data_7NXI # _entry.id 7NXI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7NXI pdb_00007nxi 10.2210/pdb7nxi/pdb WWPDB D_1292112424 ? ? BMRB 34612 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'PAF-D19S in 50 v/v % DMSO-water solution' _pdbx_database_related.db_id 34612 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7NXI _pdbx_database_status.recvd_initial_deposition_date 2021-03-18 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Czajlik, A.' 1 0000-0002-6812-5454 'Batta, G.' 2 0000-0002-0442-1828 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country CH _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Int J Mol Sci' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1422-0067 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 24 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'DMSO-Induced Unfolding of the Antifungal Disulfide Protein PAF and Its Inactive Variant: A Combined NMR and DSC Study.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.3390/ijms24021208 _citation.pdbx_database_id_PubMed 36674720 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Czajlik, A.' 1 ? primary 'Batta, A.' 2 ? primary 'Kerner, K.' 3 ? primary 'Fizil, A.' 4 ? primary 'Hajdu, D.' 5 ? primary 'Raics, M.' 6 ? primary 'Kover, K.E.' 7 0000-0001-5020-4456 primary 'Batta, G.' 8 0000-0002-0442-1828 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Pc24g00380 protein' _entity.formula_weight 6235.089 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation D19S _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code AKYTGKCTKSKNECKYKNSAGKDTFIKCPKFDNKKCTKDNNKCTVDTYNNAVDCD _entity_poly.pdbx_seq_one_letter_code_can AKYTGKCTKSKNECKYKNSAGKDTFIKCPKFDNKKCTKDNNKCTVDTYNNAVDCD _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 LYS n 1 3 TYR n 1 4 THR n 1 5 GLY n 1 6 LYS n 1 7 CYS n 1 8 THR n 1 9 LYS n 1 10 SER n 1 11 LYS n 1 12 ASN n 1 13 GLU n 1 14 CYS n 1 15 LYS n 1 16 TYR n 1 17 LYS n 1 18 ASN n 1 19 SER n 1 20 ALA n 1 21 GLY n 1 22 LYS n 1 23 ASP n 1 24 THR n 1 25 PHE n 1 26 ILE n 1 27 LYS n 1 28 CYS n 1 29 PRO n 1 30 LYS n 1 31 PHE n 1 32 ASP n 1 33 ASN n 1 34 LYS n 1 35 LYS n 1 36 CYS n 1 37 THR n 1 38 LYS n 1 39 ASP n 1 40 ASN n 1 41 ASN n 1 42 LYS n 1 43 CYS n 1 44 THR n 1 45 VAL n 1 46 ASP n 1 47 THR n 1 48 TYR n 1 49 ASN n 1 50 ASN n 1 51 ALA n 1 52 VAL n 1 53 ASP n 1 54 CYS n 1 55 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 55 _entity_src_gen.gene_src_common_name 'Penicillium chrysogenum' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Pc24g00380, PCH_Pc24g00380' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 500485 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc 10002 _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Penicillium rubens Wisconsin 54-1255' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 500485 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain PAF_D19S _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pSK275pafD19S _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code B6HWK0_PENRW _struct_ref.pdbx_db_accession B6HWK0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code AKYTGKCTKSKNECKYKNDAGKDTFIKCPKFDNKKCTKDNNKCTVDTYNNAVDCD _struct_ref.pdbx_align_begin 38 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7NXI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 55 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession B6HWK0 _struct_ref_seq.db_align_beg 38 