data_7NYL # _entry.id 7NYL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.384 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7NYL pdb_00007nyl 10.2210/pdb7nyl/pdb WWPDB D_1292114826 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-12-22 2 'Structure model' 1 1 2022-03-02 3 'Structure model' 1 2 2022-03-09 4 'Structure model' 1 3 2024-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author 5 4 'Structure model' atom_type 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond 8 4 'Structure model' pdbx_initial_refinement_model 9 4 'Structure model' struct_ncs_dom_lim # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.pdbx_database_id_DOI' 2 2 'Structure model' '_citation.pdbx_database_id_PubMed' 3 2 'Structure model' '_citation.title' 4 2 'Structure model' '_citation.year' 5 2 'Structure model' '_citation_author.identifier_ORCID' 6 2 'Structure model' '_citation_author.name' 7 3 'Structure model' '_citation.journal_volume' 8 3 'Structure model' '_citation.page_first' 9 3 'Structure model' '_citation.page_last' 10 3 'Structure model' '_citation_author.identifier_ORCID' 11 4 'Structure model' '_atom_type.pdbx_N_electrons' 12 4 'Structure model' '_atom_type.pdbx_scat_Z' 13 4 'Structure model' '_struct_ncs_dom_lim.beg_auth_comp_id' 14 4 'Structure model' '_struct_ncs_dom_lim.beg_label_asym_id' 15 4 'Structure model' '_struct_ncs_dom_lim.beg_label_comp_id' 16 4 'Structure model' '_struct_ncs_dom_lim.beg_label_seq_id' 17 4 'Structure model' '_struct_ncs_dom_lim.end_auth_comp_id' 18 4 'Structure model' '_struct_ncs_dom_lim.end_label_asym_id' 19 4 'Structure model' '_struct_ncs_dom_lim.end_label_comp_id' 20 4 'Structure model' '_struct_ncs_dom_lim.end_label_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7NYL _pdbx_database_status.recvd_initial_deposition_date 2021-03-23 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # _pdbx_database_related.db_name PDB _pdbx_database_related.details 'wild type JIP1 SH3 domain' _pdbx_database_related.db_id 7NYK _pdbx_database_related.content_type re-refinement # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Perez, L.M.' 1 ? 'Ielasi, F.S.' 2 ? 'Palencia, A.' 3 0000-0002-1805-319X 'Jensen, M.R.' 4 0000-0003-0419-2196 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Nature _citation.journal_id_ASTM NATUAS _citation.journal_id_CSD 0006 _citation.journal_id_ISSN 1476-4687 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 602 _citation.language ? _citation.page_first 695 _citation.page_last 700 _citation.title 'Visualizing protein breathing motions associated with aromatic ring flipping.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41586-022-04417-6 _citation.pdbx_database_id_PubMed 35173330 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Marino Perez, L.' 1 ? primary 'Ielasi, F.S.' 2 ? primary 'Bessa, L.M.' 3 ? primary 'Maurin, D.' 4 ? primary 'Kragelj, J.' 5 ? primary 'Blackledge, M.' 6 ? primary 'Salvi, N.' 7 ? primary 'Bouvignies, G.' 8 ? primary 'Palencia, A.' 9 ? primary 'Jensen, M.R.' 10 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'SH3 domain of JNK-interacting Protein 1 (JIP1)' 7459.299 2 3.1.3.36 H493A ? 'GHM belongs to expression vector pET28a' 2 branched man 'alpha-D-glucopyranose-(1-1)-alpha-D-glucopyranose' 342.297 1 ? ? ? ? 3 non-polymer syn 'TETRAETHYLENE GLYCOL' 194.226 1 ? ? ? ? 4 water nat water 18.015 48 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;JIP-1,JNK-interacting protein 1,Islet-brain 1,IB-1,JNK MAP kinase scaffold protein 1,Mitogen-activated protein kinase 8-interacting protein 1,C-Jun-amino-terminal kinase-interacting protein 1 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GHMEQTARAIFRFVPRHEDELELEVDDPLLVELQAEDYWYEAYNMRTGARGVFPAYYAIEVTK _entity_poly.pdbx_seq_one_letter_code_can GHMEQTARAIFRFVPRHEDELELEVDDPLLVELQAEDYWYEAYNMRTGARGVFPAYYAIEVTK _entity_poly.pdbx_strand_id AAA,BBB _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'TETRAETHYLENE GLYCOL' PG4 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 HIS n 1 3 MET n 1 4 GLU n 1 5 GLN n 1 6 THR n 1 7 ALA n 1 8 ARG n 1 9 ALA n 1 10 ILE n 1 11 PHE n 1 12 ARG n 1 13 PHE n 1 14 VAL n 1 15 PRO n 1 16 ARG n 1 17 HIS n 1 18 GLU n 1 19 ASP n 1 20 GLU n 1 21 LEU n 1 22 GLU n 1 23 LEU n 1 24 GLU n 1 25 VAL n 1 26 ASP n 1 27 ASP n 1 28 PRO n 1 29 LEU n 1 30 LEU n 1 31 VAL n 1 32 GLU n 1 33 LEU n 1 34 GLN n 1 35 ALA n 1 36 GLU n 1 37 ASP n 1 38 TYR n 1 39 TRP n 1 40 TYR n 1 41 GLU n 1 42 ALA n 1 43 TYR n 1 44 ASN n 1 45 MET n 1 46 ARG n 1 47 THR n 1 48 GLY n 1 49 ALA n 1 50 ARG n 1 51 GLY n 1 52 VAL n 1 53 PHE n 1 54 PRO n 1 55 ALA n 1 56 TYR n 1 57 TYR n 1 58 ALA n 1 59 ILE n 1 60 GLU n 1 61 VAL n 1 62 THR n 1 63 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 63 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'MAPK8IP1, IB1, JIP1, PRKM8IP' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_branch.entity_id 2 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 DGlcpa1-1DGlcpa 'Glycam Condensed Sequence' GMML 1.0 2 2 'WURCS=2.0/1,2,1/[a2122h-1a_1-5]/1-1/a1-b1' WURCS PDB2Glycan 1.1.0 3 2 '[][a-D-Glcp]{[(1+1)][a-D-Glcp]{}}' LINUCS PDB-CARE ? # _pdbx_entity_branch_link.link_id 1 _pdbx_entity_branch_link.entity_id 2 _pdbx_entity_branch_link.entity_branch_list_num_1 1 _pdbx_entity_branch_link.comp_id_1 GLC _pdbx_entity_branch_link.atom_id_1 C1 _pdbx_entity_branch_link.leaving_atom_id_1 O1 _pdbx_entity_branch_link.entity_branch_list_num_2 2 _pdbx_entity_branch_link.comp_id_2 GLC _pdbx_entity_branch_link.atom_id_2 O1 _pdbx_entity_branch_link.leaving_atom_id_2 HO1 _pdbx_entity_branch_link.value_order sing _pdbx_entity_branch_link.