data_7NE8 # _entry.id 7NE8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7NE8 pdb_00007ne8 10.2210/pdb7ne8/pdb WWPDB D_1292113765 ? ? BMRB 34598 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Tick salivary protein BSAP1' _pdbx_database_related.db_id 34598 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7NE8 _pdbx_database_status.recvd_initial_deposition_date 2021-02-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Denisov, S.S.' 1 0000-0001-5460-940X 'Ippel, J.H.' 2 0000-0001-6589-6678 'Castoldi, E.' 3 ? 'Hackeng, T.M.' 4 0000-0003-0142-0843 'Dijkgraaf, I.' 5 0000-0003-4586-3646 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Biol.Chem. _citation.journal_id_ASTM JBCHA3 _citation.journal_id_CSD 0071 _citation.journal_id_ISSN 1083-351X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 297 _citation.language ? _citation.page_first 100865 _citation.page_last 100865 _citation.title 'Molecular basis of anticoagulant and anticomplement activity of the tick salivary protein Salp14 and its homologs.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jbc.2021.100865 _citation.pdbx_database_id_PubMed 34118237 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Denisov, S.S.' 1 ? primary 'Ippel, J.H.' 2 ? primary 'Castoldi, E.' 3 ? primary 'Mans, B.J.' 4 ? primary 'Hackeng, T.M.' 5 ? primary 'Dijkgraaf, I.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'tick salivary protein BSAP1' _entity.formula_weight 9634.224 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;DSEFPCPRKQQPAGNSECSYYCEMNGQWKLGKFQNGARCDYNAVKDGVCNEGLCYASGDSASNTQNQGGSRRQENEDQGD DEWDRK ; _entity_poly.pdbx_seq_one_letter_code_can ;DSEFPCPRKQQPAGNSECSYYCEMNGQWKLGKFQNGARCDYNAVKDGVCNEGLCYASGDSASNTQNQGGSRRQENEDQGD DEWDRK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 SER n 1 3 GLU n 1 4 PHE n 1 5 PRO n 1 6 CYS n 1 7 PRO n 1 8 ARG n 1 9 LYS n 1 10 GLN n 1 11 GLN n 1 12 PRO n 1 13 ALA n 1 14 GLY n 1 15 ASN n 1 16 SER n 1 17 GLU n 1 18 CYS n 1 19 SER n 1 20 TYR n 1 21 TYR n 1 22 CYS n 1 23 GLU n 1 24 MET n 1 25 ASN n 1 26 GLY n 1 27 GLN n 1 28 TRP n 1 29 LYS n 1 30 LEU n 1 31 GLY n 1 32 LYS n 1 33 PHE n 1 34 GLN n 1 35 ASN n 1 36 GLY n 1 37 ALA n 1 38 ARG n 1 39 CYS n 1 40 ASP n 1 41 TYR n 1 42 ASN n 1 43 ALA n 1 44 VAL n 1 45 LYS n 1 46 ASP n 1 47 GLY n 1 48 VAL n 1 49 CYS n 1 50 ASN n 1 51 GLU n 1 52 GLY n 1 53 LEU n 1 54 CYS n 1 55 TYR n 1 56 ALA n 1 57 SER n 1 58 GLY n 1 59 ASP n 1 60 SER n 1 61 ALA n 1 62 SER n 1 63 ASN n 1 64 THR n 1 65 GLN n 1 66 ASN n 1 67 GLN n 1 68 GLY n 1 69 GLY n 1 70 SER n 1 71 ARG n 1 72 ARG n 1 73 GLN n 1 74 GLU n 1 75 ASN n 1 76 GLU n 1 77 ASP n 1 78 GLN n 1 79 GLY n 1 80 ASP n 1 81 ASP n 1 82 GLU n 1 83 TRP n 1 84 ASP n 1 85 ARG n 1 86 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 86 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Ornithodoros savignyi' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 69826 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 7NE8 _struct_ref.pdbx_db_accession 7NE8 