data_7NVK # _entry.id 7NVK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.384 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7NVK pdb_00007nvk 10.2210/pdb7nvk/pdb WWPDB D_1292114549 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-09-29 2 'Structure model' 1 1 2022-05-11 3 'Structure model' 1 2 2024-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Derived calculations' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' atom_type 4 3 'Structure model' chem_comp_atom 5 3 'Structure model' chem_comp_bond 6 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 3 'Structure model' '_atom_type.pdbx_N_electrons' 13 3 'Structure model' '_atom_type.pdbx_scat_Z' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7NVK _pdbx_database_status.recvd_initial_deposition_date 2021-03-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Manoj Kumar, P.' 1 0000-0002-7083-5690 'Padala, P.' 2 0000-0002-6370-9805 'Isupov, M.N.' 3 0000-0001-6842-4289 'Wiener, R.' 4 0000-0002-4219-550X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 12 _citation.language ? _citation.page_first 5708 _citation.page_last 5708 _citation.title 'Structural basis for UFM1 transfer from UBA5 to UFC1.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-021-25994-6 _citation.pdbx_database_id_PubMed 34588452 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kumar, M.' 1 ? primary 'Padala, P.' 2 ? primary 'Fahoum, J.' 3 ? primary 'Hassouna, F.' 4 ? primary 'Tsaban, T.' 5 ? primary 'Zoltsman, G.' 6 ? primary 'Banerjee, S.' 7 ? primary 'Cohen-Kfir, E.' 8 ? primary 'Dessau, M.' 9 0000-0002-1954-3625 primary 'Rosenzweig, R.' 10 0000-0002-4019-5135 primary 'Isupov, M.N.' 11 ? primary 'Schueler-Furman, O.' 12 0000-0002-1624-0362 primary 'Wiener, R.' 13 0000-0002-4219-550X # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Ubiquitin-like modifier-activating enzyme 5,Ubiquitin-fold modifier-conjugating enzyme 1' _entity.formula_weight 25917.533 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Ubiquitin-activating enzyme 5,ThiFP1,UFM1-activating enzyme,Ubiquitin-activating enzyme E1 domain-containing protein 1,Ufm1-conjugating enzyme 1 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSEVSEEELKNFSGPVPDLPEGITVAYTIPKKQEDSVTELTVEDSGESLEDLMAKMKNMMADEATRRVVSEIPVLKTNAG PRDRELWVQRLKEEYQSLIRYVENNKNADNDWFRLESNKEGTRWFGKCWYIHDLLKYEFDIEFDIPITYPTTAPEIAVPE LDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLIQKGVIQHKEKCNQ ; _entity_poly.pdbx_seq_one_letter_code_can ;GSEVSEEELKNFSGPVPDLPEGITVAYTIPKKQEDSVTELTVEDSGESLEDLMAKMKNMMADEATRRVVSEIPVLKTNAG PRDRELWVQRLKEEYQSLIRYVENNKNADNDWFRLESNKEGTRWFGKCWYIHDLLKYEFDIEFDIPITYPTTAPEIAVPE LDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLIQKGVIQHKEKCNQ ; _entity_poly.pdbx_strand_id AAA _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 GLU n 1 4 VAL n 1 5 SER n 1 6 GLU n 1 7 GLU n 1 8 GLU n 1 9 LEU n 1 10 LYS n 1 11 ASN n 1 12 PHE n 1 13 SER n 1 14 GLY n 1 15 PRO n 1 16 VAL n 1 17 PRO n 1 18 ASP n 1 19 LEU n 1 20 PRO n 1 21 GLU n 1 22 GLY n 1 23 ILE n 1 24 THR n 1 25 VAL n 1 26 ALA n 1 27 TYR n 1 28 THR n 1 29 ILE n 1 30 PRO n 1 31 LYS n 1 32 LYS n 1 33 GLN n 1 34 GLU n 1 35 ASP n 1 36 SER n 1 37 VAL n 1 38 THR n 1 39 GLU n 1 40 LEU n 1 41 THR n 