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLC 'D-saccharide, alpha linking' . alpha-D-glucopyranose 'alpha-D-glucose; D-glucose; glucose' 'C6 H12 O6' 180.156 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PG4 non-polymer . 'TETRAETHYLENE GLYCOL' ? 'C8 H18 O5' 194.226 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier GLC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpa GLC 'COMMON NAME' GMML 1.0 a-D-glucopyranose GLC 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 a-D-Glcp GLC 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Glc # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 487 ? ? ? AAA . n A 1 2 HIS 2 488 ? ? ? AAA . n A 1 3 MET 3 489 ? ? ? AAA . n A 1 4 GLU 4 490 ? ? ? AAA . n A 1 5 GLN 5 491 491 GLN GLN AAA . n A 1 6 THR 6 492 492 THR THR AAA . n A 1 7 ALA 7 493 493 ALA ALA AAA . n A 1 8 ARG 8 494 494 ARG ARG AAA . n A 1 9 ALA 9 495 495 ALA ALA AAA . n A 1 10 ILE 10 496 496 ILE ILE AAA . n A 1 11 PHE 11 497 497 PHE PHE AAA . n A 1 12 ARG 12 498 498 ARG ARG AAA . n A 1 13 PHE 13 499 499 PHE PHE AAA . n A 1 14 VAL 14 500 500 VAL VAL AAA . n A 1 15 PRO 15 501 501 PRO PRO AAA . n A 1 16 ARG 16 502 502 ARG ARG AAA . n A 1 17 HIS 17 503 503 HIS HIS AAA . n A 1 18 GLU 18 504 504 GLU GLU AAA . n A 1 19 ASP 19 505 505 ASP ASP AAA . n A 1 20 GLU 20 506 506 GLU GLU AAA . n A 1 21 LEU 21 507 507 LEU LEU AAA . n A 1 22 GLU 22 508 508 GLU GLU AAA . n A 1 23 LEU 23 509 509 LEU LEU AAA . n A 1 24 GLU 24 510 510 GLU GLU AAA . n A 1 25 VAL 25 511 511 VAL VAL AAA . n A 1 26 ASP 26 512 512 ASP ASP AAA . n A 1 27 ASP 27 513 513 ASP ASP AAA . n A 1 28 PRO 28 514 514 PRO PRO AAA . n A 1 29 LEU 29 515 515 LEU LEU AAA . n A 1 30 LEU 30 516 516 LEU LEU AAA . n A 1 31 VAL 31 517 517 VAL VAL AAA . n A 1 32 GLU 32 518 518 GLU GLU AAA . n A 1 33 LEU 33 519 519 LEU LEU AAA . n A 1 34 GLN 34 520 520 GLN GLN AAA . n A 1 35 ALA 35 521 521 ALA ALA AAA . n A 1 36 GLU 36 522 522 GLU GLU AAA . n A 1 37 ASP 37 523 523 ASP ASP AAA . n A 1 38 TYR 38 524 524 TYR TYR AAA . n A 1 39 TRP 39 525 525 TRP TRP AAA . n A 1 40 TYR 40 526 526 TYR TYR AAA . n A 1 41 GLU 41 527 527 GLU GLU AAA . n A 1 42 ALA 42 528 528 ALA ALA AAA . n A 1 43 TYR 43 529 529 TYR TYR AAA . n A 1 44 ASN 44 530 530 ASN ASN AAA . n A 1 45 MET 45 531 531 MET MET AAA . n A 1 46 ARG 46 532 532 ARG ARG AAA . n A 1 47 THR 47 533 533 THR THR AAA . n A 1 48 GLY 48 534 534 GLY GLY AAA . n A 1 49 ALA 49 535 535 ALA ALA AAA . n A 1 50 ARG 50 536 536 ARG ARG AAA . n A 1 51 GLY 51 537 537 GLY GLY AAA . n A 1 52 VAL 52 538 538 VAL VAL AAA . n A 1 53 PHE 53 539 539 PHE PHE AAA . n A 1 54 PRO 54 540 540 PRO PRO AAA . n A 1 55 ALA 55 541 541 ALA ALA AAA . n A 1 56 TYR 56 542 542 TYR TYR AAA . n A 1 57 TYR 57 543 543 TYR TYR AAA . n A 1 58 ALA 58 544 544 ALA ALA AAA . n A 1 59 ILE 59 545 545 ILE ILE AAA . n A 1 60 GLU 60 546 546 GLU GLU AAA . n A 1 61 VAL 61 547 547 VAL VAL AAA . n A 1 62 THR 62 548 548 THR THR AAA . n A 1 63 LYS 63 549 ? ? ? AAA . n B 1 1 GLY 1 487 487 GLY GLY BBB . n B 1 2 HIS 2 488 488 HIS HIS BBB . n B 1 3 MET 3 489 489 MET MET BBB . n B 1 4 GLU 4 490 490 GLU GLU BBB . n B 1 5 GLN 5 491 491 GLN GLN BBB . n B 1 6 THR 6 492 492 THR THR BBB . n B 1 7 ALA 7 493 493 ALA ALA BBB . n B 1 8 ARG 8 494 494 ARG ARG BBB . n B 1 9 ALA 9 495 495 ALA ALA BBB . n B 1 10 ILE 10 496 496 ILE ILE BBB . n B 1 11 PHE 11 497 497 PHE PHE BBB . n B 1 12 ARG 12 498 498 ARG ARG BBB . n B 1 13 PHE 13 499 499 PHE PHE BBB . n B 1 14 VAL 14 500 500 VAL VAL BBB . n B 1 15 PRO 15 501 501 PRO PRO BBB . n B 1 16 ARG 16 502 502 ARG ARG BBB . n B 1 17 HIS 17 503 503 HIS HIS BBB . n B 1 18 GLU 18 504 504 GLU GLU BBB . n B 1 19 ASP 19 505 505 ASP ASP BBB . n B 1 20 GLU 20 506 506 GLU GLU BBB . n B 1 21 LEU 21 507 507 LEU LEU BBB . n B 1 22 GLU 22 508 508 GLU GLU BBB . n B 1 23 LEU 23 509 509 LEU LEU BBB . n B 1 24 GLU 24 510 510 GLU GLU BBB . n B 1 25 VAL 25 511 511 VAL VAL BBB . n B 1 26 ASP 26 512 512 ASP ASP BBB . n B 1 27 ASP 27 513 513 ASP ASP BBB . n B 1 28 PRO 28 514 514 PRO PRO BBB . n B 1 29 LEU 29 515 515 LEU LEU BBB . n B 1 30 LEU 30 516 516 LEU LEU BBB . n B 1 31 VAL 31 517 517 VAL VAL BBB . n B 1 32 GLU 32 518 518 GLU GLU BBB . n B 1 33 LEU 33 519 519 LEU LEU BBB . n B 1 34 GLN 34 520 520 GLN GLN BBB . n B 1 35 ALA 35 521 521 ALA ALA BBB . n B 1 36 GLU 36 522 522 GLU GLU BBB . n B 1 37 ASP 37 523 523 ASP ASP BBB . n B 1 38 TYR 38 524 524 TYR