALA C 183 ? O ALA C 183 AA6 3 4 O ILE C 182 ? O ILE C 182 N LEU C 158 ? N LEU C 158 AA6 4 5 O ALA C 161 ? O ALA C 161 N LEU C 107 ? N LEU C 107 AA6 5 6 N GLY C 108 ? N GLY C 108 O HIS C 134 ? O HIS C 134 # _atom_sites.entry_id 7N41 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.008800 _atom_sites.fract_transf_matrix[1][2] 0.005081 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010161 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008435 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 ARG 3 3 3 ARG ARG A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 MET 16 16 16 MET MET A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 HIS 33 33 33 HIS HIS A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 ASN 39 39 39 ASN ASN A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 MET 44 44 44 MET MET A . n A 1 45 MET 45 45 45 MET MET A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 TYR 52 52 52 TYR TYR A . n A 1 53 MET 53 53 53 MET MET A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 PHE 76 76 76 PHE PHE A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 PHE 87 87 87 PHE PHE A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 MET 90 90 90 MET MET A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 PHE 93 93 93 PHE PHE A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 SER 98 98 98 SER SER A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 TYR 105 105 105 TYR TYR A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 GLN 112 112 112 GLN GLN A . n A 1 113 VAL 113 113 113 VAL VAL A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 GLN 116 116 116 GLN GLN A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 ARG 118 118 118 ARG ARG A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 ASN 120 120 120 ASN ASN A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 TYR 125 125 125 TYR TYR A . n A 1 126 PRO 126 126 126 PRO PRO A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 VAL 128 128 128 VAL VAL A . n A 1 129 LYS 129 129 129 LYS LYS A . n A 1 130 ILE 130 130 130 ILE ILE A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 GLY 132 132 132 GLY GLY A . n A 1 133 THR 133 133 133 THR THR A . n A 1 134 HIS 134 134 134 HIS HIS A . n A 1 135 HIS 135 135 135 HIS HIS A . n A 1 136 GLY 136 136 136 GLY GLY A . n A 1 137 TYR 137 137 137 TYR TYR A . n A 1 138 PHE 138 138 138 PHE PHE A . n A 1 139 THR 139 139 139 THR THR A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 GLU 141 141 141 GLU GLU A . n A 1 142 GLU 142 142 142 GLU GLU A . n A 1 143 GLU 143 143 143 GLU GLU A . n A 1 144 ASN 144 144 144 ASN ASN A . n A 1 145 LYS 145 145 145 LYS LYS A . n A 1 146 ILE 146 146 146 ILE ILE A . n A 1 147 ILE 147 147 147 ILE ILE A . n A 1 148 GLU 148 148 148 GLU GLU A . n A 1 149 GLU 149 149 149 GLU GLU A . n A 1 150 ILE 150 150 150 ILE ILE A . n A 1 151 ASN 151 151 151 ASN ASN A . n A 1 152 ASN 152 152 152 ASN ASN A . n A 1 153 LYS 153 153 153 LYS LYS A . n A 1 154 GLY 154 154 154 GLY GLY A . n A 1 155 ALA 155 155 155 ALA ALA A . n A 1 156 GLU 156 156 156 GLU GLU A . n A 1 157 VAL 157 157 157 VAL VAL A . n A 1 158 LEU 158 158 158 LEU LEU A . n A 1 159 PHE 159 159 159 PHE PHE A . n A 1 160 VAL 160 160 160 VAL VAL A . n A 1 161 ALA 161 161 161 ALA ALA A . n A 1 162 LEU 162 162 162 LEU LEU A . n A 1 163 GLY 163 163 163 GLY GLY A . n A 1 164 ALA 164 164 164 ALA ALA A . n A 1 165 PRO 165 165 165 PRO PRO A . n A 1 166 LYS 166 166 166 LYS LYS A . n A 1 167 GLN 167 167 167 GLN GLN A . n A 1 168 GLU 168 168 168 GLU GLU A . n A 1 169 LYS 169 169 169 LYS LYS A . n A 1 170 TRP 170 170 170 TRP TRP A . n A 1 171 ILE 171 171 171 ILE ILE A . n A 1 172 TYR 172 172 172 TYR TYR A . n A 1 173 LYS 173 173 173 LYS LYS A . n A 1 174 ASN 174 174 174 ASN ASN A . n A 1 175 LYS 175 175 175 LYS LYS A . n A 1 176 ASP 176 176 176 ASP ASP A . n A 1 177 LYS 177 177 177 LYS LYS A . n A 1 178 LEU 178 178 178 LEU LEU A . n A 1 179 LYS 179 179 179 LYS LYS A . n A 1 180 VAL 180 180 180 VAL VAL A . n A 1 181 LYS 181 181 181 LYS LYS A . n A 1 182 ILE 182 182 182 ILE ILE A . n A 1 183 ALA 183 183 183 ALA ALA A . n A 1 184 MET 184 184 184 MET MET A . n A 1 185 GLY 185 185 185 GLY GLY A . n A 1 186 VAL 186 186 186 VAL VAL A . n A 1 187 GLY 187 187 187 GLY GLY A . n A 1 188 GLY 188 188 188 GLY GLY A . n A 1 189 SER 189 189 189 SER SER A . n A 1 190 PHE 190 190 190 PHE PHE A . n A 1 191 ASP 191 191 191 ASP ASP A . n A 1 192 VAL 192 192 192 VAL VAL A . n A 1 193 ILE 193 193 193 ILE ILE A . n A 1 194 ALA 194 194 194 ALA ALA A . n A 1 195 GLY 195 195 195 GLY GLY A . n A 1 196 LYS 196 196 196 LYS LYS A . n A 1 197 VAL 197 197 197 VAL VAL A . n A 1 198 LYS 198 198 ? ? ? A . n A 1 199 ARG 199 199 ? ? ? A . n A 1 200 ALA 200 200 ? ? ? A . n A 1 201 PRO 201 201 ? ? ? A . n A 1 202 TYR 202 202 ? ? ? A . n A 1 203 GLU 203 203 ? ? ? A . n A 1 204 TYR 204 204 ? ? ? A . n A 1 205 ARG 205 205 ? ? ? A . n A 1 206 LYS 206 206 ? ? ? A . n A 1 207 LEU 207 207 ? ? ? A . n A 1 208 GLY 208 208 ? ? ? A . n A 1 209 GLN 209 209 ? ? ? A . n A 1 210 GLU 210 210 ? ? ? A . n A 1 211 TRP 211 211 ? ? ? A . n A 1 212 LYS 212 212 ? ? ? A . n A 1 213 TYR 213 213 ? ? ? A . n A 1 214 ARG 214 214 ? ? ? A . n A 1 215 LEU 215 215 ? ? ? A . n A 1 216 GLU 216 216 ? ? ? A . n A 1 217 LYS 217 217 ? ? ? A . n A 1 218 GLU 218 218 ? ? ? A . n A 1 219 PRO 219 219 ? ? ? A . n A 1 220 TRP 220 220 ? ? ? A . n A 1 221 ARG 221 221 ? ? ? A . n A 1 222 TYR 222 222 ? ? ? A . n A 1 223 LYS 223 223 ? ? ? A . n A 1 224 ARG 224 224 ? ? ? A . n A 1 225 MET 225 225 ? ? ? A . n A 1 226 MET 226 226 ? ? ? A . n A 1 227 ALA 227 227 ? ? ? A . n A 1 228 LEU 228 228 ? ? ? A . n A 1 229 PRO 229 229 ? ? ? A . n A 1 230 LYS 230 230 ? ? ? A . n A 1 231 PHE 231 231 ? ? ? A . n A 1 232 ALA 232 232 ? ? ? A . n A 1 233 ILE 233 233 ? ? ? A . n A 1 234 LYS 234 234 ? ? ? A . n A 1 235 VAL 235 235 ? ? ? A . n A 1 236 LEU 236 236 ? ? ? A . n A 1 237 LEU 237 