1 42 VAL n 1 43 GLU n 1 44 ASP n 1 45 SER n 1 46 GLY n 1 47 GLU n 1 48 SER n 1 49 LEU n 1 50 GLU n 1 51 ASP n 1 52 LEU n 1 53 MET n 1 54 ALA n 1 55 LYS n 1 56 MET n 1 57 LYS n 1 58 ASN n 1 59 MET n 1 60 MET n 1 61 ALA n 1 62 ASP n 1 63 GLU n 1 64 ALA n 1 65 THR n 1 66 ARG n 1 67 ARG n 1 68 VAL n 1 69 VAL n 1 70 SER n 1 71 GLU n 1 72 ILE n 1 73 PRO n 1 74 VAL n 1 75 LEU n 1 76 LYS n 1 77 THR n 1 78 ASN n 1 79 ALA n 1 80 GLY n 1 81 PRO n 1 82 ARG n 1 83 ASP n 1 84 ARG n 1 85 GLU n 1 86 LEU n 1 87 TRP n 1 88 VAL n 1 89 GLN n 1 90 ARG n 1 91 LEU n 1 92 LYS n 1 93 GLU n 1 94 GLU n 1 95 TYR n 1 96 GLN n 1 97 SER n 1 98 LEU n 1 99 ILE n 1 100 ARG n 1 101 TYR n 1 102 VAL n 1 103 GLU n 1 104 ASN n 1 105 ASN n 1 106 LYS n 1 107 ASN n 1 108 ALA n 1 109 ASP n 1 110 ASN n 1 111 ASP n 1 112 TRP n 1 113 PHE n 1 114 ARG n 1 115 LEU n 1 116 GLU n 1 117 SER n 1 118 ASN n 1 119 LYS n 1 120 GLU n 1 121 GLY n 1 122 THR n 1 123 ARG n 1 124 TRP n 1 125 PHE n 1 126 GLY n 1 127 LYS n 1 128 CYS n 1 129 TRP n 1 130 TYR n 1 131 ILE n 1 132 HIS n 1 133 ASP n 1 134 LEU n 1 135 LEU n 1 136 LYS n 1 137 TYR n 1 138 GLU n 1 139 PHE n 1 140 ASP n 1 141 ILE n 1 142 GLU n 1 143 PHE n 1 144 ASP n 1 145 ILE n 1 146 PRO n 1 147 ILE n 1 148 THR n 1 149 TYR n 1 150 PRO n 1 151 THR n 1 152 THR n 1 153 ALA n 1 154 PRO n 1 155 GLU n 1 156 ILE n 1 157 ALA n 1 158 VAL n 1 159 PRO n 1 160 GLU n 1 161 LEU n 1 162 ASP n 1 163 GLY n 1 164 LYS n 1 165 THR n 1 166 ALA n 1 167 LYS n 1 168 MET n 1 169 TYR n 1 170 ARG n 1 171 GLY n 1 172 GLY n 1 173 LYS n 1 174 ILE n 1 175 CYS n 1 176 LEU n 1 177 THR n 1 178 ASP n 1 179 HIS n 1 180 PHE n 1 181 LYS n 1 182 PRO n 1 183 LEU n 1 184 TRP n 1 185 ALA n 1 186 ARG n 1 187 ASN n 1 188 VAL n 1 189 PRO n 1 190 LYS n 1 191 PHE n 1 192 GLY n 1 193 LEU n 1 194 ALA n 1 195 HIS n 1 196 LEU n 1 197 MET n 1 198 ALA n 1 199 LEU n 1 200 GLY n 1 201 LEU n 1 202 GLY n 1 203 PRO n 1 204 TRP n 1 205 LEU n 1 206 ALA n 1 207 VAL n 1 208 GLU n 1 209 ILE n 1 210 PRO n 1 211 ASP n 1 212 LEU n 1 213 ILE n 1 214 GLN n 1 215 LYS n 1 216 GLY n 1 217 VAL n 1 218 ILE n 1 219 GLN n 1 220 HIS n 1 221 LYS n 1 222 GLU n 1 223 LYS n 1 224 CYS n 1 225 ASN n 1 226 GLN n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 59 Human ? 'UBA5, UBE1DC1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? pET32A ? ? 1 2 sample 'Biological sequence' 60 226 Human ? 'UFC1, CGI-126, HSPC155' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? pET32A ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 0 ? ? ? AAA . n A 1 2 SER 2 1 ? ? ? AAA . n A 1 3 GLU 3 2 ? ? ? AAA . n A 1 4 VAL 4 3 ? ? ? AAA . n A 1 5 SER 5 4 ? ? ? AAA . n A 1 6 GLU 6 5 ? ? ? AAA . n A 1 7 GLU 7 6 ? ? ? AAA . n A 1 8 GLU 8 7 ? ? ? AAA . n A 1 9 LEU 9 8 ? ? ? AAA . n A 1 10 LYS 10 9 ? ? ? AAA . n A 1 11 ASN 11 10 ? ? ? AAA . n A 1 12 PHE 12 11 ? ? ? AAA . n A 1 13 SER 13 12 ? ? ? AAA . n A 1 14 GLY 14 13 ? ? ? AAA . n A 1 15 PRO 15 14 ? ? ? AAA . n A 1 16 VAL 16 15 ? ? ? AAA . n A 1 17 PRO 17 16 ? ? ? AAA . n A 1 18 ASP 18 17 ? ? ? AAA . n A 1 19 LEU 19 18 ? ? ? AAA . n A 1 20 PRO 20 19 ? ? ? AAA . n A 1 21 GLU 21 20 ? ? ? AAA . n A 1 22 GLY 22 21 ? ? ? AAA . n A 1 23 ILE 23 22 ? ? ? AAA . n A 1 24 THR 24 23 ? ? ? AAA . n A 1 25 VAL 25 24 ? ? ? AAA . n A 1 26 ALA 26 25 ? ? ? AAA . n A 1 27 TYR 27 26 ? ? ? AAA . n A 1 28 THR 28 27 ? ? ? AAA . n A 1 29 ILE 29 28 ? ? ? AAA . n A 1 30 PRO 30 29 ? ? ? AAA . n A 1 31 LYS 31 30 ? ? ? AAA . n A 1 32 LYS 32 31 ? ? ? AAA . n A 1 33 GLN 33 32 ? ? ? AAA . n A 1 34 GLU 34 33 ? ? ? AAA . n A 1 35 ASP 35 34 ? ? ? AAA . n A 1 36 SER 36 35 ? ? ? AAA . n A 1 37 VAL 37 36 36 VAL VAL AAA . n A 1 38 THR 38 37 37 THR THR AAA . n A 1 39 GLU 39 38 38 GLU GLU AAA . n A 1 40 LEU 40 39 39 LEU LEU AAA . n A 1 41 THR 41 40 40 THR THR AAA . n A 1 42 VAL 42 41 41 VAL VAL AAA . n A 1 43 GLU 43 42 42 GLU GLU AAA . n A 1 44 ASP 44 43 43 ASP ASP AAA . n A 1 45 SER 45 44 44 SER SER AAA . n A 1 46 GLY 46 45 45 GLY GLY AAA . n A 1 47 GLU 47 46 46 GLU GLU AAA . n A 1 48 SER 48 47 47 SER SER AAA . n A 1 49 LEU 49 48 48 LEU LEU AAA . n A 1 50 GLU 50 49 49 GLU GLU AAA . n A 1 51 ASP 51 50 50 ASP ASP AAA . n A 1 52 LEU 52 51 51 LEU LEU AAA . n A 1 53 MET 53 52 52 MET MET AAA . n A 1 54 ALA 54 53 53 ALA ALA AAA . n A 1 55 LYS 55 54 54 LYS LYS AAA . n A 1 56 MET 56 55 55 MET MET AAA . n A 1 57 LYS 57 56 56 LYS LYS AAA . n A 1 58 ASN 58 57 57 ASN ASN AAA . n A 1 59 MET 59 58 58 MET MET AAA . n A 1 60 MET 60 59 59 MET MET AAA . n A 1 61 ALA 61 60 60 ALA ALA AAA . n A 1 62 ASP 62 61 61 ASP ASP AAA . n A 1 63 GLU 63 62 62 GLU GLU AAA . n A 1 64 ALA 64 63 63 ALA ALA AAA . n A 1 65 THR 65 64 64 THR THR AAA . n A 1 66 ARG 66 65 65 ARG ARG AAA . n A 1 67 ARG 67 66 66 ARG ARG AAA . n A 1 68 VAL 68 67 67 VAL VAL AAA . n A 1 69 VAL 69 68 68 VAL VAL AAA . n A 1 70 SER 70 69 69 SER SER AAA . n A 1 71 GLU 71 70 70 GLU GLU AAA . n A 1 72 ILE 72 71 71 ILE ILE AAA . n A 1 73 PRO 73 72 72 PRO PRO AAA . n A 1 74 VAL 74 73 73 VAL VAL AAA . n A 1 75 LEU 75 74 74 LEU LEU AAA . n A 1 76 LYS 76 75 75 LYS LYS AAA . n A 1 77 THR 77 76 76 THR THR AAA . n A 1 78 ASN 78 77 77 ASN ASN AAA . n A 1 79 ALA 79 78 78 ALA ALA AAA . n A 1 80 GLY 80 79 79 GLY GLY AAA . n A 1 81 PRO 81 80 80 PRO PRO AAA . n A 1 82 ARG 82 81 81 ARG ARG AAA . n A 1 83 ASP 83 82 82 ASP ASP AAA . n A 1 84 ARG 84 83 83 ARG ARG AAA . n A 1 85 GLU 85 84 84 GLU GLU AAA . n A 1 86 LEU 86 85 85 LEU LEU AAA . n A 1 87 TRP 87 86 86 TRP TRP AAA . n A 1 88 VAL 88 87 87 VAL VAL AAA . n A 1 89 GLN 89 88 88 GLN GLN AAA . n A 1 90 ARG 90 89 89 ARG ARG AAA . n A 1 91 LEU 91 90 90 LEU LEU AAA . n A 1 92 LYS 92 91 91 LYS LYS AAA . n A 1 93 GLU 93 92 92 GLU GLU AAA . n A 1 94 GLU 94 93 93 GLU GLU AAA . n A 1 95 TYR 95 94 94 TYR TYR AAA . n A 1 96 GLN 96 95 95 GLN GLN AAA . n A 1 97 SER 97 96 96 SER SER AAA . n A 1 98 LEU 98 97 97 LEU LEU AAA . n A 1 99 ILE 99 98 98 ILE ILE AAA . n A 1 100 ARG 100 99 99 ARG ARG AAA . n A 1 101 TYR 101 100 100 TYR TYR AAA . n A 1 102 VAL 102 101 101 VAL VAL AAA . n A 1 103 GLU 103 102 102 GLU GLU AAA . n A 1 104 ASN 104 103 103 ASN ASN AAA . n A 1 105 ASN 105 104 104 ASN ASN AAA . n A 1 106 LYS 106 105 105 LYS LYS AAA . n A 1 107 ASN 107 106 106 ASN ASN AAA . n A 1 108 ALA 108 107 107 ALA ALA AAA . n A 1 109 ASP 109 108 108 ASP ASP AAA . n A 1 110 ASN 110 109 109 ASN ASN AAA . n A 1 111 ASP 111 110 110 ASP ASP AAA . n A 1 112 TRP 112 111 111 TRP TRP AAA . n A 1 113 PHE 113 112 112 PHE PHE AAA . n A 1 114 ARG 114 113 113 ARG ARG AAA . n A 1 115 