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7NE8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 86 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 7NE8 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 86 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 86 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl.experiment_id 1 _pdbx_nmr_exptl.conditions_id 1 _pdbx_nmr_exptl.solution_id 1 _pdbx_nmr_exptl.type '2D NOESY' _pdbx_nmr_exptl.spectrometer_id 1 _pdbx_nmr_exptl.sample_state isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 20 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label condition_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '350 uM [U-13C; U-15N] tick salivary protein BSAP1, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' _pdbx_nmr_sample_details.label '13C, 15N sample' _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III HD' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 7NE8 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 3 # _pdbx_nmr_ensemble.entry_id 7NE8 _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7NE8 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'chemical shift assignment' NMRFAM-SPARKY ? 'Lee W, Tonelli M, Markley JL' 2 'structure calculation' 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' 3 refinement 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7NE8 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7NE8 _struct.title 'Tick salivary protein BSAP1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7NE8 _struct_keywords.text 'lectin pathway, complement, tick salivary protein, IMMUNOSUPPRESSANT' _struct_keywords.pdbx_keywords IMMUNOSUPPRESSANT # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 22 SG ? ? A CYS 6 A CYS 22 1_555 ? ? ? ? ? ? ? 2.017 ? ? disulf2 disulf ? ? A CYS 18 SG ? ? ? 1_555 A CYS 49 SG ? ? A CYS 18 A CYS 49 1_555 ? ? ? ? ? ? ? 2.044 ? ? disulf3 disulf ? ? A CYS 39 SG ? ? ? 1_555 A CYS 54 SG ? ? A CYS 39 A CYS 54 1_555 ? ? ? ? ? ? ? 2.029 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 CYS A 22 ? MET A 24 ? CYS A 22 MET A 24 AA1 2 GLN A 27 ? LYS A 29 ? GLN A 27 LYS A 29 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id CYS _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 22 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id CYS _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 22 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id LYS _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 29 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id LYS _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 29 # _atom_sites.entry_id 7NE8 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 1 1 ASP ASP A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 MET 24 24 24 MET MET A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 TRP 28 28 28 TRP TRP A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 TYR 41 41 41 TYR TYR A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 CYS 54 54 54 CYS CYS A . n A 1 55 TYR 55 55 55 TYR TYR