237 ? ? ? A . n A 1 238 HIS 238 238 ? ? ? A . n A 1 239 LYS 239 239 ? ? ? A . n A 1 240 ARG 240 240 ? ? ? A . n A 1 241 GLU 241 241 ? ? ? A . n A 1 242 VAL 242 242 ? ? ? A . n A 1 243 VAL 243 243 ? ? ? A . n A 1 244 ARG 244 244 ? ? ? A . n B 1 1 MET 1 1 ? ? ? B . n B 1 2 GLU 2 2 2 GLU GLU B . n B 1 3 ARG 3 3 3 ARG ARG B . n B 1 4 LEU 4 4 4 LEU LEU B . n B 1 5 ASP 5 5 5 ASP ASP B . n B 1 6 ILE 6 6 6 ILE ILE B . n B 1 7 PHE 7 7 7 PHE PHE B . n B 1 8 GLY 8 8 8 GLY GLY B . n B 1 9 VAL 9 9 9 VAL VAL B . n B 1 10 PRO 10 10 10 PRO PRO B . n B 1 11 ILE 11 11 11 ILE ILE B . n B 1 12 ASP 12 12 12 ASP ASP B . n B 1 13 ARG 13 13 13 ARG ARG B . n B 1 14 VAL 14 14 14 VAL VAL B . n B 1 15 THR 15 15 15 THR THR B . n B 1 16 MET 16 16 16 MET MET B . n B 1 17 ILE 17 17 17 ILE ILE B . n B 1 18 GLN 18 18 18 GLN GLN B . n B 1 19 ALA 19 19 19 ALA ALA B . n B 1 20 VAL 20 20 20 VAL VAL B . n B 1 21 ASP 21 21 21 ASP ASP B . n B 1 22 ILE 22 22 22 ILE ILE B . n B 1 23 LEU 23 23 23 LEU LEU B . n B 1 24 ASN 24 24 24 ASN ASN B . n B 1 25 ASN 25 25 25 ASN ASN B . n B 1 26 PHE 26 26 26 PHE PHE B . n B 1 27 LEU 27 27 27 LEU LEU B . n B 1 28 GLN 28 28 28 GLN GLN B . n B 1 29 GLU 29 29 29 GLU GLU B . n B 1 30 ASN 30 30 30 ASN ASN B . n B 1 31 ARG 31 31 31 ARG ARG B . n B 1 32 LEU 32 32 32 LEU LEU B . n B 1 33 HIS 33 33 33 HIS HIS B . n B 1 34 ILE 34 34 34 ILE ILE B . n B 1 35 VAL 35 35 35 VAL VAL B . n B 1 36 ALA 36 36 36 ALA ALA B . n B 1 37 THR 37 37 37 THR THR B . n B 1 38 PRO 38 38 38 PRO PRO B . n B 1 39 ASN 39 39 39 ASN ASN B . n B 1 40 ALA 40 40 40 ALA ALA B . n B 1 41 GLU 41 41 41 GLU GLU B . n B 1 42 ILE 42 42 42 ILE ILE B . n B 1 43 VAL 43 43 43 VAL VAL B . n B 1 44 MET 44 44 44 MET MET B . n B 1 45 MET 45 45 45 MET MET B . n B 1 46 ALA 46 46 46 ALA ALA B . n B 1 47 GLN 47 47 47 GLN GLN B . n B 1 48 LYS 48 48 48 LYS LYS B . n B 1 49 ASP 49 49 49 ASP ASP B . n B 1 50 LYS 50 50 50 LYS LYS B . n B 1 51 GLU 51 51 51 GLU GLU B . n B 1 52 TYR 52 52 52 TYR TYR B . n B 1 53 MET 53 53 53 MET MET B . n B 1 54 GLU 54 54 54 GLU GLU B . n B 1 55 ILE 55 55 55 ILE ILE B . n B 1 56 LEU 56 56 56 LEU LEU B . n B 1 57 ASN 57 57 57 ASN ASN B . n B 1 58 ASN 58 58 58 ASN ASN B . n B 1 59 THR 59 59 59 THR THR B . n B 1 60 ASP 60 60 60 ASP ASP B . n B 1 61 LEU 61 61 61 LEU LEU B . n B 1 62 ASN 62 62 62 ASN ASN B . n B 1 63 VAL 63 63 63 VAL VAL B . n B 1 64 PRO 64 64 64 PRO PRO B . n B 1 65 ASP 65 65 65 ASP ASP B . n B 1 66 GLY 66 66 66 GLY GLY B . n B 1 67 SER 67 67 67 SER SER B . n B 1 68 GLY 68 68 68 GLY GLY B . n B 1 69 ILE 69 69 69 ILE ILE B . n B 1 70 VAL 70 70 70 VAL VAL B . n B 1 71 PHE 71 71 71 PHE PHE B . n B 1 72 ALA 72 72 72 ALA ALA B . n B 1 73 SER 73 73 73 SER SER B . n B 1 74 LYS 74 74 74 LYS LYS B . n B 1 75 VAL 75 75 75 VAL VAL B . n B 1 76 PHE 76 76 76 PHE PHE B . n B 1 77 LYS 77 77 77 LYS LYS B . n B 1 78 LYS 78 78 78 LYS LYS B . n B 1 79 PRO 79 79 79 PRO PRO B . n B 1 80 LEU 80 80 80 LEU LEU B . n B 1 81 PRO 81 81 81 PRO PRO B . n B 1 82 GLU 82 82 82 GLU GLU B . n B 1 83 ARG 83 83 83 ARG ARG B . n B 1 84 VAL 84 84 84 VAL VAL B . n B 1 85 ALA 85 85 85 ALA ALA B . n B 1 86 GLY 86 86 86 GLY GLY B . n B 1 87 PHE 87 87 87 PHE PHE B . n B 1 88 ASP 88 88 88 ASP ASP B . n B 1 89 LEU 89 89 89 LEU LEU B . n B 1 90 MET 90 90 90 MET MET B . n B 1 91 LEU 91 91 91 LEU LEU B . n B 1 92 GLU 92 92 92 GLU GLU B . n B 1 93 PHE 93 93 93 PHE PHE B . n B 1 94 ILE 94 94 94 ILE ILE B . n B 1 95 LYS 95 95 95 LYS LYS B . n B 1 96 GLY 96 96 96 GLY GLY B . n B 1 97 ILE 97 97 97 ILE ILE B . n B 1 98 SER 98 98 98 SER SER B . n B 1 99 SER 99 99 99 SER SER B . n B 1 100 LYS 100 100 100 LYS LYS B . n B 1 101 GLY 101 101 101 GLY GLY B . n B 1 102 VAL 102 102 102 VAL VAL B . n B 1 103 LYS 103 103 103 LYS LYS B . n B 1 104 ILE 104 104 104 ILE ILE B . n B 1 105 TYR 105 105 105 TYR TYR B . n B 1 106 LEU 106 106 106 LEU LEU B . n B 1 107 LEU 107 107 107 LEU LEU B . n B 1 108 GLY 108 108 108 GLY GLY B . n B 1 109 ALA 109 109 109 ALA ALA B . n B 1 110 ALA 110 110 110 ALA ALA B . n B 1 111 ALA 111 111 111 ALA ALA B . n B 1 112 GLN 112 112 112 GLN GLN B . n B 1 113 VAL 113 113 113 VAL VAL B . n B 1 114 ALA 114 114 114 ALA ALA B . n B 1 115 GLU 115 115 115 GLU GLU B . n B 1 116 GLN 116 116 116 GLN GLN B . n B 1 117 ALA 117 117 117 ALA ALA B . n B 1 118 ARG 118 118 118 ARG ARG B . n B 1 119 ALA 119 119 119 ALA ALA B . n B 1 120 ASN 120 120 120 ASN ASN B . n B 1 121 LEU 121 121 121 LEU LEU B . n B 1 122 GLU 122 122 122 GLU GLU B . n B 1 123 LYS 123 123 123 LYS LYS B . n B 1 124 LEU 124 124 124 LEU LEU B . n B 1 125 TYR 125 125 125 TYR TYR B . n B 1 126 PRO 126 126 126 PRO PRO B . n B 1 127 GLY 127 127 127 GLY GLY B . n B 1 128 VAL 128 128 128 VAL VAL B . n B 1 129 LYS 129 129 129 LYS LYS B . n B 1 130 ILE 130 130 130 ILE ILE B . n B 1 131 VAL 131 131 131 VAL VAL B . n B 1 132 GLY 132 132 132 GLY GLY B . n B 1 133 THR 133 133 133 THR THR B . n B 1 134 HIS 134 134 134 HIS HIS B . n B 1 135 HIS 135 135 135 HIS HIS B . n B 1 136 GLY 136 136 136 GLY GLY B . n B 1 137 TYR 137 137 137 TYR TYR B . n B 1 138 PHE 138 138 138 PHE PHE B . n B 1 139 THR 139 139 139 THR THR B . n B 1 140 GLU 140 140 140 GLU GLU B . n B 1 141 GLU 141 141 141 GLU GLU B . n B 1 142 GLU 142 142 142 GLU GLU B . n B 1 143 GLU 143 143 143 GLU GLU B . n B 1 144 ASN 144 144 144 ASN ASN B . n B 1 145 LYS 145 145 145 LYS LYS B . n B 1 146 ILE 146 146 146 ILE ILE B . n B 1 147 ILE 147 147 147 ILE ILE B . n B 1 148 GLU 148 148 148 GLU GLU B . n B 1 149 GLU 149 149 149 GLU GLU B . n B 1 150 ILE 150 150 150 ILE ILE B . n B 1 151 ASN 151 151 151 ASN ASN B . n B 1 152 ASN 152 152 152 ASN ASN B . n B 1 153 LYS 153 153 153 LYS LYS B . n B 1 154 GLY 154 154 154 GLY GLY B . n B 1 155 ALA 155 155 155 ALA ALA B . n B 1 156 GLU 156 156 156 GLU GLU B . n B 1 157 VAL 157 157 157 VAL VAL B . n B 1 158 LEU 158 158 158 LEU LEU B . n B 1 159 PHE 159 159 159 PHE PHE B . n B 1 160 VAL 160 160 160 VAL VAL B . n B 1 