LEU 115 114 114 LEU LEU AAA . n A 1 116 GLU 116 115 115 GLU GLU AAA . n A 1 117 SER 117 116 116 SER SER AAA . n A 1 118 ASN 118 117 117 ASN ASN AAA . n A 1 119 LYS 119 118 118 LYS LYS AAA . n A 1 120 GLU 120 119 119 GLU GLU AAA . n A 1 121 GLY 121 120 120 GLY GLY AAA . n A 1 122 THR 122 121 121 THR THR AAA . n A 1 123 ARG 123 122 122 ARG ARG AAA . n A 1 124 TRP 124 123 123 TRP TRP AAA . n A 1 125 PHE 125 124 124 PHE PHE AAA . n A 1 126 GLY 126 125 125 GLY GLY AAA . n A 1 127 LYS 127 126 126 LYS LYS AAA . n A 1 128 CYS 128 127 127 CYS CYS AAA . n A 1 129 TRP 129 128 128 TRP TRP AAA . n A 1 130 TYR 130 129 129 TYR TYR AAA . n A 1 131 ILE 131 130 130 ILE ILE AAA . n A 1 132 HIS 132 131 131 HIS HIS AAA . n A 1 133 ASP 133 132 132 ASP ASP AAA . n A 1 134 LEU 134 133 133 LEU LEU AAA . n A 1 135 LEU 135 134 134 LEU LEU AAA . n A 1 136 LYS 136 135 135 LYS LYS AAA . n A 1 137 TYR 137 136 136 TYR TYR AAA . n A 1 138 GLU 138 137 137 GLU GLU AAA . n A 1 139 PHE 139 138 138 PHE PHE AAA . n A 1 140 ASP 140 139 139 ASP ASP AAA . n A 1 141 ILE 141 140 140 ILE ILE AAA . n A 1 142 GLU 142 141 141 GLU GLU AAA . n A 1 143 PHE 143 142 142 PHE PHE AAA . n A 1 144 ASP 144 143 143 ASP ASP AAA . n A 1 145 ILE 145 144 144 ILE ILE AAA . n A 1 146 PRO 146 145 145 PRO PRO AAA . n A 1 147 ILE 147 146 146 ILE ILE AAA . n A 1 148 THR 148 147 147 THR THR AAA . n A 1 149 TYR 149 148 148 TYR TYR AAA . n A 1 150 PRO 150 149 149 PRO PRO AAA . n A 1 151 THR 151 150 150 THR THR AAA . n A 1 152 THR 152 151 151 THR THR AAA . n A 1 153 ALA 153 152 152 ALA ALA AAA . n A 1 154 PRO 154 153 153 PRO PRO AAA . n A 1 155 GLU 155 154 154 GLU GLU AAA . n A 1 156 ILE 156 155 155 ILE ILE AAA . n A 1 157 ALA 157 156 156 ALA ALA AAA . n A 1 158 VAL 158 157 157 VAL VAL AAA . n A 1 159 PRO 159 158 158 PRO PRO AAA . n A 1 160 GLU 160 159 159 GLU GLU AAA . n A 1 161 LEU 161 160 160 LEU LEU AAA . n A 1 162 ASP 162 161 161 ASP ASP AAA . n A 1 163 GLY 163 162 162 GLY GLY AAA . n A 1 164 LYS 164 163 163 LYS LYS AAA . n A 1 165 THR 165 164 164 THR THR AAA . n A 1 166 ALA 166 165 165 ALA ALA AAA . n A 1 167 LYS 167 166 166 LYS LYS AAA . n A 1 168 MET 168 167 167 MET MET AAA . n A 1 169 TYR 169 168 168 TYR TYR AAA . n A 1 170 ARG 170 169 169 ARG ARG AAA . n A 1 171 GLY 171 170 170 GLY GLY AAA . n A 1 172 GLY 172 171 171 GLY GLY AAA . n A 1 173 LYS 173 172 172 LYS LYS AAA . n A 1 174 ILE 174 173 173 ILE ILE AAA . n A 1 175 CYS 175 174 174 CYS CYS AAA . n A 1 176 LEU 176 175 175 LEU LEU AAA . n A 1 177 THR 177 176 176 THR THR AAA . n A 1 178 ASP 178 177 177 ASP ASP AAA . n A 1 179 HIS 179 178 178 HIS HIS AAA . n A 1 180 PHE 180 179 179 PHE PHE AAA . n A 1 181 LYS 181 180 180 LYS LYS AAA . n A 1 182 PRO 182 181 181 PRO PRO AAA . n A 1 183 LEU 183 182 182 LEU LEU AAA . n A 1 184 TRP 184 183 183 TRP TRP AAA . n A 1 185 ALA 185 184 184 ALA ALA AAA . n A 1 186 ARG 186 185 185 ARG ARG AAA . n A 1 187 ASN 187 186 186 ASN ASN AAA . n A 1 188 VAL 188 187 187 VAL VAL AAA . n A 1 189 PRO 189 188 188 PRO PRO AAA . n A 1 190 LYS 190 189 189 LYS LYS AAA . n A 1 191 PHE 191 190 190 PHE PHE AAA . n A 1 192 GLY 192 191 191 GLY GLY AAA . n A 1 193 LEU 193 192 192 LEU LEU AAA . n A 1 194 ALA 194 193 193 ALA ALA AAA . n A 1 195 HIS 195 194 194 HIS HIS