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 92 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 55 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 7NXI _struct_ref_seq_dif.mon_id SER _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 19 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code B6HWK0 _struct_ref_seq_dif.db_mon_id ASP _struct_ref_seq_dif.pdbx_seq_db_seq_num 56 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 19 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '2D 1H-1H NOESY' 1 isotropic 3 1 1 '2D 1H-1H TOCSY' 1 isotropic 4 1 1 '3D HNHA' 1 isotropic 5 1 1 '3D HNHB' 1 isotropic 6 1 1 '3D 1H-15N TOCSY' 1 isotropic 7 1 1 '3D 1H-15N NOESY' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 4.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.007 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err 0.0007 _pdbx_nmr_exptl_sample_conditions.ionic_strength_units M _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err 0.05 _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err 0.01 _pdbx_nmr_exptl_sample_conditions.temperature_err 1 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '20 mM [U-100% 2H] acetic acid, 50 % v/v H2O, 50 % v/v [U-100% 2H] DMSO, 1.7 mM [U-100% 15N] PAF D19S, 50% H2O/50% DMSO' _pdbx_nmr_sample_details.solvent_system '50% H2O/50% DMSO' _pdbx_nmr_sample_details.label 15_sample _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details '5 mm sample tube, 500 ul volume' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 7NXI _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 4 # _pdbx_nmr_ensemble.entry_id 7NXI _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'all calculated structures submitted' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7NXI _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 processing TopSpin 3.1 'Bruker Biospin' 2 'chemical shift assignment' 'CcpNmr Analysis' 2.4.2 CCPN 3 'peak picking' 'CcpNmr Analysis' 2.4.2 CCPN 4 'structure calculation' CYANA 2.1 'Guntert, Mumenthaler and Wuthrich' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7NXI _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7NXI _struct.title 'PAF-D19S in 50 v/v % DMSO-water solution' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7NXI _struct_keywords.text 'DISULPHIDE PROTEIN, PAF D19S MUTANT, SOLUTION STRUCTURE, STRUCTURE FROM CYANA 2.1, ANTIMICROBIAL PROTEIN' _struct_keywords.pdbx_keywords 'ANTIMICROBIAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 7 SG ? ? ? 1_555 A CYS 36 SG ? ? A CYS 7 A CYS 36 1_555 ? ? ? ? ? ? ? 1.858 ? ? disulf2 disulf ? ? A CYS 14 SG ? ? ? 1_555 A CYS 43 SG ? ? A CYS 14 A CYS 43 1_555 ? ? ? ? ? ? ? 2.131 ? ? disulf3 disulf ? ? A CYS 28 SG ? ? ? 1_555 A CYS 54 SG ? ? A CYS 28 A CYS 54 1_555 ? ? ? ? ? ? ? 1.875 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 24 ? LYS A 27 ? THR A 24 LYS A 27 AA1 2 GLU A 13 ? TYR A 16 ? GLU A 13 TYR A 16 AA1 3 TYR A 3 ? THR A 8 ? TYR A 3 THR A 8 AA1 4 ASN A 41 ? VAL A 45 ? ASN A 41 VAL A 45 AA1 5 ASP A 53 ? CYS A 54 ? ASP A 53 CYS A 54 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O THR A 24 ? O THR A 24 N TYR A 16 ? N TYR A 16 AA1 2 3 O LYS A 15 ? O LYS A 15 N LYS A 6 ? N LYS A 6 AA1 3 4 N TYR A 3 ? N TYR A 3 O VAL A 45 ? O VAL A 45 AA1 4 5 N THR A 44 ? N THR A 44 O ASP A 53 ? O ASP A 53 # _atom_sites.entry_id 7NXI _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 TYR 3 3 3 TYR TYR