161 ALA 161 161 161 ALA ALA B . n B 1 162 LEU 162 162 162 LEU LEU B . n B 1 163 GLY 163 163 163 GLY GLY B . n B 1 164 ALA 164 164 164 ALA ALA B . n B 1 165 PRO 165 165 165 PRO PRO B . n B 1 166 LYS 166 166 166 LYS LYS B . n B 1 167 GLN 167 167 167 GLN GLN B . n B 1 168 GLU 168 168 168 GLU GLU B . n B 1 169 LYS 169 169 169 LYS LYS B . n B 1 170 TRP 170 170 170 TRP TRP B . n B 1 171 ILE 171 171 171 ILE ILE B . n B 1 172 TYR 172 172 172 TYR TYR B . n B 1 173 LYS 173 173 173 LYS LYS B . n B 1 174 ASN 174 174 174 ASN ASN B . n B 1 175 LYS 175 175 175 LYS LYS B . n B 1 176 ASP 176 176 176 ASP ASP B . n B 1 177 LYS 177 177 177 LYS LYS B . n B 1 178 LEU 178 178 178 LEU LEU B . n B 1 179 LYS 179 179 179 LYS LYS B . n B 1 180 VAL 180 180 180 VAL VAL B . n B 1 181 LYS 181 181 181 LYS LYS B . n B 1 182 ILE 182 182 182 ILE ILE B . n B 1 183 ALA 183 183 183 ALA ALA B . n B 1 184 MET 184 184 184 MET MET B . n B 1 185 GLY 185 185 185 GLY GLY B . n B 1 186 VAL 186 186 186 VAL VAL B . n B 1 187 GLY 187 187 187 GLY GLY B . n B 1 188 GLY 188 188 188 GLY GLY B . n B 1 189 SER 189 189 189 SER SER B . n B 1 190 PHE 190 190 190 PHE PHE B . n B 1 191 ASP 191 191 191 ASP ASP B . n B 1 192 VAL 192 192 192 VAL VAL B . n B 1 193 ILE 193 193 193 ILE ILE B . n B 1 194 ALA 194 194 194 ALA ALA B . n B 1 195 GLY 195 195 195 GLY GLY B . n B 1 196 LYS 196 196 196 LYS LYS B . n B 1 197 VAL 197 197 197 VAL VAL B . n B 1 198 LYS 198 198 198 LYS LYS B . n B 1 199 ARG 199 199 199 ARG ARG B . n B 1 200 ALA 200 200 ? ? ? B . n B 1 201 PRO 201 201 ? ? ? B . n B 1 202 TYR 202 202 ? ? ? B . n B 1 203 GLU 203 203 ? ? ? B . n B 1 204 TYR 204 204 ? ? ? B . n B 1 205 ARG 205 205 ? ? ? B . n B 1 206 LYS 206 206 ? ? ? B . n B 1 207 LEU 207 207 ? ? ? B . n B 1 208 GLY 208 208 ? ? ? B . n B 1 209 GLN 209 209 ? ? ? B . n B 1 210 GLU 210 210 ? ? ? B . n B 1 211 TRP 211 211 ? ? ? B . n B 1 212 LYS 212 212 ? ? ? B . n B 1 213 TYR 213 213 ? ? ? B . n B 1 214 ARG 214 214 ? ? ? B . n B 1 215 LEU 215 215 ? ? ? B . n B 1 216 GLU 216 216 ? ? ? B . n B 1 217 LYS 217 217 ? ? ? B . n B 1 218 GLU 218 218 ? ? ? B . n B 1 219 PRO 219 219 ? ? ? B . n B 1 220 TRP 220 220 ? ? ? B . n B 1 221 ARG 221 221 ? ? ? B . n B 1 222 TYR 222 222 ? ? ? B . n B 1 223 LYS 223 223 ? ? ? B . n B 1 224 ARG 224 224 ? ? ? B . n B 1 225 MET 225 225 ? ? ? B . n B 1 226 MET 226 226 ? ? ? B . n B 1 227 ALA 227 227 ? ? ? B . n B 1 228 LEU 228 228 ? ? ? B . n B 1 229 PRO 229 229 ? ? ? B . n B 1 230 LYS 230 230 ? ? ? B . n B 1 231 PHE 231 231 ? ? ? B . n B 1 232 ALA 232 232 ? ? ? B . n B 1 233 ILE 233 233 ? ? ? B . n B 1 234 LYS 234 234 ? ? ? B . n B 1 235 VAL 235 235 ? ? ? B . n B 1 236 LEU 236 236 ? ? ? B . n B 1 237 LEU 237 237 ? ? ? B . n B 1 238 HIS 238 238 ? ? ? B . n B 1 239 LYS 239 239 ? ? ? B . n B 1 240 ARG 240 240 ? ? ? B . n B 1 241 GLU 241 241 ? ? ? B . n B 1 242 VAL 242 242 ? ? ? B . n B 1 243 VAL 243 243 ? ? ? B . n B 1 244 ARG 244 244 ? ? ? B . n C 1 1 MET 1 1 1 MET MET C . n C 1 2 GLU 2 2 2 GLU GLU C . n C 1 3 ARG 3 3 3 ARG ARG C . n C 1 4 LEU 4 4 4 LEU LEU C . n C 1 5 ASP 5 5 5 ASP ASP C . n C 1 6 ILE 6 6 6 ILE ILE C . n C 1 7 PHE 7 7 7 PHE PHE C . n C 1 8 GLY 8 8 8 GLY GLY C . n C 1 9 VAL 9 9 9 VAL VAL C . n C 1 10 PRO 10 10 10 PRO PRO C . n C 1 11 ILE 11 11 11 ILE ILE C . n C 1 12 ASP 12 12 12 ASP ASP C . n C 1 13 ARG 13 13 13 ARG ARG C . n C 1 14 VAL 14 14 14 VAL VAL C . n C 1 15 THR 15 15 15 THR THR C . n C 1 16 MET 16 16 16 MET MET C . n C 1 17 ILE 17 17 17 ILE ILE C . n C 1 18 GLN 18 18 18 GLN GLN C . n C 1 19 ALA 19 19 19 ALA ALA C . n C 1 20 VAL 20 20 20 VAL VAL C . n C 1 21 ASP 21 21 21 ASP ASP C . n C 1 22 ILE 22 22 22 ILE ILE C . n C 1 23 LEU 23 23 23 LEU LEU C . n C 1 24 ASN 24 24 24 ASN ASN C . n C 1 25 ASN 25 25 25 ASN ASN C . n C 1 26 PHE 26 26 26 PHE PHE C . n C 1 27 LEU 27 27 27 LEU LEU C . n C 1 28 GLN 28 28 28 GLN GLN C . n C 1 29 GLU 29 29 29 GLU GLU C . n C 1 30 ASN 30 30 30 ASN ASN C . n C 1 31 ARG 31 31 31 ARG ARG C . n C 1 32 LEU 32 32 32 LEU LEU C . n C 1 33 HIS 33 33 33 HIS HIS C . n C 1 34 ILE 34 34 34 ILE ILE C . n C 1 35 VAL 35 35 35 VAL VAL C . n C 1 36 ALA 36 36 36 ALA ALA C . n C 1 37 THR 37 37 37 THR THR C . n C 1 38 PRO 38 38 38 PRO PRO C . n C 1 39 ASN 39 39 39 ASN ASN C . n C 1 40 ALA 40 40 40 ALA ALA C . n C 1 41 GLU 41 41 41 GLU GLU C . n C 1 42 ILE 42 42 42 ILE ILE C . n C 1 43 VAL 43 43 43 VAL VAL C . n C 1 44 MET 44 44 44 MET MET C . n C 1 45 MET 45 45 45 MET MET C . n C 1 46 ALA 46 46 46 ALA ALA C . n C 1 47 GLN 47 47 47 GLN GLN C . n C 1 48 LYS 48 48 48 LYS LYS C . n C 1 49 ASP 49 49 49 ASP ASP C . n C 1 50 LYS 50 50 50 LYS LYS C . n C 1 51 GLU 51 51 51 GLU GLU C . n C 1 52 TYR 52 52 52 TYR TYR C . n C 1 53 MET 53 53 53 MET MET C . n C 1 54 GLU 54 54 54 GLU GLU C . n C 1 55 ILE 55 55 55 ILE ILE C . n C 1 56 LEU 56 56 56 LEU LEU C . n C 1 57 ASN 57 57 57 ASN ASN C . n C 1 58 ASN 58 58 58 ASN ASN C . n C 1 59 THR 59 59 59 THR THR C . n C 1 60 ASP 60 60 60 ASP ASP C . n C 1 61 LEU 61 61 61 LEU LEU C . n C 1 62 ASN 62 62 62 ASN ASN C . n C 1 63 VAL 63 63 63 VAL VAL C . n C 1 64 PRO 64 64 64 PRO PRO C . n C 1 65 ASP 65 65 65 ASP ASP C . n C 1 66 GLY 66 66 66 GLY GLY C . n C 1 67 SER 67 67 67 SER SER C . n C 1 68 GLY 68 68 68 GLY GLY C . n C 1 69 ILE 69 69 69 ILE ILE C . n C 1 70 VAL 70 70 70 VAL VAL C . n C 1 71 PHE 71 71 71 PHE PHE C . n C 1 72 ALA 72 72 72 ALA ALA C . n C 1 73 SER 73 73 73 SER SER C . n C 1 74 LYS 74 74 74 LYS LYS C . n C 1 75 VAL 75 75 75 VAL VAL C . n C 1 76 PHE 76 76 76 PHE PHE C . n C 1 77 LYS 77 77 77 LYS LYS C . n C 1 78 LYS 78 78 78 LYS LYS C . n C 1 79 PRO 79 79 79 PRO PRO C . n C 1 80 LEU 80 80 80 LEU LEU C . n C 1 81 PRO 81 81 81 PRO PRO C . n C 1 82 GLU 82 82 82 GLU GLU C . n C 1 83 ARG 83 83 83 ARG ARG C . n C 1 84 VAL 84 84 84 VAL VAL C . n C 1 85 ALA 85 85 85 ALA ALA C . n C 1 86 GLY 86 86 86 GLY GLY C . n C 1 87 PHE 87 87 87 PHE PHE C . n C 1 88 ASP 88 88 88 ASP ASP C . n C 1 89 LEU 89 