AAA . n A 1 196 LEU 196 195 195 LEU LEU AAA . n A 1 197 MET 197 196 196 MET MET AAA . n A 1 198 ALA 198 197 197 ALA ALA AAA . n A 1 199 LEU 199 198 198 LEU LEU AAA . n A 1 200 GLY 200 199 199 GLY GLY AAA . n A 1 201 LEU 201 200 200 LEU LEU AAA . n A 1 202 GLY 202 201 201 GLY GLY AAA . n A 1 203 PRO 203 202 202 PRO PRO AAA . n A 1 204 TRP 204 203 203 TRP TRP AAA . n A 1 205 LEU 205 204 204 LEU LEU AAA . n A 1 206 ALA 206 205 205 ALA ALA AAA . n A 1 207 VAL 207 206 206 VAL VAL AAA . n A 1 208 GLU 208 207 207 GLU GLU AAA . n A 1 209 ILE 209 208 208 ILE ILE AAA . n A 1 210 PRO 210 209 209 PRO PRO AAA . n A 1 211 ASP 211 210 210 ASP ASP AAA . n A 1 212 LEU 212 211 211 LEU LEU AAA . n A 1 213 ILE 213 212 212 ILE ILE AAA . n A 1 214 GLN 214 213 213 GLN GLN AAA . n A 1 215 LYS 215 214 214 LYS LYS AAA . n A 1 216 GLY 216 215 215 GLY GLY AAA . n A 1 217 VAL 217 216 216 VAL VAL AAA . n A 1 218 ILE 218 217 217 ILE ILE AAA . n A 1 219 GLN 219 218 218 GLN GLN AAA . n A 1 220 HIS 220 219 ? ? ? AAA . n A 1 221 LYS 221 220 ? ? ? AAA . n A 1 222 GLU 222 221 ? ? ? AAA . n A 1 223 LYS 223 222 ? ? ? AAA . n A 1 224 CYS 224 223 ? ? ? AAA . n A 1 225 ASN 225 224 ? ? ? AAA . n A 1 226 GLN 226 225 ? ? ? AAA . n # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0258 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MoRDa ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7NVK _cell.details ? _cell.formula_units_Z ? _cell.length_a 84.630 _cell.length_a_esd ? _cell.length_b 84.630 _cell.length_b_esd ? _cell.length_c 60.770 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7NVK _symmetry.cell_setting ? _symmetry.Int_Tables_number 172 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 64' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7NVK _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.51 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 51 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2% (v/v) Tacsimate pH 7.0, 20% PEG 3350, 0.1M HEPES pH 7.5, 6mM zinc sulfate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 298 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-12-20 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9763 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'BESSY BEAMLINE 14.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9763 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 14.1 _diffrn_source.pdbx_synchrotron_site BESSY # _reflns.B_iso_Wilson_estimate 127.1 _reflns.entry_id 7NVK _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.65 _reflns.d_resolution_low 46.78 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7314 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 20.4 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.1 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.112 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.990 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.65 _reflns_shell.d_res_low 2.78 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 953 _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 21.4 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.6 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.292 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -2.318 _refine.aniso_B[1][2] -1.159 _refine.aniso_B[1][3] -0.000 _refine.aniso_B[2][2] -2.318 _refine.aniso_B[2][3] -0.000 _refine.aniso_B[3][3] 7.519 _refine.B_iso_max ? _refine.B_iso_mean 157.069 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.957 _refine.correlation_coeff_Fo_to_Fc_free 0.968 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7NVK _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.651 _refine.ls_d_res_low 46.78 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7296 _refine.ls_number_reflns_R_free 373 _refine.ls_number_reflns_R_work 6923 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.986 _refine.ls_percent_reflns_R_free 5.112 _refine.ls_R_factor_all 0.219 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2638 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2165 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'BABINET MODEL PLUS MASK' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method NONE _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2Z6O _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details 'Random selection' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.723 _refine.pdbx_overall_ESU_R_Free 0.330 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 23.987 _refine.overall_SU_ML 0.466 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1488 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1488 _refine_hist.d_res_high 2.651 _refine_hist.d_res_low 46.78 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.004 0.012 1524 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 1.454 1.640 2065 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 7.844 5.000 182 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 32.881 22.561 82 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 21.976 15.000 275 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 15.222 15.000 10 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.109 0.200 193 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 0.020 1160 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.268 0.200 749 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.327 0.200 1011 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.202 0.200 51 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.220 0.200 59 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.293 0.200 4 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 22.255 30.794 731 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 30.387 57.365 912 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 23.011 31.576 792 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 30.946 58.287 1152 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 39.925 293.188 6285 ? r_lrange_it ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.651 2.719 . . 29 493 100.0000 . . . 0.544 . 0.436 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.719 2.794 . . 21 516 100.0000 . . . 0.637 . 0.427 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.794 2.875 . . 22 474 100.0000 . . . 0.456 . 0.405 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.875 2.963 . . 30 470 100.0000 . . . 0.457 . 0.391 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.963 3.060 . . 39 438 100.0000 . . . 0.535 . 0.372 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.060 3.167 . . 22 434 100.0000 . . . 0.386 . 0.277 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.167 3.287 . . 24 423 100.0000 . . . 0.359 . 0.273 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.287 3.421 . . 10 417 100.0000 . . . 0.376 . 0.288 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.421 3.572 . . 29 390 100.0000 . . . 0.323 . 0.251 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.572 3.746 . . 17 379 100.0000 . . . 0.358 . 0.264 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.746 3.948 . . 25 341 100.0000 . . . 0.373 . 0.235 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.948 4.187 . . 22 349 100.0000 . . . 0.326 . 0.223 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.187 4.475 . . 14 318 100.0000 . . . 0.307 . 0.207 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.475 4.832 . . 15 292 100.0000 . . . 0.341 . 0.198 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.832 5.291 . . 10 294 100.0000 . . . 0.345 . 0.206 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.291 5.912 . . 4 251 100.0000 . . . 0.448 . 0.205 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.912 6.819 . . 13 218 100.0000 . . . 0.224 . 0.207 . . . . . . . . . . . 'X-RAY DIFFRACTION' 6.819 8.333 . . 8 195 100.0000 . . . 0.181 . 0.187 . . . . . . . . . . . 'X-RAY DIFFRACTION' 8.333 11.710 . . 14 143 100.0000 . . . 0.189 . 0.121 . . . . . . . . . . . 'X-RAY DIFFRACTION' 11.710 46.78 . . 5 88 98.9362 . . . 0.078 . 0.238 . . . . . . . . . . . # _struct.entry_id 7NVK _struct.title 'Crystal structure of UBA5 fragment fused to the N-terminus of UFC1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7NVK _struct_keywords.text ;Ubiquitin like fold modifier enzyme 5 (UBA5), E1, Ubiquitin fold modifier 1 (UFM1), Ubiquitin fold modifier conjugating enzyme 1 (UFC1), UFMYLATION, LIGASE ; _struct_keywords.pdbx_keywords LIGASE # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP UBA5_HUMAN Q9GZZ9 ? 1 SEVSEEELKNFSGPVPDLPEGITVAYTIPKKQEDSVTELTVEDSGESLEDLMAKMKNM 347 2 UNP UFC1_HUMAN Q9Y3C8 ? 1 ;MADEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNADNDWFRLESNKEGTRWFGKCWYIHDLLKYEF DIEFDIPITYPTTAPEIAVPELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLIQKGVIQ HKEKCNQ ; 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7NVK AAA 2 ? 59 ? Q9GZZ9 347 ? 404 ? 1 58 2 2 7NVK AAA 60 ? 226 ? Q9Y3C8 1 ? 167 ? 59 225 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 7NVK _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id AAA _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q9GZZ9 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 0 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 11890 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 48 ? ALA A 61 ? SER AAA 47 ALA AAA 60 1 ? 14 HELX_P HELX_P2 AA2 ASP A 62 ? ILE A 72 ? ASP AAA 61 ILE AAA 71 1 ? 11 HELX_P HELX_P3 AA3 ASP A 83 ? ALA A 108 ? ASP AAA 82 ALA AAA 107 1 ? 26 HELX_P HELX_P4 AA4 TYR A 169 ? LYS A 173 ? TYR AAA 168 LYS AAA 172 5 ? 5 HELX_P HELX_P5 AA5 HIS A 179 ? VAL A 188 ? HIS AAA 178 VAL AAA 187 1 ? 10 HELX_P HELX_P6 AA6 GLY A 192 ? LEU A 199 ? GLY AAA 191 LEU AAA 198 1 ? 8 HELX_P HELX_P7 AA7 GLY A 200 ? LYS A 215 ? GLY AAA 199 LYS AAA 214 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 TYR 149 A . ? TYR 148 AAA PRO 150 A ? PRO 149 AAA 1 1.56 2 VAL 188 A . ? VAL 187 AAA PRO 189 A ? PRO 188 AAA 1 0.11 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 113 ? SER A 117 ? PHE AAA 112 SER AAA 116 AA1 2 TRP A 124 ? ILE A 131 ? TRP AAA 123 ILE AAA 130 AA1 3 LYS A 136 ? ILE A 141 ? LYS AAA 135 ILE AAA 140 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 116 ? N GLU AAA 115 O PHE A 125 ? O PHE AAA 124 AA1 2 3 N GLY A 126 ? N GLY AAA 125 O ILE A 141 ? O ILE AAA 140 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER AAA 44 ? ? -107.96 -166.17 2 1 LEU AAA 51 ? ? -93.68 -66.11 3 1 LYS AAA 75 ? ? -123.16 -65.64 4 1 ARG AAA 83 ? ? 53.45 -123.10 5 1 GLU AAA 119 ? ? -68.25 8.92 6 1 HIS AAA 131 ? ? -164.70 109.91 7 1 ASP AAA 132 ? ? 83.99 25.44 8 1 LEU AAA 133 ? ? 56.34 17.73 9 1 PRO AAA 145 ? ? -44.23 155.64 10 1 PRO AAA 188 ? ? -104.53 41.39 11 1 VAL AAA 206 ? ? -98.75 -72.88 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 AAA GLY 0 ? A GLY 1 2 1 Y 1 AAA SER 1 ? A SER 2 3 1 Y 1 AAA GLU 2 ? A GLU 3 4 1 Y 1 AAA VAL 3 ? A VAL 4 5 1 Y 1 AAA SER 4 ? A SER 5 6 1 Y 1 AAA GLU 5 ? A GLU 6 7 1 Y 1 AAA GLU 6 ? A GLU 7 8 1 Y 1 AAA GLU 7 ? A GLU 8 9 1 Y 1 AAA LEU 8 ? A LEU 9 10 1 Y 1 AAA LYS 9 ? A LYS 10 11 1 Y 1 AAA ASN 10 ? A ASN 11 12 1 Y 1 AAA PHE 11 ? A PHE 12 13 1 Y 1 AAA SER 12 ? A SER 13 14 1 Y 1 AAA GLY 13 ? A GLY 14 15 1 Y 1 AAA PRO 14 ? A PRO 15 16 1 Y 1 AAA VAL 15 ? A VAL 16 17 1 Y 1 AAA PRO 16 ? A PRO 17 18 1 Y 1 AAA ASP 17 ? A ASP 18 19 1 Y 1 AAA LEU 18 ? A LEU 19 20 1 Y 1 AAA PRO 19 ? A PRO 20 21 1 Y 1 AAA GLU 20 ? A GLU 21 22 1 Y 1 AAA GLY 21 ? A GLY 22 23 1 Y 1 AAA ILE 22 ? A ILE 23 24 1 Y 1 AAA THR 23 ? A THR 24 25 1 Y 1 AAA VAL 24 ? A VAL 25 26 1 Y 1 AAA ALA 25 ? A ALA 26 27 1 Y 1 AAA TYR 26 ? A TYR 27 28 1 Y 1 AAA THR 27 ? A THR 28 29 1 Y 1 AAA ILE 28 ? A ILE 29 30 1 Y 1 AAA PRO 29 ? A PRO 30 31 1 Y 1 AAA LYS 30 ? A LYS 31 32 1 Y 1 AAA LYS 31 ? A LYS 32 33 1 Y 1 AAA GLN 32 ? A GLN 33 34 1 Y 1 AAA GLU 33 ? A GLU 34 35 1 Y 1 AAA ASP 34 ? A ASP 35 36 1 Y 1 AAA SER 35 ? A SER 36 37 1 Y 1 AAA HIS 219 ? A HIS 220 38 1 Y 1 AAA LYS 220 ? A LYS 221 39 1 Y 1 AAA GLU 221 ? A GLU 222 40 1 Y 1 AAA LYS 222 ? A LYS 223 41 1 Y 1 AAA CYS 223 ? A CYS 224 42 1 Y 1 AAA ASN 224 ? A ASN 225 43 1 Y 1 AAA GLN 225 ? A GLN 226 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _pdbx_audit_support.funding_organization 'Israel Science Foundation' _pdbx_audit_support.country Israel _pdbx_audit_support.grant_number 1383/17 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2Z6O _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7NVK _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.011816 _atom_sites.fract_transf_matrix[1][2] 0.006822 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013644 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016455 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 C 6 6 2.310 20.844 1.020 10.208 1.589 0.569 0.865 51.651 N 7 7 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 O 8 8 3.049 13.277 2.287 5.701 1.546 0.324 0.867 32.909 S 16 16 6.905 1.468 5.203 22.215 1.438 0.254 1.586 56.172 # loop_