A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 CYS 7 7 7 CYS CYS A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 TYR 16 16 16 TYR TYR A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 CYS 43 43 43 CYS CYS A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 CYS 54 54 54 CYS CYS A . n A 1 55 ASP 55 55 55 ASP ASP A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 4020 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-03-30 2 'Structure model' 1 1 2023-02-15 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'acetic acid' 20 ? mM '[U-100% 2H]' 1 H2O 50 ? '% v/v' 'natural abundance' 1 DMSO 50 ? '% v/v' '[U-100% 2H]' 1 'PAF D19S' 1.7 ? mM '[U-100% 15N]' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 SG A CYS 14 ? ? SG A CYS 28 ? ? 1.89 2 3 SG A CYS 36 ? ? SG A CYS 54 ? ? 2.11 3 15 SG A CYS 14 ? ? SG A CYS 28 ? ? 2.12 4 18 SG A CYS 14 ? ? SG A CYS 28 ? ? 1.91 5 18 SG A CYS 14 ? ? SG A CYS 54 ? ? 2.05 6 20 SG A CYS 14 ? ? SG A CYS 28 ? ? 1.94 7 20 SG A CYS 14 ? ? SG A CYS 54 ? ? 2.14 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 18 ? ? -57.98 -177.60 2 1 ALA A 20 ? ? -174.11 -38.29 3 1 PHE A 31 ? ? -62.93 -169.52 4 1 ASN A 33 ? ? -149.48 -41.64 5 1 LYS A 38 ? ? -176.55 131.99 6 1 ASN A 41 ? ? -68.85 -167.12 7 1 ASN A 49 ? ? -164.00 26.93 8 2 ASN A 12 ? ? 63.27 61.06 9 2 ASN A 18 ? ? -61.55 -166.27 10 2 ALA A 20 ? ? -165.03 -37.57 11 2 LYS A 22 ? ? -129.25 -168.36 12 2 PHE A 31 ? ? -57.90 -178.27 13 2 ASN A 33 ? ? -143.84 14.25 14 2 CYS A 36 ? ? -53.91 101.86 15 2 LYS A 38 ? ? -178.74 140.24 16 2 ASN A 41 ? ? -72.88 -167.21 17 2 ASN A 49 ? ? -164.14 26.88 18 3 ASN A 18 ? ? -55.19 177.94 19 3 ALA A 20 ? ? -173.22 -36.91 20 3 ASN A 33 ? ? -145.22 26.28 21 3 LYS A 34 ? ? -153.52 -39.81 22 3 LYS A 35 ? ? -49.55 164.19 23 3 ASN A 41 ? ? -64.54 -169.60 24 3 ASN A 49 ? ? -166.94 28.05 25 4 ASN A 12 ? ? 51.43 85.29 26 4 ASN A 18 ? ? -58.16 -177.24 27 4 ALA A 20 ? ? -169.64 -37.96 28 4 ASN A 33 ? ? -157.37 -56.85 29 4 LYS A 38 ? ? -178.71 138.08 30 4 ASN A 41 ? ? -70.74 -164.14 31 4 ASN A 49 ? ? -163.65 26.55 32 5 ASN A 18 ? ? -61.42 -166.25 33 5 ALA A 20 ? ? -164.82 -37.30 34 5 LYS A 22 ? ? -128.06 -167.22 35 5 PHE A 31 ? ? -64.68 -174.58 36 5 ASN A 33 ? ? -143.27 13.70 37 5 LYS A 34 ? ? -136.08 -40.05 38 5 LYS A 35 ? ? -49.74 151.48 39 5 ASN A 41 ? ? -74.43 -168.40 40 5 ASN A 49 ? ? -168.25 29.46 41 5 CYS A 54 ? ? -58.92 103.61 42 6 ASN A 18 ? ? -58.21 -178.18 43 6 ALA A 20 ? ? -178.51 -34.82 44 6 LYS A 34 ? ? -148.86 -42.10 45 6 ASN A 41 ? ? -69.39 -164.72 46 6 ASN A 49 ? ? -164.54 27.22 47 7 ALA A 20 ? ? -162.59 20.63 48 7 ASN A 33 ? ? -140.81 12.15 49 7 LYS A 34 ? ? -131.88 -40.24 50 7 LYS A 38 ? ? -177.94 134.03 51 7 ASN A 41 ? ? -71.96 -167.67 52 7 ASN A 49 ? ? -165.89 27.68 53 8 ASN A 12 ? ? 51.64 73.97 54 8 ALA A 20 ? ? -165.19 22.31 55 8 PRO A 29 ? ? -69.74 -169.80 56 8 PHE A 31 ? ? -69.75 -178.01 57 8 ASN A 49 ? ? -167.45 28.55 58 8 CYS A 54 ? ? -65.88 -174.72 59 9 ASN A 18 ? ? -55.65 178.41 60 9 ALA A 20 ? ? -171.36 -37.66 61 9 PHE A 31 ? ? -60.01 -172.79 62 9 ASN A 33 ? ? -148.15 16.43 63 9 LYS A 34 ? ? -166.75 29.61 64 9 CYS A 36 ? ? -65.05 91.28 65 9 LYS A 38 ? ? -175.51 126.47 66 9 ASN A 41 ? ? -75.49 -168.20 67 9 ASN A 49 ? ? -166.91 28.22 68 10 LYS A 2 ? ? 66.40 139.04 69 10 ASN A 12 ? ? 