89 89 LEU LEU C . n C 1 90 MET 90 90 90 MET MET C . n C 1 91 LEU 91 91 91 LEU LEU C . n C 1 92 GLU 92 92 92 GLU GLU C . n C 1 93 PHE 93 93 93 PHE PHE C . n C 1 94 ILE 94 94 94 ILE ILE C . n C 1 95 LYS 95 95 95 LYS LYS C . n C 1 96 GLY 96 96 96 GLY GLY C . n C 1 97 ILE 97 97 97 ILE ILE C . n C 1 98 SER 98 98 98 SER SER C . n C 1 99 SER 99 99 99 SER SER C . n C 1 100 LYS 100 100 100 LYS LYS C . n C 1 101 GLY 101 101 101 GLY GLY C . n C 1 102 VAL 102 102 102 VAL VAL C . n C 1 103 LYS 103 103 103 LYS LYS C . n C 1 104 ILE 104 104 104 ILE ILE C . n C 1 105 TYR 105 105 105 TYR TYR C . n C 1 106 LEU 106 106 106 LEU LEU C . n C 1 107 LEU 107 107 107 LEU LEU C . n C 1 108 GLY 108 108 108 GLY GLY C . n C 1 109 ALA 109 109 109 ALA ALA C . n C 1 110 ALA 110 110 110 ALA ALA C . n C 1 111 ALA 111 111 111 ALA ALA C . n C 1 112 GLN 112 112 112 GLN GLN C . n C 1 113 VAL 113 113 113 VAL VAL C . n C 1 114 ALA 114 114 114 ALA ALA C . n C 1 115 GLU 115 115 115 GLU GLU C . n C 1 116 GLN 116 116 116 GLN GLN C . n C 1 117 ALA 117 117 117 ALA ALA C . n C 1 118 ARG 118 118 118 ARG ARG C . n C 1 119 ALA 119 119 119 ALA ALA C . n C 1 120 ASN 120 120 120 ASN ASN C . n C 1 121 LEU 121 121 121 LEU LEU C . n C 1 122 GLU 122 122 122 GLU GLU C . n C 1 123 LYS 123 123 123 LYS LYS C . n C 1 124 LEU 124 124 124 LEU LEU C . n C 1 125 TYR 125 125 125 TYR TYR C . n C 1 126 PRO 126 126 126 PRO PRO C . n C 1 127 GLY 127 127 127 GLY GLY C . n C 1 128 VAL 128 128 128 VAL VAL C . n C 1 129 LYS 129 129 129 LYS LYS C . n C 1 130 ILE 130 130 130 ILE ILE C . n C 1 131 VAL 131 131 131 VAL VAL C . n C 1 132 GLY 132 132 132 GLY GLY C . n C 1 133 THR 133 133 133 THR THR C . n C 1 134 HIS 134 134 134 HIS HIS C . n C 1 135 HIS 135 135 135 HIS HIS C . n C 1 136 GLY 136 136 136 GLY GLY C . n C 1 137 TYR 137 137 137 TYR TYR C . n C 1 138 PHE 138 138 138 PHE PHE C . n C 1 139 THR 139 139 139 THR THR C . n C 1 140 GLU 140 140 140 GLU GLU C . n C 1 141 GLU 141 141 141 GLU GLU C . n C 1 142 GLU 142 142 142 GLU GLU C . n C 1 143 GLU 143 143 143 GLU GLU C . n C 1 144 ASN 144 144 144 ASN ASN C . n C 1 145 LYS 145 145 145 LYS LYS C . n C 1 146 ILE 146 146 146 ILE ILE C . n C 1 147 ILE 147 147 147 ILE ILE C . n C 1 148 GLU 148 148 148 GLU GLU C . n C 1 149 GLU 149 149 149 GLU GLU C . n C 1 150 ILE 150 150 150 ILE ILE C . n C 1 151 ASN 151 151 151 ASN ASN C . n C 1 152 ASN 152 152 152 ASN ASN C . n C 1 153 LYS 153 153 153 LYS LYS C . n C 1 154 GLY 154 154 154 GLY GLY C . n C 1 155 ALA 155 155 155 ALA ALA C . n C 1 156 GLU 156 156 156 GLU GLU C . n C 1 157 VAL 157 157 157 VAL VAL C . n C 1 158 LEU 158 158 158 LEU LEU C . n C 1 159 PHE 159 159 159 PHE PHE C . n C 1 160 VAL 160 160 160 VAL VAL C . n C 1 161 ALA 161 161 161 ALA ALA C . n C 1 162 LEU 162 162 162 LEU LEU C . n C 1 163 GLY 163 163 163 GLY GLY C . n C 1 164 ALA 164 164 164 ALA ALA C . n C 1 165 PRO 165 165 165 PRO PRO C . n C 1 166 LYS 166 166 166 LYS LYS C . n C 1 167 GLN 167 167 167 GLN GLN C . n C 1 168 GLU 168 168 168 GLU GLU C . n C 1 169 LYS 169 169 169 LYS LYS C . n C 1 170 TRP 170 170 170 TRP TRP C . n C 1 171 ILE 171 171 171 ILE ILE C . n C 1 172 TYR 172 172 172 TYR TYR C . n C 1 173 LYS 173 173 173 LYS LYS C . n C 1 174 ASN 174 174 174 ASN ASN C . n C 1 175 LYS 175 175 175 LYS LYS C . n C 1 176 ASP 176 176 176 ASP ASP C . n C 1 177 LYS 177 177 177 LYS LYS C . n C 1 178 LEU 178 178 178 LEU LEU C . n C 1 179 LYS 179 179 179 LYS LYS C . n C 1 180 VAL 180 180 180 VAL VAL C . n C 1 181 LYS 181 181 181 LYS LYS C . n C 1 182 ILE 182 182 182 ILE ILE C . n C 1 183 ALA 183 183 183 ALA ALA C . n C 1 184 MET 184 184 184 MET MET C . n C 1 185 GLY 185 185 185 GLY GLY C . n C 1 186 VAL 186 186 186 VAL VAL C . n C 1 187 GLY 187 187 187 GLY GLY C . n C 1 188 GLY 188 188 188 GLY GLY C . n C 1 189 SER 189 189 189 SER SER C . n C 1 190 PHE 190 190 190 PHE PHE C . n C 1 191 ASP 191 191 191 ASP ASP C . n C 1 192 VAL 192 192 192 VAL VAL C . n C 1 193 ILE 193 193 193 ILE ILE C . n C 1 194 ALA 194 194 194 ALA ALA C . n C 1 195 GLY 195 195 195 GLY GLY C . n C 1 196 LYS 196 196 ? ? ? C . n C 1 197 VAL 197 197 ? ? ? C . n C 1 198 LYS 198 198 ? ? ? C . n C 1 199 ARG 199 199 ? ? ? C . n C 1 200 ALA 200 200 ? ? ? C . n C 1 201 PRO 201 201 ? ? ? C . n C 1 202 TYR 202 202 ? ? ? C . n C 1 203 GLU 203 203 ? ? ? C . n C 1 204 TYR 204 204 ? ? ? C . n C 1 205 ARG 205 205 ? ? ? C . n C 1 206 LYS 206 206 ? ? ? C . n C 1 207 LEU 207 207 ? ? ? C . n C 1 208 GLY 208 208 ? ? ? C . n C 1 209 GLN 209 209 ? ? ? C . n C 1 210 GLU 210 210 ? ? ? C . n C 1 211 TRP 211 211 ? ? ? C . n C 1 212 LYS 212 212 ? ? ? C . n C 1 213 TYR 213 213 ? ? ? C . n C 1 214 ARG 214 214 ? ? ? C . n C 1 215 LEU 215 215 ? ? ? C . n C 1 216 GLU 216 216 ? ? ? C . n C 1 217 LYS 217 217 ? ? ? C . n C 1 218 GLU 218 218 ? ? ? C . n C 1 219 PRO 219 219 ? ? ? C . n C 1 220 TRP 220 220 ? ? ? C . n C 1 221 ARG 221 221 ? ? ? C . n C 1 222 TYR 222 222 ? ? ? C . n C 1 223 LYS 223 223 ? ? ? C . n C 1 224 ARG 224 224 ? ? ? C . n C 1 225 MET 225 225 ? ? ? C . n C 1 226 MET 226 226 ? ? ? C . n C 1 227 ALA 227 227 ? ? ? C . n C 1 228 LEU 228 228 ? ? ? C . n C 1 229 PRO 229 229 ? ? ? C . n C 1 230 LYS 230 230 ? ? ? C . n C 1 231 PHE 231 231 ? ? ? C . n C 1 232 ALA 232 232 ? ? ? C . n C 1 233 ILE 233 233 ? ? ? C . n C 1 234 LYS 234 234 ? ? ? C . n C 1 235 VAL 235 235 ? ? ? C . n C 1 236 LEU 236 236 ? ? ? C . n C 1 237 LEU 237 237 ? ? ? C . n C 1 238 HIS 238 238 ? ? ? C . n C 1 239 LYS 239 239 ? ? ? C . n C 1 240 ARG 240 240 ? ? ? C . n C 1 241 GLU 241 241 ? ? ? C . n C 1 242 VAL 242 242 ? ? ? C . n C 1 243 VAL 243 243 ? ? ? C . n C 1 244 ARG 244 244 ? ? ? C . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code D 2 UD9 1 300 300 UD9 UD9 A . E 2 UD9 1 300 300 UD9 UD9 B . F 2 UD9 1 300 300 UD9 UD9 C . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 author_defined_assembly ? monomeric 1 3 author_defined_assembly ? monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,D 2 1 B,E 3 1 C,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-12-29 2 'Structure model' 1 1 2022-02-02 3 'Structure model' 1 2 2023-10-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' pdbx_initial_refinement_model 5 3 'Structure model' struct_ncs_dom_lim # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 3 'Structure model' '_struct_ncs_dom_lim.beg_auth_comp_id' 3 3 'Structure model' '_struct_ncs_dom_lim.beg_label_asym_id' 4 3 'Structure model' '_struct_ncs_dom_lim.beg_label_comp_id' 5 3 'Structure model' '_struct_ncs_dom_lim.beg_label_seq_id' 6 3 'Structure model' '_struct_ncs_dom_lim.end_auth_comp_id' 7 3 'Structure model' '_struct_ncs_dom_lim.end_label_asym_id' 8 3 'Structure model' '_struct_ncs_dom_lim.end_label_comp_id' 9 3 'Structure model' '_struct_ncs_dom_lim.end_label_seq_id' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 10.4758 -72.8188 -8.3731 1.1018 ? -0.1993 ? 0.1119 ? 0.4755 ? 0.0131 ? 0.8554 ? 0.0324 ? 0.0141 ? -0.0003 ? 0.0241 ? 0.0264 ? 0.0216 ? 0.2788 ? -0.2613 ? -0.3775 ? 0.1848 ? 0.1360 ? -0.1250 ? -0.0857 ? 0.2311 ? 0.0008 ? 2 'X-RAY DIFFRACTION' ? refined -1.0374 -80.8107 -4.7286 1.6950 ? -0.5617 ? 0.2024 ? 0.8360 ? -0.2262 ? 0.9660 ? 0.5734 ? -0.1741 ? -0.1589 ? 0.0526 ? 0.0497 ? 0.0460 ? 0.4367 ? 0.0411 ? -0.4289 ? -0.0349 ? -0.0831 ? -0.4009 ? 0.4228 ? -0.0710 ? -0.0444 ? 3 'X-RAY DIFFRACTION' ? refined 7.5773 -67.3318 -5.8784 1.2617 ? -0.3036 ? 0.0855 ? 0.5149 ? -0.0528 ? 0.6804 ? 0.5140 ? -0.1635 ? -0.0053 ? 0.1155 ? -0.0998 ? 0.2902 ? 0.1390 ? 0.0381 ? -0.3339 ? 0.5053 ? -0.4024 ? 0.2744 ? 0.3004 ? -0.1147 ? -0.0163 ? 4 'X-RAY DIFFRACTION' ? refined -12.6784 -75.5237 -2.8306 1.6910 ? -0.8995 ? 0.3239 ? 1.5038 ? -0.5535 ? 1.6992 ? 0.1027 ? 0.0572 ? 0.1266 ? 0.0432 ? 0.0561 ? 0.2162 ? 0.0732 ? -0.3027 ? 0.3404 ? -0.0205 ? -0.1618 ? 0.4875 ? -0.1609 ? -0.5654 ? 0.0080 ? 5 'X-RAY DIFFRACTION' ? refined -21.0186 -71.1031 -0.7200 1.4274 ? -0.6283 ? 0.0436 ? 2.4598 ? -0.4333 ? 1.5074 ? 0.0019 ? 0.0033 ? 0.0071 ? 0.0071 ? 0.0190 ? 0.0542 ? 0.0937 ? -0.0157 ? -0.0302 ? 0.1358 ? 0.0099 ? -0.0113 ? -0.0804 ? 0.0427 ? -0.0006 ? 6 'X-RAY DIFFRACTION' ? refined -11.9669 -75.7133 10.7921 1.9258 ? -1.0560 ? 0.5550 ? 1.7522 ? -0.4435 ? 1.2194 ? 0.7032 ? -0.7372 ? -0.0275 ? 1.0273 ? 0.1872 ? 0.1123 ? -0.3176 ? -0.2314 ? -0.1551 ? 0.6287 ? -0.1613 ? 0.0327 ? 0.4889 ? -0.1241 ? -0.1153 ? 7 'X-RAY DIFFRACTION' ? refined -0.9051 -74.7496 9.2508 1.5110 ? -0.4561 ? 0.4009 ? 0.9948 ? 0.0248 ? 0.6414 ? 0.0392 ? -0.0288 ? 0.0076 ? 0.0662 ? 0.0166 ? 0.0145 ? -0.3559 ? -0.0756 ? -0.4331 ? 0.1569 ? -0.0324 ? -0.0912 ? 0.3460 ? 0.1624 ? -0.0020 ? 8 'X-RAY DIFFRACTION' ? refined -10.4508 -68.6967 -0.5384 1.6571 ? -0.4472 ? -0.0350 ? 1.1259 ? -0.3639 ? 1.0536 ? 0.0176 ? -0.0178 ? 0.0023 ? 0.0165 ? -0.0049 ? 0.0136 ? -0.1494 ? -0.0702 ? -0.0139 ? -0.1757 ? -0.3101 ? -0.0568 ? -0.0948 ? -0.5224 ? 0.0017 ? 9 'X-RAY DIFFRACTION' ? refined 7.3458 -48.4693 -2.7318 0.8961 ? -0.1945 ? -0.0631 ? 0.6256 ? 0.0035 ? 0.6128 ? 0.0031 ? 0.0079 ? -0.0057 ? 0.0217 ? 0.0071 ? 0.0422 ? -0.1949 ? -0.0046 ? -0.3195 ? -0.0478 ? 0.0172 ? 0.1340 ? 0.1382 ? -0.4667 ? 0.0003 ? 10 'X-RAY DIFFRACTION' ? refined 6.5177 -33.8235 0.2602 0.9377 ? -0.0254 ? -0.1039 ? 0.4513 ? 0.0315 ? 0.5023 ? 0.5986 ? 0.2778 ? 0.7146 ? 0.7076 ? 0.7118 ? 1.1236 ? -0.2706 ? 0.0445 ? -0.0753 ? -1.0278 ? -0.0472 ? 0.3168 ? -0.1496 ? -0.6239 ? 0.0413 ? 11 'X-RAY DIFFRACTION' ? refined 17.2050 -46.9825 0.9580 0.9487 ? -0.0598 ? 0.0553 ? 0.4228 ? 0.0543 ? 0.7023 ? 1.8386 ? -0.4003 ? -0.4831 ? 0.1340 ? 0.0556 ? 0.2505 ? -0.1050 ? -0.3713 ? 0.2809 ? -0.4109 ? 0.6313 ? -0.3774 ? 0.3853 ? -0.0098 ? 0.1119 ? 12 'X-RAY DIFFRACTION' ? refined 7.5791 -49.1937 -11.9195 1.4339 ? -0.1182 ? 0.0513 ? 0.5432 ? -0.0292 ? 0.6003 ? 0.0506 ? -0.0090 ? 0.0162 ? 0.0148 ? 0.0086 ? 0.0574 ? -0.0715 ? 0.0594 ? 0.4644 ? -0.3973 ? 0.0460 ? -0.3173 ? -0.4638 ? -0.5664 ? 0.0001 ? 13 'X-RAY DIFFRACTION' ? refined 15.4556 -25.6856 -5.0595 1.3726 ? -0.3609 ? 0.3590 ? -0.3855 ? 0.1685 ? 0.5097 ? 0.0687 ? 0.0296 ? 0.0138 ? 0.5124 ? 0.2338 ? 0.1410 ? -0.1567 ? 0.3023 ? 0.1017 ? -0.7572 ? 0.0457 ? 0.1259 ? -0.2786 ? -0.0310 ? 0.0728 ? 14 'X-RAY DIFFRACTION' ? refined 22.1845 -20.2601 -9.2131 2.0152 ? -0.4848 ? 0.5495 ? 0.8466 ? -0.0872 ? 0.8722 ? 0.0099 ? 0.0821 ? -0.0262 ? 0.7509 ? -0.2641 ? 0.0919 ? -0.1057 ? 0.0853 ? 0.0253 ? 0.0490 ? 0.0639 ? -0.1893 ? -0.3019 ? 0.0942 ? 0.0740 ? 15 'X-RAY DIFFRACTION' ? refined 22.8179 -23.0700 -0.7980 1.0911 ? -0.1052 ? 0.2247 ? 0.2153 ? -0.0546 ? 0.8657 ? 0.3357 ? 0.1971 ? -0.4491 ? 0.1324 ? -0.2485 ? 0.6008 ? 0.0415 ? 0.0538 ? -0.3580 ? -0.8142 ? 0.1380 ? -0.6923 ? -0.2515 ? 0.3368 ? 0.2706 ? 16 'X-RAY DIFFRACTION' ? refined 22.5566 -26.7638 7.2646 0.7245 ? -0.0994 ? -0.0079 ? 0.3843 ? -0.0344 ? 0.6394 ? 0.0590 ? 0.0776 ? 0.0143 ? 0.1437 ? -0.0395 ? 0.1235 ? 0.0175 ? -0.2683 ? 0.1067 ? 0.3157 ? 0.0069 ? -0.5286 ? -0.0972 ? -0.0675 ? -0.0007 ? 17 'X-RAY DIFFRACTION' ? refined 21.2351 -37.4101 7.5567 0.4891 ? -0.1836 ? -0.0279 ? 0.4943 ? -0.1302 ? 0.8012 ? 0.0075 ? -0.0136 ? -0.0025 ? 0.0349 ? 0.0145 ? 0.0073 ? 0.1847 ? -0.2124 ? -0.4756 ? 0.0067 ? -0.0436 ? -0.3036 ? 0.1535 ? -0.0862 ? -0.0000 ? 18 'X-RAY DIFFRACTION' ? refined 19.5160 -30.2631 -0.9036 0.7373 ? -0.0972 ? 0.1335 ? 0.2683 ? 0.0382 ? 0.4802 ? 1.3003 ? 0.2594 ? 0.0608 ? 0.5320 ? -0.1879 ? 1.5693 ? 0.2387 ? -0.1013 ? 0.0312 ? -0.3465 ? 0.3184 ? -0.7779 ? 0.1365 ? -0.1078 ? 0.1935 ? 19 'X-RAY DIFFRACTION' ? refined 31.8399 -62.4347 -15.1666 1.2024 ? -0.3765 ? 0.3086 ? 0.6032 ? -0.0172 ? 0.9708 ? 0.0952 ? 0.0015 ? -0.0684 ? 0.0941 ? 0.0674 ? 0.8094 ? 0.3635 ? -0.0297 ? 0.3715 ? 0.1909 ? 0.0530 ? -0.7078 ? -1.1400 ? 0.5265 ? 0.3091 ? 20 'X-RAY DIFFRACTION' ? refined 40.7572 -78.9242 -16.5438 0.5408 ? -0.3199 ? 0.0457 ? 0.6034 ? -0.1113 ? 0.7403 ? 0.8163 ? -0.2483 ? 0.6535 ? 0.8291 ? 0.4461 ? 1.1398 ? 0.2367 ? 0.4078 ? 0.3606 ? 0.3797 ? 