A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 GLN 73 73 73 GLN GLN A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 GLN 78 78 78 GLN GLN A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 TRP 83 83 83 TRP TRP A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 LYS 86 86 86 LYS LYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 8060 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-06-16 2 'Structure model' 1 1 2021-06-23 3 'Structure model' 1 2 2021-07-28 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' 4 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' citation 3 3 'Structure model' citation_author 4 4 'Structure model' database_2 5 4 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_PubMed' 9 2 'Structure model' '_citation.title' 10 2 'Structure model' '_citation.year' 11 3 'Structure model' '_citation.journal_volume' 12 3 'Structure model' '_citation.title' 13 4 'Structure model' '_database_2.pdbx_DOI' 14 4 'Structure model' '_database_2.pdbx_database_accession' 15 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component 'tick salivary protein BSAP1' _pdbx_nmr_exptl_sample.concentration 350 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units uM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-13C; U-15N]' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 4 H A PHE 33 ? ? HD22 A ASN 50 ? ? 1.27 2 6 H A TYR 20 ? ? H A GLY 31 ? ? 1.24 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 N A TYR 20 ? ? CA A TYR 20 ? ? CB A TYR 20 ? ? 122.76 110.60 12.16 1.80 N 2 2 N A TYR 20 ? ? CA A TYR 20 ? ? CB A TYR 20 ? ? 122.46 110.60 11.86 1.80 N 3 3 N A TYR 20 ? ? CA A TYR 20 ? ? CB A TYR 20 ? ? 122.73 110.60 12.13 1.80 N 4 7 N A TYR 20 ? ? CA A TYR 20 ? ? CB A TYR 20 ? ? 121.71 110.60 11.11 1.80 N 5 8 N A TYR 20 ? ? CA A TYR 20 ? ? CB A TYR 20 ? ? 122.42 110.60 11.82 1.80 N 6 9 N A TYR 20 ? ? CA A TYR 20 ? ? CB A TYR 20 ? ? 122.56 110.60 11.96 1.80 N 7 10 N A TYR 20 ? ? CA A TYR 20 ? ? CB A TYR 20 ? ? 121.64 110.60 11.04 1.80 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? -141.73 -57.60 2 1 GLU A 3 ? ? -155.05 -155.33 3 1 PHE A 4 ? ? 60.47 62.61 4 1 SER A 16 ? ? -169.99 71.76 5 1 GLU A 17 ? ? 168.18 165.79 6 1 ASN A 35 ? ? -44.44 105.38 7 1 CYS A 39 ? ? -117.75 -168.76 8 1 ALA A 43 ? ? -108.70 45.48 9 1 VAL A 44 ? ? -158.71 -39.83 10 1 LYS A 45 ? ? -136.91 -156.47 11 1 ASN A 50 ? ? -178.30 148.14 12 1 GLU A 51 ? ? 85.18 48.04 13 2 GLU A 3 ? ? -144.87 -145.85 14 2 PHE A 4 ? ? 60.47 60.06 15 2 SER A 16 ? ? -167.41 69.48 16 2 GLU A 17 ? ? 166.79 163.70 17 2 ASN A 35 ? ? -49.26 103.90 18 2 ALA A 43 ? ? -109.82 50.50 19 2 VAL A 44 ? ? -160.86 -43.81 20 2 LYS A 45 ? ? -132.40 -155.83 21 2 ASN A 50 ? ? -177.53 146.85 22 2 GLU A 51 ? ? 84.45 51.55 23 2 GLU A 74 ? ? -114.63 75.65 24 3 GLU A 3 ? ? -145.97 -151.29 25 3 PHE A 4 ? ? 61.12 63.16 26 3 CYS A 6 ? ? 179.85 159.54 27 3 SER A 16 ? ? -168.44 69.40 28 3 GLU A 17 ? ? 166.19 162.85 29 3 ASN A 35 ? ? -67.15 88.98 30 3 CYS A 39 ? ? -115.64 -169.65 31 3 VAL A 44 ? ? -155.62 -39.64 32 3 LYS A 45 ? ? -135.41 -157.57 33 3 ASN A 50 ? ? -172.71 149.97 34 3 GLU A 51 ? ? 