TYR BBB . n B 1 39 TRP 39 525 525 TRP TRP BBB . n B 1 40 TYR 40 526 526 TYR TYR BBB . n B 1 41 GLU 41 527 527 GLU GLU BBB . n B 1 42 ALA 42 528 528 ALA ALA BBB . n B 1 43 TYR 43 529 529 TYR TYR BBB . n B 1 44 ASN 44 530 530 ASN ASN BBB . n B 1 45 MET 45 531 531 MET MET BBB . n B 1 46 ARG 46 532 532 ARG ARG BBB . n B 1 47 THR 47 533 533 THR THR BBB . n B 1 48 GLY 48 534 534 GLY GLY BBB . n B 1 49 ALA 49 535 535 ALA ALA BBB . n B 1 50 ARG 50 536 536 ARG ARG BBB . n B 1 51 GLY 51 537 537 GLY GLY BBB . n B 1 52 VAL 52 538 538 VAL VAL BBB . n B 1 53 PHE 53 539 539 PHE PHE BBB . n B 1 54 PRO 54 540 540 PRO PRO BBB . n B 1 55 ALA 55 541 541 ALA ALA BBB . n B 1 56 TYR 56 542 542 TYR TYR BBB . n B 1 57 TYR 57 543 543 TYR TYR BBB . n B 1 58 ALA 58 544 544 ALA ALA BBB . n B 1 59 ILE 59 545 545 ILE ILE BBB . n B 1 60 GLU 60 546 546 GLU GLU BBB . n B 1 61 VAL 61 547 547 VAL VAL BBB . n B 1 62 THR 62 548 548 THR THR BBB . n B 1 63 LYS 63 549 ? ? ? BBB . n # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero C 2 GLC 1 C GLC 1 CCC TRE 1 n C 2 GLC 2 C GLC 2 CCC TRE 1 n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code D 3 PG4 1 601 1 PG4 PG4 AAA . E 4 HOH 1 701 43 HOH HOH AAA . E 4 HOH 2 702 47 HOH HOH AAA . E 4 HOH 3 703 42 HOH HOH AAA . E 4 HOH 4 704 32 HOH HOH AAA . E 4 HOH 5 705 44 HOH HOH AAA . E 4 HOH 6 706 11 HOH HOH AAA . E 4 HOH 7 707 30 HOH HOH AAA . E 4 HOH 8 708 5 HOH HOH AAA . E 4 HOH 9 709 8 HOH HOH AAA . E 4 HOH 10 710 36 HOH HOH AAA . E 4 HOH 11 711 33 HOH HOH AAA . E 4 HOH 12 712 31 HOH HOH AAA . E 4 HOH 13 713 2 HOH HOH AAA . E 4 HOH 14 714 24 HOH HOH AAA . E 4 HOH 15 715 23 HOH HOH AAA . E 4 HOH 16 716 46 HOH HOH AAA . E 4 HOH 17 717 37 HOH HOH AAA . E 4 HOH 18 718 13 HOH HOH AAA . E 4 HOH 19 719 41 HOH HOH AAA . E 4 HOH 20 720 48 HOH HOH AAA . E 4 HOH 21 721 34 HOH HOH AAA . E 4 HOH 22 722 40 HOH HOH AAA . E 4 HOH 23 723 29 HOH HOH AAA . E 4 HOH 24 724 45 HOH HOH AAA . E 4 HOH 25 725 39 HOH HOH AAA . E 4 HOH 26 726 38 HOH HOH AAA . F 4 HOH 1 601 25 HOH HOH BBB . F 4 HOH 2 602 9 HOH HOH BBB . F 4 HOH 3 603 22 HOH HOH BBB . F 4 HOH 4 604 16 HOH HOH BBB . F 4 HOH 5 605 12 HOH HOH BBB . F 4 HOH 6 606 15 HOH HOH BBB . F 4 HOH 7 607 26 HOH HOH BBB . F 4 HOH 8 608 3 HOH HOH BBB . F 4 HOH 9 609 6 HOH HOH BBB . F 4 HOH 10 610 4 HOH HOH BBB . F 4 HOH 11 611 10 HOH HOH BBB . F 4 HOH 12 612 19 HOH HOH BBB . F 4 HOH 13 613 1 HOH HOH BBB . F 4 HOH 14 614 18 HOH HOH BBB . F 4 HOH 15 615 7 HOH HOH BBB . F 4 HOH 16 616 17 HOH HOH BBB . F 4 HOH 17 617 14 HOH HOH BBB . F 4 HOH 18 618 27 HOH HOH BBB . F 4 HOH 19 619 35 HOH HOH BBB . F 4 HOH 20 620 28 HOH HOH BBB . F 4 HOH 21 621 20 HOH HOH BBB . F 4 HOH 22 622 21 HOH HOH BBB . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 7.0.078 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 104.274 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7NYL _cell.details ? _cell.formula_units_Z ? _cell.length_a 28.055 _cell.length_a_esd ? _cell.length_b 45.551 _cell.length_b_esd ? _cell.length_c 46.006 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7NYL _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7NYL _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.9 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 36.1 _exptl_crystal.description neddles _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M HEPES pH 7.5, 1-5% PEG 400, 2-2.5 M Ammonium sulfate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-11-20 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Silicon crystal' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9763 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID23-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9763 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID23-1 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7NYL _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.93 _reflns.d_resolution_low 45.55 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8443 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I 1 _reflns.percent_possible_obs 96.3 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 8.4 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 6.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.99 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.93 _reflns_shell.d_res_low 2.03 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.18 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1083 _reflns_shell.percent_possible_all 77.9 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.66 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 4.371 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] -3.490 _refine.aniso_B[2][2] -1.512 _refine.aniso_B[2][3] 0.000 _refine.aniso_B[3][3] -0.958 _refine.B_iso_max ? _refine.B_iso_mean 31.846 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.961 _refine.correlation_coeff_Fo_to_Fc_free 0.949 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7NYL _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.950 _refine.ls_d_res_low 