0.1742 ? -1.0125 ? 0.1043 ? 0.8952 ? 1.4005 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? C 1 ? ? ? C 15 ? ? ;chain 'C' and (resid 1 through 15 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? C 16 ? ? ? C 39 ? ? ;chain 'C' and (resid 16 through 39 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? C 40 ? ? ? C 85 ? ? ;chain 'C' and (resid 40 through 85 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? C 86 ? ? ? C 112 ? ? ;chain 'C' and (resid 86 through 112 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? C 113 ? ? ? C 124 ? ? ;chain 'C' and (resid 113 through 124 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? C 125 ? ? ? C 161 ? ? ;chain 'C' and (resid 125 through 161 ) ; 7 'X-RAY DIFFRACTION' 7 ? ? C 162 ? ? ? C 181 ? ? ;chain 'C' and (resid 162 through 181 ) ; 8 'X-RAY DIFFRACTION' 8 ? ? C 182 ? ? ? C 195 ? ? ;chain 'C' and (resid 182 through 195 ) ; 9 'X-RAY DIFFRACTION' 9 ? ? A 2 ? ? ? A 15 ? ? ;chain 'A' and (resid 2 through 15 ) ; 10 'X-RAY DIFFRACTION' 10 ? ? A 16 ? ? ? A 39 ? ? ;chain 'A' and (resid 16 through 39 ) ; 11 'X-RAY DIFFRACTION' 11 ? ? A 40 ? ? ? A 66 ? ? ;chain 'A' and (resid 40 through 66 ) ; 12 'X-RAY DIFFRACTION' 12 ? ? A 67 ? ? ? A 85 ? ? ;chain 'A' and (resid 67 through 85 ) ; 13 'X-RAY DIFFRACTION' 13 ? ? A 86 ? ? ? A 112 ? ? ;chain 'A' and (resid 86 through 112 ) ; 14 'X-RAY DIFFRACTION' 14 ? ? A 113 ? ? ? A 124 ? ? ;chain 'A' and (resid 113 through 124 ) ; 15 'X-RAY DIFFRACTION' 15 ? ? A 125 ? ? ? A 139 ? ? ;chain 'A' and (resid 125 through 139 ) ; 16 'X-RAY DIFFRACTION' 16 ? ? A 140 ? ? ? A 165 ? ? ;chain 'A' and (resid 140 through 165 ) ; 17 'X-RAY DIFFRACTION' 17 ? ? A 166 ? ? ? A 175 ? ? ;chain 'A' and (resid 166 through 175 ) ; 18 'X-RAY DIFFRACTION' 18 ? ? A 176 ? ? ? A 197 ? ? ;chain 'A' and (resid 176 through 197 ) ; 19 'X-RAY DIFFRACTION' 19 ? ? B 2 ? ? ? B 97 ? ? ;chain 'B' and (resid 2 through 97 ) ; 20 'X-RAY DIFFRACTION' 20 ? ? B 98 ? ? ? B 199 ? ? ;chain 'B' and (resid 98 through 199 ) ; # _pdbx_phasing_MR.entry_id 7N41 _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details ? _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 5.820 _pdbx_phasing_MR.d_res_low_rotation 98.420 _pdbx_phasing_MR.d_res_high_translation 5.820 _pdbx_phasing_MR.d_res_low_translation 98.420 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.2 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.8.3 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 5 # _pdbx_entry_details.entry_id 7N41 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 109 ? ? 69.19 161.93 2 1 ALA A 161 ? ? -116.20 77.02 3 1 LYS A 179 ? ? -115.38 50.78 4 1 ALA B 109 ? ? 70.39 163.88 5 1 ALA B 161 ? ? -113.92 74.46 6 1 LYS B 179 ? ? -119.36 54.67 7 1 VAL B 186 ? ? -141.33 35.28 8 1 ALA C 109 ? ? 69.37 164.44 9 1 LYS C 153 ? ? -67.95 6.15 10 1 ALA C 161 ? ? -116.69 72.78 11 1 ASN C 174 ? ? -94.40 31.36 12 1 LYS C 179 ? ? -119.98 51.49 13 1 VAL C 186 ? ? -141.57 34.10 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 2 ? CG ? A GLU 2 CG 2 1 Y 1 A GLU 2 ? CD ? A GLU 2 CD 3 1 Y 1 A GLU 2 ? OE1 ? A GLU 2 OE1 4 1 Y 1 A GLU 2 ? OE2 ? A GLU 2 OE2 5 1 Y 1 A GLU 54 ? CG ? A GLU 54 CG 6 1 Y 1 A GLU 54 ? CD ? A GLU 54 CD 7 1 Y 1 A GLU 54 ? OE1 ? A GLU 54 OE1 8 1 Y 1 A GLU 54 ? OE2 ? A GLU 54 OE2 9 1 Y 1 A LYS 77 ? CD ? A LYS 77 CD 10 1 Y 1 A LYS 77 ? CE ? A LYS 77 CE 11 1 Y 1 A LYS 77 ? NZ ? A LYS 77 NZ 12 1 Y 1 A GLU 92 ? CG ? A GLU 92 CG 13 1 Y 1 A GLU 92 ? CD ? A GLU 92 CD 14 1 Y 1 A GLU 92 ? OE1 ? A GLU 92 OE1 15 1 Y 1 A GLU 92 ? OE2 ? A GLU 92 OE2 16 1 Y 1 A LYS 100 ? CE ? A LYS 100 CE 17 1 Y 1 A LYS 100 ? NZ ? A LYS 100 NZ 18 1 Y 1 A LYS 145 ? CG ? A LYS 145 CG 19 1 Y 1 A LYS 145 ? CD ? A LYS 145 CD 20 1 Y 1 A LYS 145 ? CE ? A LYS 145 CE 21 1 Y 1 A LYS 145 ? NZ ? A LYS 145 NZ 22 1 Y 1 A LYS 196 ? CG ? A LYS 196 CG 23 1 Y 1 A LYS 196 ? CD ? A LYS 196 CD 24 1 Y 1 A LYS 196 ? CE ? A LYS 196 CE 25 1 Y 1 A LYS 196 ? NZ ? A LYS 196 NZ 26 1 Y 1 A VAL 197 ? CG1 ? A VAL 197 CG1 27 1 Y 1 A VAL 197 ? CG2 ? A VAL 197 CG2 28 1 Y 1 B GLU 2 ? CG ? B GLU 2 CG 29 1 Y 1 B GLU 2 ? CD ? B GLU 2 CD 30 1 Y 1 B GLU 2 ? OE1 ? B GLU 2 OE1 31 1 Y 1 B GLU 2 ? OE2 ? B GLU 2 OE2 32 1 Y 1 B LYS 77 ? CG ? B LYS 77 CG 33 1 Y 1 B LYS 77 ? CD ? B LYS 77 CD 34 1 Y 1 B LYS 77 ? CE ? B LYS 77 CE 35 1 Y 1 B LYS 77 ? NZ ? B LYS 77 NZ 36 1 Y 1 B GLU 140 ? CG ? B GLU 140 CG 37 1 Y 1 B GLU 140 ? CD ? B GLU 140 CD 38 1 Y 1 B GLU 140 ? OE1 ? B GLU 140 OE1 39 1 Y 1 B GLU 140 ? OE2 ? B GLU 140 OE2 40 1 Y 1 B LYS 145 ? CG ? B LYS 145 CG 41 1 Y 1 B LYS 145 ? CD ? B LYS 145 CD 42 1 Y 1 B LYS 145 ? CE ? B LYS 145 CE 43 1 Y 1 B LYS 145 ? NZ ? B LYS 145 NZ 44 1 Y 1 B GLU 148 ? CG ? B GLU 148 CG 45 1 Y 1 B GLU 148 ? CD ? B GLU 148 CD 46 1 Y 1 B GLU 148 ? OE1 ? B GLU 148 OE1 47 1 Y 1 B GLU 148 ? OE2 ? B GLU 148 OE2 48 1 Y 1 B GLU 156 ? CG ? B GLU 156 CG 49 1 Y 1 B GLU 156 ? CD ? B GLU 156 CD 50 1 Y 1 B GLU 156 ? OE1 ? B GLU 156 OE1 51 1 Y 1 B GLU 156 ? OE2 ? B GLU 156 OE2 52 1 Y 1 B LYS 198 ? CG ? B LYS 198 CG 53 1 Y 1 B LYS 198 ? CD ? B LYS 198 CD 54 1 Y 1 B LYS 198 ? CE ? B LYS 198 CE 55 1 Y 1 B LYS 198 ? NZ ? B LYS 198 NZ 56 1 Y 1 B ARG 199 ? CG ? B ARG 199 CG 57 1 Y 1 B ARG 199 ? CD ? B ARG 199 CD 58 1 Y 1 B ARG 199 ? NE ? B ARG 199 NE 59 1 Y 1 B ARG 199 ? CZ ? B ARG 199 CZ 60 1 Y 1 B ARG 199 ? NH1 ? B ARG 199 NH1 61 1 Y 1 B ARG 199 ? NH2 ? B ARG 199 NH2 62 1 Y 1 C GLU 2 ? CD ? C GLU 2 CD 63 1 Y 1 C GLU 2 ? OE1 ? C GLU 2 OE1 64 1 Y 1 C GLU 2 ? OE2 ? C GLU 2 OE2 65 1 Y 1 C GLU 29 ? CG ? C GLU 29 CG 66 1 Y 1 C GLU 29 ? CD ? C GLU 29 CD 67 1 Y 1 C GLU 29 ? OE1 ? C GLU 29 OE1 68 1 Y 1 C GLU 29 ? OE2 ? C GLU 29 OE2 69 1 Y 1 C LYS 50 ? CG ? C LYS 50 CG 70 1 Y 1 C LYS 50 ? CD ? C LYS 50 CD 71 1 Y 1 C LYS 50 ? CE ? C LYS 50 CE 72 1 Y 1 C LYS 50 ? NZ ? C LYS 50 NZ 73 1 Y 1 C GLU 54 ? CG ? C GLU 54 CG 74 1 Y 1 C GLU 54 ? CD ? C GLU 54 CD 75 1 Y 1 C GLU 54 ? OE1 ? C GLU 54 OE1 76 1 Y 1 C GLU 54 ? OE2 ? C GLU 54 OE2 77 1 Y 1 C ILE 97 ? CB ? C ILE 97 CB 78 1 Y 1 C ILE 97 ? CG1 ? C ILE 97 CG1 79 1 Y 1 C ILE 97 ? CG2 ? C ILE 97 CG2 80 1 Y 1 C ILE 97 ? CD1 ? C ILE 97 CD1 81 1 Y 1 C LYS 103 ? CG ? C LYS 103 CG 82 1 Y 1 C LYS 103 ? CD ? C LYS 103 CD 83 1 Y 1 C LYS 103 ? CE ? C LYS 103 CE 84 1 Y 1 C LYS 103 ? NZ ? C LYS 103 NZ 85 1 Y 1 C GLU 115 ? CG ? C GLU 115 CG 86 1 Y 1 C GLU 115 ? CD ? C GLU 115 CD 87 1 Y 1 C GLU 115 ? OE1 ? C GLU 115 OE1 88 1 Y 1 C GLU 115 ? OE2 ? C GLU 115 OE2 89 1 Y 1 C GLN 116 ? CG ? C GLN 116 CG 90 1 Y 1 C GLN 116 ? CD ? C GLN 116 CD 91 1 Y 1 C GLN 116 ? OE1 ? C GLN 116 OE1 92 1 Y 1 C GLN 116 ? NE2 ? C GLN 116 NE2 93 1 Y 1 C ARG 118 ? CG ? C ARG 118 CG 94 1 Y 1 C ARG 118 ? CD ? C ARG 118 CD 95 1 Y 1 C ARG 118 ? NE ? C ARG 118 NE 96 1 Y 1 C ARG 118 ? CZ ? C ARG 118 CZ 97 1 Y 1 C ARG 118 ? NH1 ? C ARG 118 NH1 98 1 Y 1 C ARG 118 ? NH2 ? C ARG 118 NH2 99 1 Y 1 C LEU 121 ? CG ? C LEU 121 CG 100 1 Y 1 C LEU 121 ? CD1 ? C LEU 121 CD1 101 1 Y 1 C LEU 121 ? CD2 ? C LEU 121 CD2 102 1 Y 1 C GLU 122 ? CG ? C GLU 122 CG 103 1 Y 1 C GLU 122 ? CD ? C GLU 122 CD 104 1 Y 1 C GLU 122 ? OE1 ? C GLU 122 OE1 105 1 Y 1 C GLU 122 ? OE2 ? C GLU 122 OE2 106 1 Y 1 C LYS 123 ? CG ? C LYS 123 CG 107 1 Y 1 C LYS 123 ? CD ? C LYS 123 CD 108 1 Y 1 C LYS 123 ? CE ? C LYS 123 CE 109 1 Y 1 C LYS 123 ? NZ ? C LYS 123 NZ 110 1 Y 1 C LEU 124 ? CG ? C LEU 124 CG 111 1 Y 1 C LEU 124 ? CD1 ? C LEU 124 CD1 112 1 Y 1 C LEU 124 ? CD2 ? C LEU 124 CD2 113 1 Y 1 C TYR 125 ? CG ? C TYR 125 CG 114 1 Y 1 C TYR 125 ? CD1 ? C TYR 125 CD1 115 1 Y 1 C TYR 125 ? CD2 ? C TYR 125 CD2 116 1 Y 1 C TYR 125 ? CE1 ? C TYR 125 CE1 117 1 Y 1 C TYR 125 ? CE2 ? C TYR 125 CE2 118 1 Y 1 C TYR 125 ? CZ ? C TYR 125 CZ 119 1 Y 1 C TYR 125 ? OH ? C TYR 125 OH 120 1 Y 1 C VAL 128 ? CB ? C VAL 128 CB 121 1 Y 1 C VAL 128 ? CG1 ? C VAL 128 CG1 122 1 Y 1 C VAL 128 ? CG2 ? C VAL 128 CG2 123 1 Y 1 C LYS 129 ? CG ? C LYS 129 CG 124 1 Y 1 C LYS 129 ? CD ? C LYS 129 CD 125 1 Y 1 C LYS 129 ? CE ? C LYS 129 CE 126 1 Y 1 C LYS 129 ? NZ ? C LYS 129 NZ 127 1 Y 1 C LYS 145 ? CG ? C LYS 145 CG 128 1 Y 1 C LYS 145 ? CD ? C LYS 145 CD 129 1 Y 1 C LYS 145 ? CE ? C LYS 145 CE 130 1 Y 1 C LYS 145 ? NZ ? C LYS 145 NZ 131 1 Y 1 C GLU 156 ? CB ? C GLU 156 CB 132 1 Y 1 C GLU 156 ? CG ? C GLU 156 CG 133 1 Y 1 C GLU 156 ? CD ? C GLU 156 CD 134 1 Y 1 C GLU 156 ? OE1 ? C GLU 156 OE1 135 1 Y 1 C GLU 156 ? OE2 ? C GLU 156 OE2 136 1 Y 1 C LEU 158 ? CB ? C LEU 158 CB 137 1 Y 1 C LEU 158 ? CG ? C LEU 158 CG 138 1 Y 1 C LEU 158 ? CD1 ? C LEU 158 CD1 139 1 Y 1 C LEU 158 ? CD2 ? C LEU 158 CD2 140 1 Y 1 C LYS 166 ? CG ? C LYS 166 CG 141 1 Y 1 C LYS 166 ? CD ? C LYS 166 CD 142 1 Y 1 C LYS 166 ? CE ? C LYS 166 CE 143 1 Y 1 C LYS 166 ? NZ ? C LYS 166 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A LYS 198 ? A LYS 198 3 1 Y 1 A ARG 199 ? A ARG 199 4 1 Y 1 A ALA 200 ? A ALA 200 5 1 Y 1 A PRO 201 ? A PRO 201 6 1 Y 1 A TYR 202 ? A TYR 202 7 1 Y 1 A GLU 203 ? A GLU 203 8 1 Y 1 A TYR 204 ? A TYR 204 9 1 Y 1 A ARG 205 ? A ARG 205 10 1 Y 1 A LYS 206 ? A LYS 206 11 1 Y 1 A LEU 207 ? A LEU 207 12 1 Y 1 A GLY 208 ? A GLY 208 13 1 Y 1 A GLN 209 ? A GLN 209 14 1 Y 1 A GLU 210 ? A GLU 210 15 1 Y 1 A TRP 211 ? A TRP 211 16 1 Y 1 A LYS 212 ? A LYS 212 17 1 Y 1 A TYR 213 ? A TYR 213 18 1 Y 1 A ARG 214 ? A ARG 214 19 1 Y 1 A LEU 215 ? A LEU 215 20 1 Y 1 A GLU 216 ? A GLU 216 21 1 Y 1 A LYS 217 ? A LYS 217 22 1 Y 1 A GLU 218 ? A GLU 218 23 1 Y 1 A PRO 219 ? A PRO 219 24 1 Y 1 A TRP 220 ? A TRP 220 25 1 Y 1 A ARG 221 ? A ARG 221 26 1 Y 1 A TYR 222 ? A TYR 222 27 1 Y 1 A LYS 223 ? A LYS 223 28 1 Y 1 A ARG 224 ? A ARG 224 29 1 Y 1 A MET 225 ? A MET 225 30 1 Y 1 A MET 226 ? A MET 226 31 1 Y 1 A ALA 227 ? A ALA 227 32 1 Y 1 A LEU 228 ? A LEU 228 33 1 Y 1 A PRO 229 ? A PRO 229 34 1 Y 1 A LYS 230 ? A LYS 230 35 1 Y 1 A PHE 231 ? A PHE 231 36 1 Y 1 A ALA 232 ? A ALA 232 37 1 Y 1 A ILE 233 ? A ILE 233 38 1 Y 1 A LYS 234 ? A LYS 234 39 1 Y 1 A VAL 235 ? A VAL 235 40 1 Y 1 A LEU 236 ? A LEU 236 41 1 Y 1 A LEU 237 ? A LEU 237 42 1 Y 1 A HIS 238 ? A HIS 238 43 1 Y 1 A LYS 239 ? A LYS 239 44 1 Y 1 A ARG 240 ? A ARG 240 45 1 Y 1 A GLU 241 ? A GLU 241 46 1 Y 1 A VAL 242 ? A VAL 242 47 1 Y 1 A VAL 243 ? A VAL 243 48 1 Y 1 A ARG 244 ? A ARG 244 49 1 Y 1 B MET 1 ? B MET 1 50 1 Y 1 B ALA 200 ? B ALA 200 51 1 Y 1 B PRO 201 ? B PRO 201 52 1 Y 1 B TYR 202 ? B TYR 202 53 1 Y 1 B GLU 203 ? B GLU 203 54 1 Y 1 B TYR 204 ? B TYR 204 55 1 Y 1 B ARG 205 ? B ARG 205 56 1 Y 1 B LYS 206 ? B LYS 206 57 1 Y 1 B LEU 207 ? B LEU 207 58 1 Y 1 B GLY 208 ? B GLY 208 59 1 Y 1 B GLN 209 ? B GLN 209 60 1 Y 1 B GLU 210 ? B GLU 210 61 1 Y 1 B TRP 211 ? B TRP 211 62 1 Y 1 B LYS 212 ? B LYS 212 63 1 Y 1 B TYR 213 ? B TYR 213 64 1 Y 1 B ARG 214 ? B ARG 214 65 1 Y 1 B LEU 215 ? B LEU 215 66 1 Y 1 B GLU 216 ? B GLU 216 67 1 Y 1 B LYS 217 ? B LYS 217 68 1 Y 1 B GLU 218 ? B GLU 218 69 1 Y 1 B PRO 219 ? B PRO 219 70 1 Y 1 B TRP 220 ? B TRP 220 71 1 Y 1 B ARG 221 ? B ARG 221 72 1 Y 1 B TYR 222 ? B TYR 222 73 1 Y 1 B LYS 223 ? B LYS 223 74 1 Y 1 B ARG 224 ? B ARG 224 75 1 Y 1 B MET 225 ? B MET 225 76 1 Y 1 B MET 226 ? B MET 226 77 1 Y 1 B ALA 227 ? B ALA 227 78 1 Y 1 B LEU 228 ? B LEU 228 79 1 Y 1 B PRO 229 ? B PRO 229 80 1 Y 1 B LYS 230 ? B LYS 230 81 1 Y 1 B PHE 231 ? B PHE 231 82 1 Y 1 B ALA 232 ? B ALA 232 83 1 Y 1 B ILE 233 ? B ILE 233 84 1 Y 1 B LYS 234 ? B LYS 234 85 1 Y 1 B VAL 235 ? B VAL 235 86 1 Y 1 B LEU 236 ? B LEU 236 87 1 Y 1 B LEU 237 ? B LEU 237 88 1 Y 1 B HIS 238 ? B HIS 238 89 1 Y 1 B LYS 239 ? B LYS 239 90 1 Y 1 B ARG 240 ? B ARG 240 91 1 Y 1 B GLU 241 ? B GLU 241 92 1 Y 1 B VAL 242 ? B VAL 242 93 1 Y 1 B VAL 243 ? B VAL 243 94 1 Y 1 B ARG 244 ? B ARG 244 95 1 Y 1 C LYS 196 ? C LYS 196 96 1 Y 1 C VAL 197 ? C VAL 197 97 1 Y 1 C LYS 198 ? C LYS 198 98 1 Y 1 C ARG 199 ? C ARG 199 99 1 Y 1 C ALA 200 ? C ALA 200 100 1 Y 1 C PRO 201 ? C PRO 201 101 1 Y 1 C TYR 202 ? C TYR 202 102 1 Y 1 C GLU 203 ? C GLU 203 103 1 Y 1 C TYR 204 ? C TYR 204 104 1 Y 1 C ARG 205 ? C ARG 205 105 1 Y 1 C LYS 206 ? C LYS 206 106 1 Y 1 C LEU 207 ? C LEU 207 107 1 Y 1 C GLY 208 ? C GLY 208 108 1 Y 1 C GLN 209 ? C GLN 209 109 1 Y 1 C GLU 210 ? C GLU 210 110 1 Y 1 C TRP 211 ? C TRP 211 111 1 Y 1 C LYS 212 ? C LYS 212 112 1 Y 1 C TYR 213 ? C TYR 213 113 1 Y 1 C ARG 214 ? C ARG 214 114 1 Y 1 C LEU 215 ? C LEU 215 115 1 Y 1 C GLU 216 ? C GLU 216 116 1 Y 1 C LYS 217 ? C LYS 217 117 1 Y 1 C GLU 218 ? C GLU 218 118 1 Y 1 C PRO 219 ? C PRO 219 119 1 Y 1 C TRP 220 ? C TRP 220 120 1 Y 1 C ARG 221 ? C ARG 221 121 1 Y 1 C TYR 222 ? C TYR 222 122 1 Y 1 C LYS 223 ? C LYS 223 123 1 Y 1 C ARG 224 ? C ARG 224 124 1 Y 1 C MET 225 ? C MET 225 125 1 Y 1 C MET 226 ? C MET 226 126 1 Y 1 C ALA 227 ? C ALA 227 127 1 Y 1 C LEU 228 ? C LEU 228 128 1 Y 1 C PRO 229 ? C PRO 229 129 1 Y 1 C LYS 230 ? C LYS 230 130 1 Y 1 C PHE 231 ? C PHE 231 131 1 Y 1 C ALA 232 ? C ALA 232 132 1 Y 1 C ILE 233 ? C ILE 233 133 1 Y 1 C LYS 234 ? C LYS 234 134 1 Y 1 C VAL 235 ? C VAL 235 135 1 Y 1 C LEU 236 ? C LEU 236 136 1 Y 1 C LEU 237 ? C LEU 237 137 1 Y 1 C HIS 238 ? C HIS 238 138 1 Y 1 C LYS 239 ? C LYS 239 139 1 Y 1 C ARG 240 ? C ARG 240 140 1 Y 1 C GLU 241 ? C GLU 241 141 1 Y 1 C VAL 242 ? C VAL 242 142 1 Y 1 C VAL 243 ? C VAL 243 143 1 Y 1 C ARG 244 ? C ARG 244 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 UD9 C01 C N N 369 UD9 C02 C N N 370 UD9 C05 C N S 371 UD9 C06 C N R 372 UD9 C07 C N S 373 UD9 C08 C N R 374 UD9 C10 C N R 375 UD9 C20 C N N 376 UD9 C21 C N R 377 UD9 C22 C N S 378 UD9 C23 C N R 379 UD9 C24 C N R 380 UD9 C27 C N N 381 UD9 C28 C N N 382 UD9 C29 C N N 383 UD9 C32 C N N 384 UD9 C36 C N N 385 UD9 N04 N N N 386 UD9 N26 N N N 387 UD9 N31 N N N 388 UD9 O03 O N N 389 UD9 O09 O N N 390 UD9 O11 O N N 391 UD9 O13 O N N 392 UD9 O14 O N N 393 UD9 O15 O N N 394 UD9 O17 O N N 395 UD9 O18 O N N 396 UD9 O19 O N N 397 UD9 O25 O N N 398 UD9 O30 O N N 399 UD9 O33 O N N 400 UD9 O34 O N N 401 UD9 O35 O N N 402 UD9 O37 O N N 403 UD9 O38 O N N 404 UD9 O39 O N N 405 UD9 P12 P N N 406 UD9 P16 P N N 407 UD9 H1 H N N 408 UD9 H2 H N N 409 UD9 H3 H N N 410 UD9 H4 H N N 411 UD9 H5 H N N 412 UD9 H6 H N N 413 UD9 H7 H N N 414 UD9 H8 H N N 415 UD9 H9 H N N 416 UD9 H10 H N N 417 UD9 H11 H N N 418 UD9 H12 H N N 419 UD9 H13 H N N 420 UD9 H14 H N N 421 UD9 H15 H N N 422 UD9 H16 H N N 423 UD9 H17 H N N 424 UD9 H18 H N N 425 UD9 H19 H N N 426 UD9 H20 H N N 427 UD9 H21 H N N 428 UD9 H22 H N N 429 UD9 H23 H N N 430 UD9 H24 H N N 431 UD9 H25 H N N 432 UD9 H26 H N N 433 UD9 H27 H N N 434 VAL N N N N 435 VAL CA C N S 436 VAL C C N N 437 VAL O O N N 438 VAL CB C N N 439 VAL CG1 C N N 440 VAL CG2 C N N 441 VAL OXT O N N 442 VAL H H N N 443 VAL H2 H N N 444 VAL HA H N N 445 VAL HB H N N 446 VAL HG11 H N N 447 VAL HG12 H N N 448 VAL HG13 H N N 449 VAL HG21 H N N 450 VAL HG22 H N N 451 VAL HG23 H N N 452 VAL HXT H N N 453 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 UD9 O14 P12 doub N N 356 UD9 O39 C06 sing N N 357 UD9 O38 C07 sing N N 358 UD9 P12 O13 sing N N 359 UD9 P12 O11 sing N N 360 UD9 P12 O15 sing N N 361 UD9 O18 P16 doub N N 362 UD9 C07 C06 sing N N 363 UD9 C07 C08 sing N N 364 UD9 O11 C10 sing N N 365 UD9 N04 C05 sing N N 366 UD9 N04 C02 sing N N 367 UD9 O03 C02 doub N N 368 UD9 C06 C05 sing N N 369 UD9 C36 C08 sing N N 370 UD9 C36 O37 sing N N 371 UD9 C10 C05 sing N N 372 UD9 C10 O09 sing N N 373 UD9 O19 P16 sing N N 374 UD9 O19 C20 sing N N 375 UD9 O35 C22 sing N N 376 UD9 O15 P16 sing N N 377 UD9 P16 O17 sing N N 378 UD9 C02 C01 sing N N 379 UD9 C08 O09 sing N N 380 UD9 O34 C23 sing N N 381 UD9 C20 C21 sing N N 382 UD9 C21 C22 sing N N 383 UD9 C21 O25 sing N N 384 UD9 C22 C23 sing N N 385 UD9 C23 C24 sing N N 386 UD9 O25 C24 sing N N 387 UD9 C24 N26 sing N N 388 UD9 N26 C27 sing N N 389 UD9 N26 C32 sing N N 390 UD9 C27 C28 doub N N 391 UD9 O33 C32 doub N N 392 UD9 C32 N31 sing N N 393 UD9 C28 C29 sing N N 394 UD9 N31 C29 sing N N 395 UD9 C29 O30 doub N N 396 UD9 C01 H1 sing N N 397 UD9 C01 H2 sing N N 398 UD9 C01 H3 sing N N 399 UD9 C05 H4 sing N N 400 UD9 C06 H5 sing N N 401 UD9 C07 H6 sing N N 402 UD9 C08 H7 sing N N 403 UD9 C10 H8 sing N N 404 UD9 C20 H9 sing N N 405 UD9 C20 H10 sing N N 406 UD9 C21 H11 sing N N 407 UD9 C22 H12 sing N N 408 UD9 C23 H13 sing N N 409 UD9 C24 H14 sing N N 410 UD9 C27 H15 sing N N 411 UD9 C28 H16 sing N N 412 UD9 C36 H17 sing N N 413 UD9 C36 H18 sing N N 414 UD9 N04 H19 sing N N 415 UD9 N31 H20 sing N N 416 UD9 O13 H21 sing N N 417 UD9 O17 H22 sing N N 418 UD9 O34 H23 sing N N 419 UD9 O35 H24 sing N N 420 UD9 O37 H25 sing N N 421 UD9 O38 H26 sing N N 422 UD9 O39 H27 sing N N 423 VAL N CA sing N N 424 VAL N H sing N N 425 VAL N H2 sing N N 426 VAL CA C sing N N 427 VAL CA CB sing N N 428 VAL CA HA sing N N 429 VAL C O doub N N 430 VAL C OXT sing N N 431 VAL CB CG1 sing N N 432 VAL CB CG2 sing N N 433 VAL CB HB sing N N 434 VAL CG1 HG11 sing N N 435 VAL CG1 HG12 sing N N 436 VAL CG1 HG13 sing N N 437 VAL CG2 HG21 sing N N 438 VAL CG2 HG22 sing N N 439 VAL CG2 HG23 sing N N 440 VAL OXT HXT sing N N 441 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number AI52217 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id UD9 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id UD9 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name ;(2R,3S,4R,5S,6R)-3-acetamido-4,5-dihydroxy-6-(hydroxymethyl)oxan-2-yl [(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxyoxolan-2-yl]methyl dihydrogen diphosphate (non-preferred name) ; _pdbx_entity_nonpoly.comp_id UD9 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 7MPK _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'equilibrium centrifugation' _pdbx_struct_assembly_auth_evidence.details ;Sedimentation equilibrium experiments fit a monomer-dimer equilibrium best for the protein construct. Additionally, EPPIC predicts the protein structure is a biological monomer. ; #