63.72 83.51 70 10 ASN A 18 ? ? -53.61 174.51 71 10 LYS A 22 ? ? -167.94 -165.97 72 10 PHE A 31 ? ? -63.06 -175.80 73 10 LYS A 38 ? ? -178.56 137.15 74 10 ASN A 41 ? ? -73.06 -167.69 75 10 ASN A 49 ? ? -159.72 24.46 76 11 ASN A 18 ? ? -56.51 -179.89 77 11 ALA A 20 ? ? -172.44 -37.12 78 11 PHE A 31 ? ? -62.41 -174.09 79 11 ASN A 33 ? ? -154.71 20.63 80 11 LYS A 34 ? ? -147.31 13.26 81 11 ASN A 41 ? ? -58.94 -172.64 82 11 ASN A 49 ? ? -167.45 28.85 83 11 CYS A 54 ? ? -72.74 -168.85 84 12 LYS A 2 ? ? 66.91 132.93 85 12 TYR A 16 ? ? -129.10 -169.34 86 12 ALA A 20 ? ? -170.67 24.89 87 12 PHE A 31 ? ? -59.06 -175.56 88 12 ASN A 33 ? ? -149.39 18.34 89 12 LYS A 34 ? ? -149.36 17.27 90 12 CYS A 36 ? ? -61.12 95.52 91 12 LYS A 38 ? ? -178.83 135.46 92 12 ASN A 41 ? ? -71.33 -169.24 93 12 ASN A 49 ? ? -164.04 26.75 94 13 LYS A 11 ? ? -146.43 17.02 95 13 ASN A 18 ? ? -59.43 -176.72 96 13 ALA A 20 ? ? -174.57 -36.33 97 13 PHE A 31 ? ? -59.70 -173.59 98 13 ASN A 33 ? ? -157.86 22.62 99 13 LYS A 34 ? ? -160.04 23.68 100 13 CYS A 36 ? ? -62.39 92.65 101 13 LYS A 38 ? ? -177.79 126.39 102 13 ASN A 49 ? ? -165.82 28.08 103 14 LYS A 2 ? ? 65.64 111.05 104 14 ASN A 12 ? ? 51.63 81.02 105 14 ALA A 20 ? ? -169.67 25.11 106 14 ASN A 33 ? ? -142.24 12.85 107 14 LYS A 34 ? ? -142.72 12.73 108 14 LYS A 38 ? ? -175.41 126.87 109 14 ASN A 41 ? ? -73.72 -167.23 110 14 ASN A 49 ? ? -164.38 26.79 111 15 ASN A 18 ? ? -61.79 -165.73 112 15 ALA A 20 ? ? -165.87 -37.39 113 15 LYS A 22 ? ? -129.27 -166.66 114 15 PRO A 29 ? ? -69.77 -171.80 115 15 PHE A 31 ? ? -65.79 -176.03 116 15 LYS A 38 ? ? -179.93 145.64 117 15 ASN A 41 ? ? -71.47 -165.70 118 15 ASN A 49 ? ? -169.93 30.44 119 16 LYS A 2 ? ? 66.69 138.60 120 16 LYS A 11 ? ? -140.76 12.53 121 16 ASN A 18 ? ? -57.17 -177.66 122 16 ALA A 20 ? ? -179.21 -33.92 123 16 LYS A 22 ? ? -164.88 32.99 124 16 ASP A 23 ? ? 65.52 143.50 125 16 THR A 24 ? ? -160.82 115.31 126 16 PHE A 31 ? ? -64.41 -174.32 127 16 ASN A 33 ? ? -150.88 18.73 128 16 LYS A 34 ? ? -139.09 -42.00 129 16 ASN A 41 ? ? -75.96 -169.17 130 16 ASN A 49 ? ? -163.64 26.67 131 17 ASN A 18 ? ? -61.76 -165.87 132 17 SER A 19 ? ? -94.22 32.89 133 17 ALA A 20 ? ? -144.65 14.51 134 17 PHE A 31 ? ? -68.80 -173.82 135 17 ASN A 33 ? ? -148.27 15.79 136 17 LYS A 34 ? ? -169.79 39.65 137 17 ASN A 41 ? ? -71.46 -169.98 138 17 ASN A 49 ? ? -162.93 26.02 139 17 CYS A 54 ? ? -58.24 -175.69 140 18 ASN A 18 ? ? -67.28 -173.77 141 18 SER A 19 ? ? -81.50 49.63 142 18 ALA A 20 ? ? -165.20 20.79 143 18 PHE A 31 ? ? -60.21 -172.80 144 18 ASN A 33 ? ? -150.17 -64.76 145 18 ASN A 41 ? ? -74.99 -165.74 146 18 ASN A 49 ? ? -165.37 27.82 147 19 LYS A 2 ? ? 66.94 134.63 148 19 ALA A 20 ? ? -170.40 25.12 149 19 PHE A 31 ? ? -67.91 -173.20 150 19 ASN A 33 ? ? -161.42 26.00 151 19 LYS A 34 ? ? -145.79 -41.84 152 19 LYS A 35 ? ? -59.17 177.02 153 19 LYS A 38 ? ? -178.29 149.31 154 19 ASN A 41 ? ? -71.84 -169.41 155 19 ASN A 49 ? ? -168.25 28.69 156 20 LYS A 2 ? ? 66.06 144.46 157 20 ASN A 12 ? ? 52.02 88.59 158 20 ALA A 20 ? ? -163.78 22.00 159 20 ASN A 33 ? ? -150.36 24.33 160 20 LYS A 34 ? ? -148.45 -41.13 161 20 LYS A 38 ? ? -176.49 148.96 162 20 ASN A 41 ? ? -77.54 -168.30 163 20 ASN A 49 ? ? -150.51 16.39 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'European Regional Development Fund' Hungary GINOP-2.3.2-15-2016-00008 1 'European Regional Development Fund' Hungary GINOP-2.3.3-15-2016-00004 2 'National Research Development and Innovation Office (NKFIH)' Hungary K119509 3 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR relaxation study' _pdbx_struct_assembly_auth_evidence.details ? #