44.586 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8311 _refine.ls_number_reflns_R_free 403 _refine.ls_number_reflns_R_work 7908 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.844 _refine.ls_percent_reflns_R_free 4.849 _refine.ls_R_factor_all 0.207 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2545 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2049 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 7NYK _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.225 _refine.pdbx_overall_ESU_R_Free 0.187 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 10.216 _refine.overall_SU_ML 0.249 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1003 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 36 _refine_hist.number_atoms_solvent 48 _refine_hist.number_atoms_total 1087 _refine_hist.d_res_high 1.950 _refine_hist.d_res_low 44.586 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 0.013 1066 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 937 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.673 1.691 1448 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.233 1.596 2164 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 10.264 5.000 118 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 30.694 21.528 72 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 19.221 15.000 156 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 20.172 15.000 10 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.064 0.200 135 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 0.020 1176 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 250 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.184 0.200 171 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.199 0.200 936 ? r_symmetry_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.176 0.200 469 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.080 0.200 553 ? r_symmetry_nbtor_other ? ? 'X-RAY DIFFRACTION' ? 0.186 0.200 41 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.204 0.200 9 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.179 0.200 52 ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.307 0.200 9 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 2.481 3.005 478 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 2.483 3.001 477 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 3.785 4.468 594 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 3.782 4.473 595 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 3.822 3.617 588 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 3.818 3.622 589 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? 6.104 5.219 854 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 6.100 5.224 855 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 8.133 33.567 1105 ? r_lrange_it ? ? 'X-RAY DIFFRACTION' ? 8.130 33.608 1106 ? r_lrange_other ? ? 'X-RAY DIFFRACTION' ? 0.140 0.050 1694 ? r_ncsr_local_group_1 ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.950 2.001 630 . 26 603 99.8413 . 0.329 . 0.330 . 0.329 . . . . . 0.319 . 20 . 0.306 0.276 'X-RAY DIFFRACTION' 2.001 2.055 597 . 22 575 100.0000 . 0.332 . 0.343 . 0.332 . . . . . 0.316 . 20 . 0.427 0.328 'X-RAY DIFFRACTION' 2.055 2.115 565 . 24 541 100.0000 . 0.307 . 0.294 . 0.308 . . . . . 0.287 . 20 . 0.526 0.438 'X-RAY DIFFRACTION' 2.115 2.180 574 . 31 542 99.8258 . 0.301 . 0.349 . 0.299 . . . . . 0.270 . 20 . 0.597 0.462 'X-RAY DIFFRACTION' 2.180 2.251 526 . 30 496 100.0000 . 0.288 . 0.274 . 0.289 . . . . . 0.265 . 20 . 0.695 0.715 'X-RAY DIFFRACTION' 2.251 2.330 541 . 24 516 99.8152 . 0.261 . 0.355 . 0.257 . . . . . 0.233 . 20 . 0.762 0.750 'X-RAY DIFFRACTION' 2.330 2.418 500 . 24 475 99.8000 . 0.250 . 0.302 . 0.248 . . . . . 0.225 . 20 . 0.780 0.703 'X-RAY DIFFRACTION' 2.418 2.516 494 . 27 467 100.0000 . 0.247 . 0.258 . 0.247 . . . . . 0.225 . 20 . 0.802 0.789 'X-RAY DIFFRACTION' 2.516 2.627 457 . 17 440 100.0000 . 0.245 . 0.352 . 0.242 . . . . . 0.224 . 20 . 0.822 0.694 'X-RAY DIFFRACTION' 2.627 2.755 451 . 22 429 100.0000 . 0.212 . 0.338 . 0.206 . . . . . 0.187 . 20 . 0.872 0.802 'X-RAY DIFFRACTION' 2.755 2.904 431 . 22 409 100.0000 . 0.201 . 0.364 . 0.192 . . . . . 0.177 . 20 . 0.906 0.868 'X-RAY DIFFRACTION' 2.904 3.079 411 . 26 385 100.0000 . 0.171 . 0.289 . 0.164 . . . . . 0.151 . 20 . 0.932 0.884 'X-RAY DIFFRACTION' 3.079 3.290 389 . 25 362 99.4859 . 0.153 . 0.206 . 0.150 . . . . . 0.143 . 20 . 0.951 0.913 'X-RAY DIFFRACTION' 3.290 3.552 359 . 19 340 100.0000 . 0.175 . 0.266 . 0.169 . . . . . 0.164 . 20 . 0.950 0.952 'X-RAY DIFFRACTION' 3.552 3.889 319 . 19 299 99.6865 . 0.149 . 0.196 . 0.146 . . . . . 0.144 . 20 . 0.959 0.940 'X-RAY DIFFRACTION' 3.889 4.344 296 . 18 278 100.0000 . 0.135 . 0.112 . 0.136 . . . . . 0.138 . 20 . 0.966 0.978 'X-RAY DIFFRACTION' 4.344 5.008 273 . 14 255 98.5348 . 0.166 . 0.260 . 0.161 . . . . . 0.170 . 20 . 0.963 0.946 'X-RAY DIFFRACTION' 5.008 6.114 220 . 8 211 99.5455 . 0.209 . 0.247 . 0.207 . . . . . 0.212 . 20 . 0.933 0.951 'X-RAY DIFFRACTION' 6.114 8.567 181 . 2 179 100.0000 . 0.199 . 0.532 . 0.196 . . . . . 0.203 . 20 . 0.926 . 'X-RAY DIFFRACTION' 8.567 44.586 109 . 3 105 99.0826 . 0.234 . 0.247 . 0.234 . . . . . 0.251 . 20 . 0.924 0.853 # _struct_ncs_dom.id 1 _struct_ncs_dom.details 'Chains AAA BBB' _struct_ncs_dom.pdbx_ens_id 1 # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 1 A GLN 5 . A THR 62 . AAA GLN 491 AAA THR 548 ? ? 1 1 2 B GLY 1 . B THR 62 . BBB GLY 487 BBB THR 548 ? ? # _struct_ncs_ens.id 1 _struct_ncs_ens.details r_ncsr_local_group_1s # _struct.entry_id 7NYL _struct.title 'Mutant H493A of SH3 domain of JNK-interacting Protein 1 (JIP1)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7NYL _struct_keywords.text 'SH3 domain of JNK-interacting protein 1 (JIP1), SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 3 ? E N N 4 ? F N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code JIP1_HUMAN _struct_ref.pdbx_db_accession Q9UQF2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code EQTHRAIFRFVPRHEDELELEVDDPLLVELQAEDYWYEAYNMRTGARGVFPAYYAIEVTK _struct_ref.pdbx_align_begin 490 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7NYL AAA 4 ? 63 ? Q9UQF2 490 ? 549 ? 490 549 2 1 7NYL BBB 4 ? 63 ? Q9UQF2 490 ? 549 ? 490 549 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7NYL GLY AAA 1 ? UNP Q9UQF2 ? ? 'expression tag' 487 1 1 7NYL HIS AAA 2 ? UNP Q9UQF2 ? ? 'expression tag' 488 2 1 7NYL MET AAA 3 ? UNP Q9UQF2 ? ? 'expression tag' 489 3 1 7NYL ALA AAA 7 ? UNP Q9UQF2 HIS 493 'engineered mutation' 493 4 2 7NYL GLY BBB 1 ? UNP Q9UQF2 ? ? 'expression tag' 487 5 2 7NYL HIS BBB 2 ? UNP Q9UQF2 ? ? 'expression tag' 488 6 2 7NYL MET BBB 3 ? UNP Q9UQF2 ? ? 'expression tag' 489 7 2 7NYL ALA BBB 7 ? UNP Q9UQF2 HIS 493 'engineered mutation' 493 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2290 ? 1 MORE -1 ? 1 'SSA (A^2)' 6920 ? # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,D,E,F 1 2 C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details 'chain A forms a dimer with chain B' # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_445 -x-1,y-1/2,-z -1.0000000000 0.0000000000 0.0000000000 -28.0550000000 0.0000000000 1.0000000000 0.0000000000 -22.7755000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag both _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id C _struct_conn.ptnr1_label_comp_id GLC _struct_conn.ptnr1_label_seq_id . _struct_conn.ptnr1_label_atom_id C1 _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id C _struct_conn.ptnr2_label_comp_id GLC _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id O1 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id C _struct_conn.ptnr1_auth_comp_id GLC _struct_conn.ptnr1_auth_seq_id 1 _struct_conn.ptnr2_auth_asym_id C _struct_conn.ptnr2_auth_comp_id GLC _struct_conn.ptnr2_auth_seq_id 2 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.431 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 50 ? PRO A 54 ? ARG AAA 536 PRO AAA 540 AA1 2 TRP A 39 ? ASN A 44 ? TRP AAA 525 ASN AAA 530 AA1 3 PRO A 28 ? LEU A 33 ? PRO AAA 514 LEU AAA 519 AA1 4 THR A 6 ? ALA A 9 ? THR AAA 492 ALA AAA 495 AA1 5 ALA A 58 ? VAL A 61 ? ALA AAA 544 VAL AAA 547 AA2 1 ARG B 50 ? PRO B 54 ? ARG BBB 536 PRO BBB 540 AA2 2 TRP B 39 ? ASN B 44 ? TRP BBB 525 ASN BBB 530 AA2 3 PRO B 28 ? LEU B 33 ? PRO BBB 514 LEU BBB 519 AA2 4 GLN B 5 ? ALA B 9 ? GLN BBB 491 ALA BBB 495 AA2 5 ALA B 58 ? GLU B 60 ? ALA BBB 544 GLU BBB 546 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O PHE A 53 ? O PHE AAA 539 N TYR A 40 ? N TYR AAA 526 AA1 2 3 O GLU A 41 ? O GLU AAA 527 N GLU A 32 ? N GLU AAA 518 AA1 3 4 O LEU A 29 ? O LEU AAA 515 N ALA A 7 ? N ALA AAA 493 AA1 4 5 N THR A 6 ? N THR AAA 492 O VAL A 61 ? O VAL AAA 547 AA2 1 2 O PHE B 53 ? O PHE BBB 539 N TYR B 40 ? N TYR BBB 526 AA2 2 3 O TYR B 43 ? O TYR BBB 529 N LEU B 30 ? N LEU BBB 516 AA2 3 4 O VAL B 31 ? O VAL BBB 517 N GLN B 5 ? N GLN BBB 491 AA2 4 5 N ARG B 8 ? N ARG BBB 494 O ILE B 59 ? O ILE BBB 545 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OE1 _pdbx_validate_close_contact.auth_asym_id_1 BBB _pdbx_validate_close_contact.auth_comp_id_1 GLU _pdbx_validate_close_contact.auth_seq_id_1 508 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 BBB _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 601 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.12 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP AAA 512 ? ? 89.94 9.05 2 1 GLU BBB 490 ? ? -48.58 151.09 3 1 ASP BBB 512 ? ? 89.15 13.95 # _pdbx_molecule_features.prd_id PRD_900006 _pdbx_molecule_features.name trehalose _pdbx_molecule_features.type Oligosaccharide _pdbx_molecule_features.class Nutrient _pdbx_molecule_features.details 'oligosaccharide with reducing-end-to-reducing-end glycosidic bond' # _pdbx_molecule.instance_id 1 _pdbx_molecule.prd_id PRD_900006 _pdbx_molecule.asym_id C # _pdbx_entry_details.entry_id 7NYL _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 AAA GLY 487 ? A GLY 1 2 1 Y 1 AAA HIS 488 ? A HIS 2 3 1 Y 1 AAA MET 489 ? A MET 3 4 1 Y 1 AAA GLU 490 ? A GLU 4 5 1 Y 1 AAA LYS 549 ? A LYS 63 6 1 Y 1 BBB LYS 549 ? B LYS 63 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLC C1 C N S 74 GLC C2 C N R 75 GLC C3 C N S 76 GLC C4 C N S 77 GLC C5 C N R 78 GLC C6 C N N 79 GLC O1 O N N 80 GLC O2 O N N 81 GLC O3 O N N 82 GLC O4 O N N 83 GLC O5 O N N 84 GLC O6 O N N 85 GLC H1 H N N 86 GLC H2 H N N 87 GLC H3 H N N 88 GLC H4 H N N 89 GLC H5 H N N 90 GLC H61 H N N 91 GLC H62 H N N 92 GLC HO1 H N N 93 GLC HO2 H N N 94 GLC HO3 H N N 95 GLC HO4 H N N 96 GLC HO6 H N N 97 GLN N N N N 98 GLN CA C N S 99 GLN C C N N 100 GLN O O N N 101 GLN CB C N N 102 GLN CG C N N 103 GLN CD C N N 104 GLN OE1 O N N 105 GLN NE2 N N N 106 GLN OXT O N N 107 GLN H H N N 108 GLN H2 H N N 109 GLN HA H N N 110 GLN HB2 H N N 111 GLN HB3 H N N 112 GLN HG2 H N N 113 GLN HG3 H N N 114 GLN HE21 H N N 115 GLN HE22 H N N 116 GLN HXT H N N 117 GLU N N N N 118 GLU CA C N S 119 GLU C C N N 120 GLU O O N N 121 GLU CB C N N 122 GLU CG C N N 123 GLU CD C N N 124 GLU OE1 O N N 125 GLU OE2 O N N 126 GLU OXT O N N 127 GLU H H N N 128 GLU H2 H N N 129 GLU HA H N N 130 GLU HB2 H N N 131 GLU HB3 H N N 132 GLU HG2 H N N 133 GLU HG3 H N N 134 GLU HE2 H N N 135 GLU HXT H N N 136 GLY N N N N 137 GLY CA C N N 138 GLY C C N N 139 GLY O O N N 140 GLY OXT O N N 141 GLY H H N N 142 GLY H2 H N N 143 GLY HA2 H N N 144 GLY HA3 H N N 145 GLY HXT H N N 146 HIS N N N N 147 HIS CA C N S 148 HIS C C N N 149 HIS O O N N 150 HIS CB C N N 151 HIS CG C Y N 152 HIS ND1 N Y N 153 HIS CD2 C Y N 154 HIS CE1 C Y N 155 HIS NE2 N Y N 156 HIS OXT O N N 157 HIS H H N N 158 HIS H2 H N N 159 HIS HA H N N 160 HIS HB2 H N N 161 HIS HB3 H N N 162 HIS HD1 H N N 163 HIS HD2 H N N 164 HIS HE1 H N N 165 HIS HE2 H N N 166 HIS HXT H N N 167 HOH O O N N 168 HOH H1 H N N 169 HOH H2 H N N 170 ILE N N N N 171 ILE CA C N S 172 ILE C C N N 173 ILE O O N N 174 ILE CB C N S 175 ILE CG1 C N N 176 ILE CG2 C N N 177 ILE CD1 C N N 178 ILE OXT O N N 179 ILE H H N N 180 ILE H2 H N N 181 ILE HA H N N 182 ILE HB H N N 183 ILE HG12 H N N 184 ILE HG13 H N N 185 ILE HG21 H N N 186 ILE HG22 H N N 187 ILE HG23 H N N 188 ILE HD11 H N N 189 ILE HD12 H N N 190 ILE HD13 H N N 191 ILE HXT H N N 192 LEU N N N N 193 LEU CA C N S 194 LEU C C N N 195 LEU O O N N 196 LEU CB C N N 197 LEU CG C N N 198 LEU CD1 C N N 199 LEU CD2 C N N 200 LEU OXT O N N 201 LEU H H N N 202 LEU H2 H N N 203 LEU HA H N N 204 LEU HB2 H N N 205 LEU HB3 H N N 206 LEU HG H N N 207 LEU HD11 H N N 208 LEU HD12 H N N 209 LEU HD13 H N N 210 LEU HD21 H N N 211 LEU HD22 H N N 212 LEU HD23 H N N 213 LEU HXT H N N 214 LYS N N N N 215 LYS CA C N S 216 LYS C C N N 217 LYS O O N N 218 LYS CB C N N 219 LYS CG C N N 220 LYS CD C N N 221 LYS CE C N N 222 LYS NZ N N N 223 LYS OXT O N N 224 LYS H H N N 225 LYS H2 H N N 226 LYS HA H N N 227 LYS HB2 H N N 228 LYS HB3 H N N 229 LYS HG2 H N N 230 LYS HG3 H N N 231 LYS HD2 H N N 232 LYS HD3 H N N 233 LYS HE2 H N N 234 LYS HE3 H N N 235 LYS HZ1 H N N 236 LYS HZ2 H N N 237 LYS HZ3 H N N 238 LYS HXT H N N 239 MET N N N N 240 MET CA C N S 241 MET C C N N 242 MET O O N N 243 MET CB C N N 244 MET CG C N N 245 MET SD S N N 246 MET CE C N N 247 MET OXT O N N 248 MET H H N N 249 MET H2 H N N 250 MET HA H N N 251 MET HB2 H N N 252 MET HB3 H N N 253 MET HG2 H N N 254 MET HG3 H N N 255 MET HE1 H N N 256 MET HE2 H N N 257 MET HE3 H N N 258 MET HXT H N N 259 PG4 O1 O N N 260 PG4 C1 C N N 261 PG4 C2 C N N 262 PG4 O2 O N N 263 PG4 C3 C N N 264 PG4 C4 C N N 265 PG4 O3 O N N 266 PG4 C5 C N N 267 PG4 C6 C N N 268 PG4 O4 O N N 269 PG4 C7 C N N 270 PG4 C8 C N N 271 PG4 O5 O N N 272 PG4 HO1 H N N 273 PG4 H11 H N N 274 PG4 H12 H N N 275 PG4 H21 H N N 276 PG4 H22 H N N 277 PG4 H31 H N N 278 PG4 H32 H N N 279 PG4 H41 H N N 280 PG4 H42 H N N 281 PG4 H51 H N N 282 PG4 H52 H N N 283 PG4 H61 H N N 284 PG4 H62 H N N 285 PG4 H71 H N N 286 PG4 H72 H N N 287 PG4 H81 H N N 288 PG4 H82 H N N 289 PG4 HO5 H N N 290 PHE N N N N 291 PHE CA C N S 292 PHE C C N N 293 PHE O O N N 294 PHE CB C N N 295 PHE CG C Y N 296 PHE CD1 C Y N 297 PHE CD2 C Y N 298 PHE CE1 C Y N 299 PHE CE2 C Y N 300 PHE CZ C Y N 301 PHE OXT O N N 302 PHE H H N N 303 PHE H2 H N N 304 PHE HA H N N 305 PHE HB2 H N N 306 PHE HB3 H N N 307 PHE HD1 H N N 308 PHE HD2 H N N 309 PHE HE1 H N N 310 PHE HE2 H N N 311 PHE HZ H N N 312 PHE HXT H N N 313 PRO N N N N 314 PRO CA C N S 315 PRO C C N N 316 PRO O O N N 317 PRO CB C N N 318 PRO CG C N N 319 PRO CD C N N 320 PRO OXT O N N 321 PRO H H N N 322 PRO HA H N N 323 PRO HB2 H N N 324 PRO HB3 H N N 325 PRO HG2 H N N 326 PRO HG3 H N N 327 PRO HD2 H N N 328 PRO HD3 H N N 329 PRO HXT H N N 330 THR N N N N 331 THR CA C N S 332 THR C C N N 333 THR O O N N 334 THR CB C N R 335 THR OG1 O N N 336 THR CG2 C N N 337 THR OXT O N N 338 THR H H N N 339 THR H2 H N N 340 THR HA H N N 341 THR HB H N N 342 THR HG1 H N N 343 THR HG21 H N N 344 THR HG22 H N N 345 THR HG23 H N N 346 THR HXT H N N 347 TRP N N N N 348 TRP CA C N S 349 TRP C C N N 350 TRP O O N N 351 TRP CB C N N 352 TRP CG C Y N 353 TRP CD1 C Y N 354 TRP CD2 C Y N 355 TRP NE1 N Y N 356 TRP CE2 C Y N 357 TRP CE3 C Y N 358 TRP CZ2 C Y N 359 TRP CZ3 C Y N 360 TRP CH2 C Y N 361 TRP OXT O N N 362 TRP H H N N 363 TRP H2 H N N 364 TRP HA H N N 365 TRP HB2 H N N 366 TRP HB3 H N N 367 TRP HD1 H N N 368 TRP HE1 H N N 369 TRP HE3 H N N 370 TRP HZ2 H N N 371 TRP HZ3 H N N 372 TRP HH2 H N N 373 TRP HXT H N N 374 TYR N N N N 375 TYR CA C N S 376 TYR C C N N 377 TYR O O N N 378 TYR CB C N N 379 TYR CG C Y N 380 TYR CD1 C Y N 381 TYR CD2 C Y N 382 TYR CE1 C Y N 383 TYR CE2 C Y N 384 TYR CZ C Y N 385 TYR OH O N N 386 TYR OXT O N N 387 TYR H H N N 388 TYR H2 H N N 389 TYR HA H N N 390 TYR HB2 H N N 391 TYR HB3 H N N 392 TYR HD1 H N N 393 TYR HD2 H N N 394 TYR HE1 H N N 395 TYR HE2 H N N 396 TYR HH H N N 397 TYR HXT H N N 398 VAL N N N N 399 VAL CA C N S 400 VAL C C N N 401 VAL O O N N 402 VAL CB C N N 403 VAL CG1 C N N 404 VAL CG2 C N N 405 VAL OXT O N N 406 VAL H H N N 407 VAL H2 H N N 408 VAL HA H N N 409 VAL HB H N N 410 VAL HG11 H N N 411 VAL HG12 H N N 412 VAL HG13 H N N 413 VAL HG21 H N N 414 VAL HG22 H N N 415 VAL HG23 H N N 416 VAL HXT H N N 417 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLC C1 C2 sing N N 70 GLC C1 O1 sing N N 71 GLC C1 O5 sing N N 72 GLC C1 H1 sing N N 73 GLC C2 C3 sing N N 74 GLC C2 O2 sing N N 75 GLC C2 H2 sing N N 76 GLC C3 C4 sing N N 77 GLC C3 O3 sing N N 78 GLC C3 H3 sing N N 79 GLC C4 C5 sing N N 80 GLC C4 O4 sing N N 81 GLC C4 H4 sing N N 82 GLC C5 C6 sing N N 83 GLC C5 O5 sing N N 84 GLC C5 H5 sing N N 85 GLC C6 O6 sing N N 86 GLC C6 H61 sing N N 87 GLC C6 H62 sing N N 88 GLC O1 HO1 sing N N 89 GLC O2 HO2 sing N N 90 GLC O3 HO3 sing N N 91 GLC O4 HO4 sing N N 92 GLC O6 HO6 sing N N 93 GLN N CA sing N N 94 GLN N H sing N N 95 GLN N H2 sing N N 96 GLN CA C sing N N 97 GLN CA CB sing N N 98 GLN CA HA sing N N 99 GLN C O doub N N 100 GLN C OXT sing N N 101 GLN CB CG sing N N 102 GLN CB HB2 sing N N 103 GLN CB HB3 sing N N 104 GLN CG CD sing N N 105 GLN CG HG2 sing N N 106 GLN CG HG3 sing N N 107 GLN CD OE1 doub N N 108 GLN CD NE2 sing N N 109 GLN NE2 HE21 sing N N 110 GLN NE2 HE22 sing N N 111 GLN OXT HXT sing N N 112 GLU N CA sing N N 113 GLU N H sing N N 114 GLU N H2 sing N N 115 GLU CA C sing N N 116 GLU CA CB sing N N 117 GLU CA HA sing N N 118 GLU C O doub N N 119 GLU C OXT sing N N 120 GLU CB CG sing N N 121 GLU CB HB2 sing N N 122 GLU CB HB3 sing N N 123 GLU CG CD sing N N 124 GLU CG HG2 sing N N 125 GLU CG HG3 sing N N 126 GLU CD OE1 doub N N 127 GLU CD OE2 sing N N 128 GLU OE2 HE2 sing N N 129 GLU OXT HXT sing N N 130 GLY N CA sing N N 131 GLY N H sing N N 132 GLY N H2 sing N N 133 GLY CA C sing N N 134 GLY CA HA2 sing N N 135 GLY CA HA3 sing N N 136 GLY C O doub N N 137 GLY C OXT sing N N 138 GLY OXT HXT sing N N 139 HIS N CA sing N N 140 HIS N H sing N N 141 HIS N H2 sing N N 142 HIS CA C sing N N 143 HIS CA CB sing N N 144 HIS CA HA sing N N 145 HIS C O doub N N 146 HIS C OXT sing N N 147 HIS CB CG sing N N 148 HIS CB HB2 sing N N 149 HIS CB HB3 sing N N 150 HIS CG ND1 sing Y N 151 HIS CG CD2 doub Y N 152 HIS ND1 CE1 doub Y N 153 HIS ND1 HD1 sing N N 154 HIS CD2 NE2 sing Y N 155 HIS CD2 HD2 sing N N 156 HIS CE1 NE2 sing Y N 157 HIS CE1 HE1 sing N N 158 HIS NE2 HE2 sing N N 159 HIS OXT HXT sing N N 160 HOH O H1 sing N N 161 HOH O H2 sing N N 162 ILE N CA sing N N 163 ILE N H sing N N 164 ILE N H2 sing N N 165 ILE CA C sing N N 166 ILE CA CB sing N N 167 ILE CA HA sing N N 168 ILE C O doub N N 169 ILE C OXT sing N N 170 ILE CB CG1 sing N N 171 ILE CB CG2 sing N N 172 ILE CB HB sing N N 173 ILE CG1 CD1 sing N N 174 ILE CG1 HG12 sing N N 175 ILE CG1 HG13 sing N N 176 ILE CG2 HG21 sing N N 177 ILE CG2 HG22 sing N N 178 ILE CG2 HG23 sing N N 179 ILE CD1 HD11 sing N N 180 ILE CD1 HD12 sing N N 181 ILE CD1 HD13 sing N N 182 ILE OXT HXT sing N N 183 LEU N CA sing N N 184 LEU N H sing N N 185 LEU N H2 sing N N 186 LEU CA C sing N N 187 LEU CA CB sing N N 188 LEU CA HA sing N N 189 LEU C O doub N N 190 LEU C OXT sing N N 191 LEU CB CG sing N N 192 LEU CB HB2 sing N N 193 LEU CB HB3 sing N N 194 LEU CG CD1 sing N N 195 LEU CG CD2 sing N N 196 LEU CG HG sing N N 197 LEU CD1 HD11 sing N N 198 LEU CD1 HD12 sing N N 199 LEU CD1 HD13 sing N N 200 LEU CD2 HD21 sing N N 201 LEU CD2 HD22 sing N N 202 LEU CD2 HD23 sing N N 203 LEU OXT HXT sing N N 204 LYS N CA sing N N 205 LYS N H sing N N 206 LYS N H2 sing N N 207 LYS CA C sing N N 208 LYS CA CB sing N N 209 LYS CA HA sing N N 210 LYS C O doub N N 211 LYS C OXT sing N N 212 LYS CB CG sing N N 213 LYS CB HB2 sing N N 214 LYS CB HB3 sing N N 215 LYS CG CD sing N N 216 LYS CG HG2 sing N N 217 LYS CG HG3 sing N N 218 LYS CD CE sing N N 219 LYS CD HD2 sing N N 220 LYS CD HD3 sing N N 221 LYS CE NZ sing N N 222 LYS CE HE2 sing N N 223 LYS CE HE3 sing N N 224 LYS NZ HZ1 sing N N 225 LYS NZ HZ2 sing N N 226 LYS NZ HZ3 sing N N 227 LYS OXT HXT sing N N 228 MET N CA sing N N 229 MET N H sing N N 230 MET N H2 sing N N 231 MET CA C sing N N 232 MET CA CB sing N N 233 MET CA HA sing N N 234 MET C O doub N N 235 MET C OXT sing N N 236 MET CB CG sing N N 237 MET CB HB2 sing N N 238 MET CB HB3 sing N N 239 MET CG SD sing N N 240 MET CG HG2 sing N N 241 MET CG HG3 sing N N 242 MET SD CE sing N N 243 MET CE HE1 sing N N 244 MET CE HE2 sing N N 245 MET CE HE3 sing N N 246 MET OXT HXT sing N N 247 PG4 O1 C1 sing N N 248 PG4 O1 HO1 sing N N 249 PG4 C1 C2 sing N N 250 PG4 C1 H11 sing N N 251 PG4 C1 H12 sing N N 252 PG4 C2 O2 sing N N 253 PG4 C2 H21 sing N N 254 PG4 C2 H22 sing N N 255 PG4 O2 C3 sing N N 256 PG4 C3 C4 sing N N 257 PG4 C3 H31 sing N N 258 PG4 C3 H32 sing N N 259 PG4 C4 O3 sing N N 260 PG4 C4 H41 sing N N 261 PG4 C4 H42 sing N N 262 PG4 O3 C5 sing N N 263 PG4 C5 C6 sing N N 264 PG4 C5 H51 sing N N 265 PG4 C5 H52 sing N N 266 PG4 C6 O4 sing N N 267 PG4 C6 H61 sing N N 268 PG4 C6 H62 sing N N 269 PG4 O4 C7 sing N N 270 PG4 C7 C8 sing N N 271 PG4 C7 H71 sing N N 272 PG4 C7 H72 sing N N 273 PG4 C8 O5 sing N N 274 PG4 C8 H81 sing N N 275 PG4 C8 H82 sing N N 276 PG4 O5 HO5 sing N N 277 PHE N CA sing N N 278 PHE N H sing N N 279 PHE N H2 sing N N 280 PHE CA C sing N N 281 PHE CA CB sing N N 282 PHE CA HA sing N N 283 PHE C O doub N N 284 PHE C OXT sing N N 285 PHE CB CG sing N N 286 PHE CB HB2 sing N N 287 PHE CB HB3 sing N N 288 PHE CG CD1 doub Y N 289 PHE CG CD2 sing Y N 290 PHE CD1 CE1 sing Y N 291 PHE CD1 HD1 sing N N 292 PHE CD2 CE2 doub Y N 293 PHE CD2 HD2 sing N N 294 PHE CE1 CZ doub Y N 295 PHE CE1 HE1 sing N N 296 PHE CE2 CZ sing Y N 297 PHE CE2 HE2 sing N N 298 PHE CZ HZ sing N N 299 PHE OXT HXT sing N N 300 PRO N CA sing N N 301 PRO N CD sing N N 302 PRO N H sing N N 303 PRO CA C sing N N 304 PRO CA CB sing N N 305 PRO CA HA sing N N 306 PRO C O doub N N 307 PRO C OXT sing N N 308 PRO CB CG sing N N 309 PRO CB HB2 sing N N 310 PRO CB HB3 sing N N 311 PRO CG CD sing N N 312 PRO CG HG2 sing N N 313 PRO CG HG3 sing N N 314 PRO CD HD2 sing N N 315 PRO CD HD3 sing N N 316 PRO OXT HXT sing N N 317 THR N CA sing N N 318 THR N H sing N N 319 THR N H2 sing N N 320 THR CA C sing N N 321 THR CA CB sing N N 322 THR CA HA sing N N 323 THR C O doub N N 324 THR C OXT sing N N 325 THR CB OG1 sing N N 326 THR CB CG2 sing N N 327 THR CB HB sing N N 328 THR OG1 HG1 sing N N 329 THR CG2 HG21 sing N N 330 THR CG2 HG22 sing N N 331 THR CG2 HG23 sing N N 332 THR OXT HXT sing N N 333 TRP N CA sing N N 334 TRP N H sing N N 335 TRP N H2 sing N N 336 TRP CA C sing N N 337 TRP CA CB sing N N 338 TRP CA HA sing N N 339 TRP C O doub N N 340 TRP C OXT sing N N 341 TRP CB CG sing N N 342 TRP CB HB2 sing N N 343 TRP CB HB3 sing N N 344 TRP CG CD1 doub Y N 345 TRP CG CD2 sing Y N 346 TRP CD1 NE1 sing Y N 347 TRP CD1 HD1 sing N N 348 TRP CD2 CE2 doub Y N 349 TRP CD2 CE3 sing Y N 350 TRP NE1 CE2 sing Y N 351 TRP NE1 HE1 sing N N 352 TRP CE2 CZ2 sing Y N 353 TRP CE3 CZ3 doub Y N 354 TRP CE3 HE3 sing N N 355 TRP CZ2 CH2 doub Y N 356 TRP CZ2 HZ2 sing N N 357 TRP CZ3 CH2 sing Y N 358 TRP CZ3 HZ3 sing N N 359 TRP CH2 HH2 sing N N 360 TRP OXT HXT sing N N 361 TYR N CA sing N N 362 TYR N H sing N N 363 TYR N H2 sing N N 364 TYR CA C sing N N 365 TYR CA CB sing N N 366 TYR CA HA sing N N 367 TYR C O doub N N 368 TYR C OXT sing N N 369 TYR CB CG sing N N 370 TYR CB HB2 sing N N 371 TYR CB HB3 sing N N 372 TYR CG CD1 doub Y N 373 TYR CG CD2 sing Y N 374 TYR CD1 CE1 sing Y N 375 TYR CD1 HD1 sing N N 376 TYR CD2 CE2 doub Y N 377 TYR CD2 HD2 sing N N 378 TYR CE1 CZ doub Y N 379 TYR CE1 HE1 sing N N 380 TYR CE2 CZ sing Y N 381 TYR CE2 HE2 sing N N 382 TYR CZ OH sing N N 383 TYR OH HH sing N N 384 TYR OXT HXT sing N N 385 VAL N CA sing N N 386 VAL N H sing N N 387 VAL N H2 sing N N 388 VAL CA C sing N N 389 VAL CA CB sing N N 390 VAL CA HA sing N N 391 VAL C O doub N N 392 VAL C OXT sing N N 393 VAL CB CG1 sing N N 394 VAL CB CG2 sing N N 395 VAL CB HB sing N N 396 VAL CG1 HG11 sing N N 397 VAL CG1 HG12 sing N N 398 VAL CG1 HG13 sing N N 399 VAL CG2 HG21 sing N N 400 VAL CG2 HG22 sing N N 401 VAL CG2 HG23 sing N N 402 VAL OXT HXT sing N N 403 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Agence Nationale de la Recherche (ANR)' France RC18114CC-NovoTarget 1 'Agence Nationale de la Recherche (ANR)' France MAPKAssembly 2 # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 GLC 1 n 2 GLC 2 n # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 7NYK _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7NYL _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.035644 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.009068 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021953 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.022429 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.310 20.844 1.020 10.208 1.589 0.569 0.865 51.651 0.216 H 1 1 0.493 10.511 0.323 26.126 0.140 3.142 0.041 57.800 0.003 N 7 7 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 -11.538 O 8 8 3.049 13.277 2.287 5.701 1.546 0.324 0.867 32.909 0.251 S 16 16 6.905 1.468 5.203 22.215 1.438 0.254 1.586 56.172 1.049 # loop_