85.00 55.32 35 3 ALA A 61 ? ? -162.30 -52.72 36 3 GLN A 78 ? ? 64.00 -116.19 37 3 ASP A 84 ? ? 63.91 -146.70 38 4 CYS A 6 ? ? 165.37 150.18 39 4 SER A 16 ? ? -166.65 69.10 40 4 GLU A 17 ? ? 163.85 140.08 41 4 ASN A 35 ? ? -65.26 98.32 42 4 CYS A 39 ? ? -113.65 -169.31 43 4 ASN A 42 ? ? -131.55 -58.38 44 4 GLU A 51 ? ? 82.76 45.72 45 4 SER A 60 ? ? -151.50 -48.29 46 5 SER A 2 ? ? -130.64 -53.42 47 5 GLU A 3 ? ? -154.54 -155.21 48 5 CYS A 6 ? ? 179.24 157.70 49 5 SER A 16 ? ? -166.15 70.88 50 5 GLU A 17 ? ? 168.96 159.81 51 5 ASN A 35 ? ? -41.65 106.45 52 5 ASP A 40 ? ? -88.53 32.85 53 5 VAL A 44 ? ? -146.83 -36.73 54 5 LYS A 45 ? ? -131.25 -155.05 55 5 ASN A 50 ? ? -176.11 144.71 56 5 GLU A 51 ? ? 84.01 54.92 57 5 ARG A 71 ? ? -145.56 -45.66 58 5 GLN A 78 ? ? 63.74 -110.66 59 6 SER A 2 ? ? -142.14 -53.32 60 6 GLU A 3 ? ? -155.46 -158.26 61 6 PHE A 4 ? ? 60.71 61.49 62 6 CYS A 6 ? ? 167.19 143.87 63 6 SER A 16 ? ? -172.58 70.84 64 6 GLU A 17 ? ? 171.21 162.48 65 6 ASN A 35 ? ? -52.11 101.91 66 6 CYS A 39 ? ? -116.76 -168.60 67 6 VAL A 44 ? ? -149.96 -32.21 68 6 ASN A 50 ? ? 179.11 157.11 69 6 GLU A 51 ? ? 82.85 41.01 70 7 GLU A 3 ? ? -148.91 -154.92 71 7 CYS A 6 ? ? 178.11 153.99 72 7 SER A 16 ? ? -170.18 69.60 73 7 GLU A 17 ? ? 169.14 163.77 74 7 ASN A 35 ? ? -47.85 102.72 75 7 CYS A 39 ? ? -115.90 -165.48 76 7 ASN A 42 ? ? -133.62 -53.27 77 7 VAL A 44 ? ? -151.75 -46.76 78 7 ASN A 50 ? ? -179.59 148.89 79 7 GLU A 51 ? ? 85.02 45.03 80 7 ALA A 61 ? ? -158.42 -50.99 81 7 ASP A 77 ? ? -154.04 31.38 82 7 GLN A 78 ? ? 69.02 -165.88 83 8 GLU A 3 ? ? -145.36 -151.93 84 8 PHE A 4 ? ? 61.75 65.11 85 8 SER A 16 ? ? -167.43 70.93 86 8 GLU A 17 ? ? 166.84 179.31 87 8 CYS A 39 ? ? -116.94 -169.79 88 8 ALA A 43 ? ? -106.65 43.85 89 8 VAL A 44 ? ? -159.04 -39.63 90 8 LYS A 45 ? ? -128.85 -164.26 91 8 GLU A 51 ? ? 86.62 50.76 92 8 ALA A 61 ? ? -154.76 -54.84 93 8 GLN A 78 ? ? 63.48 -107.11 94 9 GLU A 3 ? ? -148.28 -153.21 95 9 PHE A 4 ? ? 61.66 65.70 96 9 SER A 16 ? ? -159.04 73.55 97 9 GLU A 17 ? ? 169.64 -178.03 98 9 VAL A 44 ? ? -159.77 -41.07 99 9 LYS A 45 ? ? -131.48 -157.16 100 9 GLU A 51 ? ? 87.43 49.00 101 9 ALA A 61 ? ? -158.14 -65.48 102 9 THR A 64 ? ? -141.18 -52.50 103 9 GLN A 78 ? ? 63.99 -118.73 104 10 GLU A 3 ? ? -150.73 -155.40 105 10 PHE A 4 ? ? 60.87 62.57 106 10 CYS A 6 ? ? 179.83 156.79 107 10 SER A 16 ? ? -170.09 70.87 108 10 GLU A 17 ? ? 167.65 165.96 109 10 ASN A 35 ? ? -52.31 100.70 110 10 CYS A 39 ? ? -117.25 -168.13 111 10 TYR A 41 ? ? -103.15 41.08 112 10 ALA A 43 ? ? -109.07 44.09 113 10 VAL A 44 ? ? -156.89 -34.07 114 10 ASN A 50 ? ? -178.38 147.69 115 10 GLU A 51 ? ? 84.99 49.61 116 10 GLN A 78 ? ? 63.09 -114.88 117 10 ASP A 84 ? ? 63.42 -124.60 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Netherlands Organisation for Scientific Research (NWO)' Netherlands 015.010.005 1 'Netherlands Organisation for Scientific Research (NWO)' Netherlands 723.013.009 2 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #