data_7O64 # _entry.id 7O64 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.384 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7O64 pdb_00007o64 10.2210/pdb7o64/pdb WWPDB D_1292113535 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-10-13 2 'Structure model' 1 1 2021-11-03 3 'Structure model' 1 2 2024-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' pdbx_database_proc 4 3 'Structure model' chem_comp_atom 5 3 'Structure model' chem_comp_bond 6 3 'Structure model' diffrn_source 7 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation_author.identifier_ORCID' 5 3 'Structure model' '_diffrn_source.pdbx_synchrotron_site' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7O64 _pdbx_database_status.recvd_initial_deposition_date 2021-04-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name PDB _pdbx_database_related.details 'High resolution crystal structure of human mitochondrial ferritin (hMTF)' _pdbx_database_related.db_id 7O63 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Pozzi, C.' 1 0000-0003-2574-3911 'Ciambellotti, S.' 2 0000-0002-1924-5046 'Tassone, G.' 3 0000-0002-2575-5528 'Turano, P.' 4 0000-0002-7683-8614 'Mangani, S.' 5 0000-0003-4824-7478 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country GE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Chemistry _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 0947-6539 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 27 _citation.language ? _citation.page_first 14690 _citation.page_last 14701 _citation.title 'Iron Binding in the Ferroxidase Site of Human Mitochondrial Ferritin.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/chem.202102270 _citation.pdbx_database_id_PubMed 34343376 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ciambellotti, S.' 1 ? primary 'Pratesi, A.' 2 ? primary 'Tassone, G.' 3 ? primary 'Turano, P.' 4 ? primary 'Mangani, S.' 5 ? primary 'Pozzi, C.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Ferritin, mitochondrial' 21107.568 1 1.16.3.1 ? ? ? 2 non-polymer syn 'FE (II) ION' 55.845 2 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 4 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 5 water nat water 18.015 283 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MPAAGPSRVRQNFHPDSEAAINRQINLELYASYVYLSMAYYFSRDDVALNNFSRYFLHQSREETEHAEKLMRLQNQRGGR IRLQDIKKPEQDDWESGLHAMECALLLEKNVNQSLLELHALASDKGDPHLCDFLETYYLNEQVKSIKELGDHVHNLVKMG APDAGLAEYLFDTHTLGNENKQN ; _entity_poly.pdbx_seq_one_letter_code_can ;MPAAGPSRVRQNFHPDSEAAINRQINLELYASYVYLSMAYYFSRDDVALNNFSRYFLHQSREETEHAEKLMRLQNQRGGR IRLQDIKKPEQDDWESGLHAMECALLLEKNVNQSLLELHALASDKGDPHLCDFLETYYLNEQVKSIKELGDHVHNLVKMG APDAGLAEYLFDTHTLGNENKQN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'FE (II) ION' FE2 3 'CHLORIDE ION' CL 4 'MAGNESIUM ION' MG 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 PRO n 1 3 ALA n 1 4 ALA n 1 5 GLY n 1 6 PRO n 1 7 SER n 1 8 ARG n 1 9 VAL n 1 10 ARG n 1 11 GLN n 1 12 ASN n 1 13 PHE n 1 14 HIS n 1 15 PRO n 1 16 ASP n 1 17 SER n 1 18 GLU n 1 19 ALA n 1 20 ALA n 1 21 ILE n 1 22 ASN n 1 23 ARG n 1 24 GLN n 1 25 ILE n 1 26 ASN n 1 27 LEU n 1 28 GLU n 1 29 LEU n 1 30 TYR n 1 31 ALA n 1 32 SER n 1 33 TYR n 1 34 VAL n 1 35 TYR n 1 36 LEU n 1 37 SER n 1 38 MET n 1 39 ALA n 1 40 TYR n 1 41 TYR n 1 42 PHE n 1 43 SER n 1 44 ARG n 1 45 ASP n 1 46 ASP n 1 47 VAL n 1 48 ALA n 1 49 LEU n 1 50 ASN n 1 51 ASN n 1 52 PHE n 1 53 SER n 1 54 ARG n 1 55 TYR n 1 56 PHE n 1 57 LEU n 1 58 HIS n 1 59 GLN n 1 60 SER n 1 61 ARG n 1 62 GLU n 1 63 GLU n 1 64 THR n 1 65 GLU n 1 66 HIS n 1 67 ALA n 1 68 GLU n 1 69 LYS n 1 70 LEU n 1 71 MET n 1 72 ARG n 1 73 LEU n 1 74 GLN n 1 75 ASN n 1 76 GLN n 1 77 ARG n 1 78 GLY n 1 79 GLY n 1 80 ARG n 1 81 ILE n 1 82 ARG n 1 83 LEU n 1 84 GLN n 1 85 ASP n 1 86 ILE n 1 87 LYS n 1 88 LYS n 1 89 PRO n 1 90 GLU n 1 91 GLN n 1 92 ASP n 1 93 ASP n 1 94 TRP n 1 95 GLU n 1 96 SER n 1 97 GLY n 1 98 LEU n 1 99 HIS n 1 100 ALA n 1 101 MET n 1 102 GLU n 1 103 CYS n 1 104 ALA n 1 105 LEU n 1 106 LEU n 1 107 LEU n 1 108 GLU n 1 109 LYS n 1 110 ASN n 1 111 VAL n 1 112 ASN n 1 113 GLN n 1 114 SER n 1 115 LEU n 1 116 LEU n 1 117 GLU n 1 118 LEU n 1 119 HIS n 1 120 ALA n 1 121 LEU n 1 122 ALA n 1 123 SER n 1 124 ASP n 1 125 LYS n 1 126 GLY n 1 127 ASP n 1 128 PRO n 1 129 HIS n 1 130 LEU n 1 131 CYS n 1 132 ASP n 1 133 PHE n 1 134 LEU n 1 135 GLU n 1 136 THR n 1 137 TYR n 1 138 TYR n 1 139 LEU n 1 140 ASN n 1 141 GLU n 1 142 GLN n 1 143 VAL n 1 144 LYS n 1 145 SER n 1 146 ILE n 1 147 LYS n 1 148 GLU n 1 149 LEU n 1 150 GLY n 1 151 ASP n 1 152 HIS n 1 153 VAL n 1 154 HIS n 1 155 ASN n 1 156 LEU n 1 157 VAL n 1 158 LYS n 1 159 MET n 1 160 GLY n 1 161 ALA n 1 162 PRO n 1 163 ASP n 1 164 ALA n 1 165 GLY n 1 166 LEU n 1 167 ALA n 1 168 GLU n 1 169 TYR n 1 170 LEU n 1 171 PHE n 1 172 ASP n 1 173 THR n 1 174 HIS n 1 175 THR n 1 176 LEU n 1 177 GLY n 1 178 ASN n 1 179 GLU n 1 180 ASN n 1 181 LYS n 1 182 GLN n 1 183 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 183 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene FTMT _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant -pLysS _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET-3a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FE2 non-polymer . 'FE (II) ION' ? 'Fe 2' 55.845 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 ? ? ? A . n A 1 2 PRO 2 1 ? ? ? A . n A 1 3 ALA 3 2 ? ? ? A . n A 1 4 ALA 4 3 ? ? ? A . n A 1 5 GLY 5 4 4 GLY GLY A . n A 1 6 PRO 6 5 5 PRO PRO A . n A 1 7 SER 7 6 6 SER SER A . n A 1 8 ARG 8 7 7 ARG ARG A . n A 1 9 VAL 9 8 8 VAL VAL A . n A 1 10 ARG 10 9 9 ARG ARG A . n A 1 11 GLN 11 10 10 GLN GLN A . n A 1 12 ASN 12 11 11 ASN ASN A . n A 1 13 PHE 13 12 12 PHE PHE A . n A 1 14 HIS 14 13 13 HIS HIS A . n A 1 15 PRO 15 14 14 PRO PRO A . n A 1 16 ASP 16 15 15 ASP ASP A . n A 1 17 SER 17 16 16 SER SER A . n A 1 18 GLU 18 17 17 GLU GLU A . n A 1 19 ALA 19 18 18 ALA ALA A . n A 1 20 ALA 20 19 19 ALA ALA A . n A 1 21 ILE 21 20 20 ILE ILE A . n A 1 22 ASN 22 21 21 ASN ASN A . n A 1 23 ARG 23 22 22 ARG ARG A . n A 1 24 GLN 24 23 23 GLN GLN A . n A 1 25 ILE 25 24 24 ILE ILE A . n A 1 26 ASN 26 25 25 ASN ASN A . n A 1 27 LEU 27 26 26 LEU LEU A . n A 1 28 GLU 28 27 27 GLU GLU A . n A 1 29 LEU 29 28 28 LEU LEU A . n A 1 30 TYR 30 29 29 TYR TYR A . n A 1 31 ALA 31 30 30 ALA ALA A . n A 1 32 SER 32 31 31 SER SER A . n A 1 33 TYR 33 32 32 TYR TYR A . n A 1 34 VAL 34 33 33 VAL VAL A . n A 1 35 TYR 35 34 34 TYR TYR A . n A 1 36 LEU 36 35 35 LEU LEU A . n A 1 37 SER 37 36 36 SER SER A . n A 1 38 MET 38 37 37 MET MET A . n A 1 39 ALA 39 38 38 ALA ALA A . n A 1 40 TYR 40 39 39 TYR TYR A . n A 1 41 TYR 41 40 40 TYR TYR A . n A 1 42 PHE 42 41 41 PHE PHE A . n A 1 43 SER 43 42 42 SER SER A . n A 1 44 ARG 44 43 43 ARG ARG A . n A 1 45 ASP 45 44 44 ASP ASP A . n A 1 46 ASP 46 45 45 ASP ASP A . n A 1 47 VAL 47 46 46 VAL VAL A . n A 1 48 ALA 48 47 47 ALA ALA A . n A 1 49 LEU 49 48 48 LEU LEU A . n A 1 50 ASN 50 49 49 ASN ASN A . n A 1 51 ASN 51 50 50 ASN ASN A . n A 1 52 PHE 52 51 51 PHE PHE A . n A 1 53 SER 53 52 52 SER SER A . n A 1 54 ARG 54 53 53 ARG ARG A . n A 1 55 TYR 55 54 54 TYR TYR A . n A 1 56 PHE 56 55 55 PHE PHE A . n A 1 57 LEU 57 56 56 LEU LEU A . n A 1 58 HIS 58 57 57 HIS HIS A . n A 1 59 GLN 59 58 58 GLN GLN A . n A 1 60 SER 60 59 59 SER SER A . n A 1 61 ARG 61 60 60 ARG ARG A . n A 1 62 GLU 62 61 61 GLU GLU A . n A 1 63 GLU 63 62 62 GLU GLU A . n A 1 64 THR 64 63 63 THR THR A . n A 1 65 GLU 65 64 64 GLU GLU A . n A 1 66 HIS 66 65 65 HIS HIS A . n A 1 67 ALA 67 66 66 ALA ALA A . n A 1 68 GLU 68 67 67 GLU GLU A . n A 1 69 LYS 69 68 68 LYS LYS A . n A 1 70 LEU 70 69 69 LEU LEU A . n A 1 71 MET 71 70 70 MET MET A . n A 1 72 ARG 72 71 71 ARG ARG A . n A 1 73 LEU 73 72 72 LEU LEU A . n A 1 74 GLN 74 73 73 GLN GLN A . n A 1 75 ASN 75 74 74 ASN ASN A . n A 1 76 GLN 76 75 75 GLN GLN A . n A 1 77 ARG 77 76 76 ARG ARG A . n A 1 78 GLY 78 77 77 GLY GLY A . n A 1 79 GLY 79 78 78 GLY GLY A . n A 1 80 ARG 80 79 79 ARG ARG A . n A 1 81 ILE 81 80 80 ILE ILE A . n A 1 82 ARG 82 81 81 ARG ARG A . n A 1 83 LEU 83 82 82 LEU LEU A . n A 1 84 GLN 84 83 83 GLN GLN A . n A 1 85 ASP 85 84 84 ASP ASP A . n A 1 86 ILE 86 85 85 ILE ILE A . n A 1 87 LYS 87 86 86 LYS LYS A . n A 1 88 LYS 88 87 87 LYS LYS A . n A 1 89 PRO 89 88 88 PRO PRO A . n A 1 90 GLU 90 89 89 GLU GLU A . n A 1 91 GLN 91 90 90 GLN GLN A . n A 1 92 ASP 92 91 91 ASP ASP A . n A 1 93 ASP 93 92 92 ASP ASP A . n A 1 94 TRP 94 93 93 TRP TRP A . n A 1 95 GLU 95 94 94 GLU GLU A . n A 1 96 SER 96 95 95 SER SER A . n A 1 97 GLY 97 96 96 GLY GLY A . n A 1 98 LEU 98 97 97 LEU LEU A . n A 1 99 HIS 99 98 98 HIS HIS A . n A 1 100 ALA 100 99 99 ALA ALA A . n A 1 101 MET 101 100 100 MET MET A . n A 1 102 GLU 102 101 101 GLU GLU A . n A 1 103 CYS 103 102 102 CYS CYS A . n A 1 104 ALA 104 103 103 ALA ALA A . n A 1 105 LEU 105 104 104 LEU LEU A . n A 1 106 LEU 106 105 105 LEU LEU A . n A 1 107 LEU 107 106 106 LEU LEU A . n A 1 108 GLU 108 107 107 GLU GLU A . n A 1 109 LYS 109 108 108 LYS LYS A . n A 1 110 ASN 110 109 109 ASN ASN A . n A 1 111 VAL 111 110 110 VAL VAL A . n A 1 112 ASN 112 111 111 ASN ASN A . n A 1 113 GLN 113 112 112 GLN GLN A . n A 1 114 SER 114 113 113 SER SER A . n A 1 115 LEU 115 114 114 LEU LEU A . n A 1 116 LEU 116 115 115 LEU LEU A . n A 1 117 GLU 117 116 116 GLU GLU A . n A 1 118 LEU 118 117 117 LEU LEU A . n A 1 119 HIS 119 118 118 HIS HIS A . n A 1 120 ALA 120 119 119 ALA ALA A . n A 1 121 LEU 121 120 120 LEU LEU A . n A 1 122 ALA 122 121 121 ALA ALA A . n A 1 123 SER 123 122 122 SER SER A . n A 1 124 ASP 124 123 123 ASP ASP A . n A 1 125 LYS 125 124 124 LYS LYS A . n A 1 126 GLY 126 125 125 GLY GLY A . n A 1 127 ASP 127 126 126 ASP ASP A . n A 1 128 PRO 128 127 127 PRO PRO A . n A 1 129 HIS 129 128 128 HIS HIS A . n A 1 130 LEU 130 129 129 LEU LEU A . n A 1 131 CYS 131 130 130 CYS CYS A . n A 1 132 ASP 132 131 131 ASP ASP A . n A 1 133 PHE 133 132 132 PHE PHE A . n A 1 134 LEU 134 133 133 LEU LEU A . n A 1 135 GLU 135 134 134 GLU GLU A . n A 1 136 THR 136 135 135 THR THR A . n A 1 137 TYR 137 136 136 TYR TYR A . n A 1 138 TYR 138 137 137 TYR TYR A . n A 1 139 LEU 139 138 138 LEU LEU A . n A 1 140 ASN 140 139 139 ASN ASN A . n A 1 141 GLU 141 140 140 GLU GLU A . n A 1 142 GLN 142 141 141 GLN GLN A . n A 1 143 VAL 143 142 142 VAL VAL A . n A 1 144 LYS 144 143 143 LYS LYS A . n A 1 145 SER 145 144 144 SER SER A . n A 1 146 ILE 146 145 145 ILE ILE A . n A 1 147 LYS 147 146 146 LYS LYS A . n A 1 148 GLU 148 147 147 GLU GLU A . n A 1 149 LEU 149 148 148 LEU LEU A . n A 1 150 GLY 150 149 149 GLY GLY A . n A 1 151 ASP 151 150 150 ASP ASP A . n A 1 152 HIS 152 151 151 HIS HIS A . n A 1 153 VAL 153 152 152 VAL VAL A . n A 1 154 HIS 154 153 153 HIS HIS A . n A 1 155 ASN 155 154 154 ASN ASN A . n A 1 156 LEU 156 155 155 LEU LEU A . n A 1 157 VAL 157 156 156 VAL VAL A . n A 1 158 LYS 158 157 157 LYS LYS A . n A 1 159 MET 159 158 158 MET MET A . n A 1 160 GLY 160 159 159 GLY GLY A . n A 1 161 ALA 161 160 160 ALA ALA A . n A 1 162 PRO 162 161 161 PRO PRO A . n A 1 163 ASP 163 162 162 ASP ASP A . n A 1 164 ALA 164 163 163 ALA ALA A . n A 1 165 GLY 165 164 164 GLY GLY A . n A 1 166 LEU 166 165 165 LEU LEU A . n A 1 167 ALA 167 166 166 ALA ALA A . n A 1 168 GLU 168 167 167 GLU GLU A . n A 1 169 TYR 169 168 168 TYR TYR A . n A 1 170 LEU 170 169 169 LEU LEU A . n A 1 171 PHE 171 170 170 PHE PHE A . n A 1 172 ASP 172 171 171 ASP ASP A . n A 1 173 THR 173 172 172 THR THR A . n A 1 174 HIS 174 173 173 HIS HIS A . n A 1 175 THR 175 174 174 THR THR A . n A 1 176 LEU 176 175 175 LEU LEU A . n A 1 177 GLY 177 176 176 GLY GLY A . n A 1 178 ASN 178 177 ? ? ? A . n A 1 179 GLU 179 178 ? ? ? A . n A 1 180 ASN 180 179 ? ? ? A . n A 1 181 LYS 181 180 ? ? ? A . n A 1 182 GLN 182 181 ? ? ? A . n A 1 183 ASN 183 182 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 FE2 1 201 2 FE2 FE2 A . C 2 FE2 1 202 3 FE2 FE2 A . D 3 CL 1 203 1 CL CL A . E 4 MG 1 204 1 MG MG A . F 5 HOH 1 301 229 HOH HOH A . F 5 HOH 2 302 117 HOH HOH A . F 5 HOH 3 303 6 HOH HOH A . F 5 HOH 4 304 126 HOH HOH A . F 5 HOH 5 305 59 HOH HOH A . F 5 HOH 6 306 21 HOH HOH A . F 5 HOH 7 307 203 HOH HOH A . F 5 HOH 8 308 107 HOH HOH A . F 5 HOH 9 309 17 HOH HOH A . F 5 HOH 10 310 158 HOH HOH A . F 5 HOH 11 311 48 HOH HOH A . F 5 HOH 12 312 69 HOH HOH A . F 5 HOH 13 313 28 HOH HOH A . F 5 HOH 14 314 167 HOH HOH A . F 5 HOH 15 315 50 HOH HOH A . F 5 HOH 16 316 102 HOH HOH A . F 5 HOH 17 317 66 HOH HOH A . F 5 HOH 18 318 201 HOH HOH A . F 5 HOH 19 319 29 HOH HOH A . F 5 HOH 20 320 52 HOH HOH A . F 5 HOH 21 321 58 HOH HOH A . F 5 HOH 22 322 114 HOH HOH A . F 5 HOH 23 323 208 HOH HOH A . F 5 HOH 24 324 189 HOH HOH A . F 5 HOH 25 325 108 HOH HOH A . F 5 HOH 26 326 269 HOH HOH A . F 5 HOH 27 327 100 HOH HOH A . F 5 HOH 28 328 160 HOH HOH A . F 5 HOH 29 329 219 HOH HOH A . F 5 HOH 30 330 250 HOH HOH A . F 5 HOH 31 331 301 HOH HOH A . F 5 HOH 32 332 104 HOH HOH A . F 5 HOH 33 333 196 HOH HOH A . F 5 HOH 34 334 36 HOH HOH A . F 5 HOH 35 335 7 HOH HOH A . F 5 HOH 36 336 20 HOH HOH A . F 5 HOH 37 337 129 HOH HOH A . F 5 HOH 38 338 286 HOH HOH A . F 5 HOH 39 339 11 HOH HOH A . F 5 HOH 40 340 53 HOH HOH A . F 5 HOH 41 341 150 HOH HOH A . F 5 HOH 42 342 217 HOH HOH A . F 5 HOH 43 343 73 HOH HOH A . F 5 HOH 44 344 26 HOH HOH A . F 5 HOH 45 345 144 HOH HOH A . F 5 HOH 46 346 86 HOH HOH A . F 5 HOH 47 347 138 HOH HOH A . F 5 HOH 48 348 133 HOH HOH A . F 5 HOH 49 349 31 HOH HOH A . F 5 HOH 50 350 45 HOH HOH A . F 5 HOH 51 351 187 HOH HOH A . F 5 HOH 52 352 24 HOH HOH A . F 5 HOH 53 353 74 HOH HOH A . F 5 HOH 54 354 75 HOH HOH A . F 5 HOH 55 355 44 HOH HOH A . F 5 HOH 56 356 4 HOH HOH A . F 5 HOH 57 357 14 HOH HOH A . F 5 HOH 58 358 67 HOH HOH A . F 5 HOH 59 359 82 HOH HOH A . F 5 HOH 60 360 8 HOH HOH A . F 5 HOH 61 361 68 HOH HOH A . F 5 HOH 62 362 283 HOH HOH A . F 5 HOH 63 363 180 HOH HOH A . F 5 HOH 64 364 159 HOH HOH A . F 5 HOH 65 365 61 HOH HOH A . F 5 HOH 66 366 30 HOH HOH A . F 5 HOH 67 367 165 HOH HOH A . F 5 HOH 68 368 22 HOH HOH A . F 5 HOH 69 369 115 HOH HOH A . F 5 HOH 70 370 60 HOH HOH A . F 5 HOH 71 371 145 HOH HOH A . F 5 HOH 72 372 94 HOH HOH A . F 5 HOH 73 373 15 HOH HOH A . F 5 HOH 74 374 95 HOH HOH A . F 5 HOH 75 375 185 HOH HOH A . F 5 HOH 76 376 137 HOH HOH A . F 5 HOH 77 377 62 HOH HOH A . F 5 HOH 78 378 206 HOH HOH A . F 5 HOH 79 379 57 HOH HOH A . F 5 HOH 80 380 98 HOH HOH A . F 5 HOH 81 381 42 HOH HOH A . F 5 HOH 82 382 37 HOH HOH A . F 5 HOH 83 383 5 HOH HOH A . F 5 HOH 84 384 65 HOH HOH A . F 5 HOH 85 385 38 HOH HOH A . F 5 HOH 86 386 267 HOH HOH A . F 5 HOH 87 387 194 HOH HOH A . F 5 HOH 88 388 25 HOH HOH A . F 5 HOH 89 389 54 HOH HOH A . F 5 HOH 90 390 72 HOH HOH A . F 5 HOH 91 391 179 HOH HOH A . F 5 HOH 92 392 298 HOH HOH A . F 5 HOH 93 393 109 HOH HOH A . F 5 HOH 94 394 120 HOH HOH A . F 5 HOH 95 395 78 HOH HOH A . F 5 HOH 96 396 97 HOH HOH A . F 5 HOH 97 397 39 HOH HOH A . F 5 HOH 98 398 173 HOH HOH A . F 5 HOH 99 399 55 HOH HOH A . F 5 HOH 100 400 294 HOH HOH A . F 5 HOH 101 401 135 HOH HOH A . F 5 HOH 102 402 1 HOH HOH A . F 5 HOH 103 403 83 HOH HOH A . F 5 HOH 104 404 10 HOH HOH A . F 5 HOH 105 405 299 HOH HOH A . F 5 HOH 106 406 183 HOH HOH A . F 5 HOH 107 407 116 HOH HOH A . F 5 HOH 108 408 56 HOH HOH A . F 5 HOH 109 409 85 HOH HOH A . F 5 HOH 110 410 172 HOH HOH A . F 5 HOH 111 411 35 HOH HOH A . F 5 HOH 112 412 12 HOH HOH A . F 5 HOH 113 413 13 HOH HOH A . F 5 HOH 114 414 270 HOH HOH A . F 5 HOH 115 415 118 HOH HOH A . F 5 HOH 116 416 63 HOH HOH A . F 5 HOH 117 417 47 HOH HOH A . F 5 HOH 118 418 23 HOH HOH A . F 5 HOH 119 419 132 HOH HOH A . F 5 HOH 120 420 43 HOH HOH A . F 5 HOH 121 421 81 HOH HOH A . F 5 HOH 122 422 79 HOH HOH A . F 5 HOH 123 423 238 HOH HOH A . F 5 HOH 124 424 254 HOH HOH A . F 5 HOH 125 425 32 HOH HOH A . F 5 HOH 126 426 77 HOH HOH A . F 5 HOH 127 427 9 HOH HOH A . F 5 HOH 128 428 110 HOH HOH A . F 5 HOH 129 429 278 HOH HOH A . F 5 HOH 130 430 213 HOH HOH A . F 5 HOH 131 431 295 HOH HOH A . F 5 HOH 132 432 80 HOH HOH A . F 5 HOH 133 433 147 HOH HOH A . F 5 HOH 134 434 157 HOH HOH A . F 5 HOH 135 435 255 HOH HOH A . F 5 HOH 136 436 19 HOH HOH A . F 5 HOH 137 437 199 HOH HOH A . F 5 HOH 138 438 259 HOH HOH A . F 5 HOH 139 439 139 HOH HOH A . F 5 HOH 140 440 176 HOH HOH A . F 5 HOH 141 441 169 HOH HOH A . F 5 HOH 142 442 171 HOH HOH A . F 5 HOH 143 443 291 HOH HOH A . F 5 HOH 144 444 210 HOH HOH A . F 5 HOH 145 445 34 HOH HOH A . F 5 HOH 146 446 140 HOH HOH A . F 5 HOH 147 447 143 HOH HOH A . F 5 HOH 148 448 123 HOH HOH A . F 5 HOH 149 449 309 HOH HOH A . F 5 HOH 150 450 16 HOH HOH A . F 5 HOH 151 451 41 HOH HOH A . F 5 HOH 152 452 193 HOH HOH A . F 5 HOH 153 453 40 HOH HOH A . F 5 HOH 154 454 246 HOH HOH A . F 5 HOH 155 455 287 HOH HOH A . F 5 HOH 156 456 96 HOH HOH A . F 5 HOH 157 457 161 HOH HOH A . F 5 HOH 158 458 262 HOH HOH A . F 5 HOH 159 459 166 HOH HOH A . F 5 HOH 160 460 51 HOH HOH A . F 5 HOH 161 461 70 HOH HOH A . F 5 HOH 162 462 76 HOH HOH A . F 5 HOH 163 463 205 HOH HOH A . F 5 HOH 164 464 307 HOH HOH A . F 5 HOH 165 465 282 HOH HOH A . F 5 HOH 166 466 124 HOH HOH A . F 5 HOH 167 467 174 HOH HOH A . F 5 HOH 168 468 27 HOH HOH A . F 5 HOH 169 469 2 HOH HOH A . F 5 HOH 170 470 113 HOH HOH A . F 5 HOH 171 471 285 HOH HOH A . F 5 HOH 172 472 265 HOH HOH A . F 5 HOH 173 473 223 HOH HOH A . F 5 HOH 174 474 197 HOH HOH A . F 5 HOH 175 475 33 HOH HOH A . F 5 HOH 176 476 111 HOH HOH A . F 5 HOH 177 477 243 HOH HOH A . F 5 HOH 178 478 184 HOH HOH A . F 5 HOH 179 479 214 HOH HOH A . F 5 HOH 180 480 200 HOH HOH A . F 5 HOH 181 481 302 HOH HOH A . F 5 HOH 182 482 221 HOH HOH A . F 5 HOH 183 483 248 HOH HOH A . F 5 HOH 184 484 146 HOH HOH A . F 5 HOH 185 485 191 HOH HOH A . F 5 HOH 186 486 230 HOH HOH A . F 5 HOH 187 487 71 HOH HOH A . F 5 HOH 188 488 222 HOH HOH A . F 5 HOH 189 489 119 HOH HOH A . F 5 HOH 190 490 228 HOH HOH A . F 5 HOH 191 491 198 HOH HOH A . F 5 HOH 192 492 300 HOH HOH A . F 5 HOH 193 493 93 HOH HOH A . F 5 HOH 194 494 162 HOH HOH A . F 5 HOH 195 495 233 HOH HOH A . F 5 HOH 196 496 271 HOH HOH A . F 5 HOH 197 497 155 HOH HOH A . F 5 HOH 198 498 235 HOH HOH A . F 5 HOH 199 499 153 HOH HOH A . F 5 HOH 200 500 190 HOH HOH A . F 5 HOH 201 501 89 HOH HOH A . F 5 HOH 202 502 192 HOH HOH A . F 5 HOH 203 503 237 HOH HOH A . F 5 HOH 204 504 288 HOH HOH A . F 5 HOH 205 505 92 HOH HOH A . F 5 HOH 206 506 18 HOH HOH A . F 5 HOH 207 507 91 HOH HOH A . F 5 HOH 208 508 290 HOH HOH A . F 5 HOH 209 509 261 HOH HOH A . F 5 HOH 210 510 84 HOH HOH A . F 5 HOH 211 511 3 HOH HOH A . F 5 HOH 212 512 127 HOH HOH A . F 5 HOH 213 513 64 HOH HOH A . F 5 HOH 214 514 182 HOH HOH A . F 5 HOH 215 515 234 HOH HOH A . F 5 HOH 216 516 156 HOH HOH A . F 5 HOH 217 517 163 HOH HOH A . F 5 HOH 218 518 121 HOH HOH A . F 5 HOH 219 519 308 HOH HOH A . F 5 HOH 220 520 306 HOH HOH A . F 5 HOH 221 521 240 HOH HOH A . F 5 HOH 222 522 181 HOH HOH A . F 5 HOH 223 523 49 HOH HOH A . F 5 HOH 224 524 101 HOH HOH A . F 5 HOH 225 525 244 HOH HOH A . F 5 HOH 226 526 231 HOH HOH A . F 5 HOH 227 527 177 HOH HOH A . F 5 HOH 228 528 105 HOH HOH A . F 5 HOH 229 529 253 HOH HOH A . F 5 HOH 230 530 279 HOH HOH A . F 5 HOH 231 531 128 HOH HOH A . F 5 HOH 232 532 225 HOH HOH A . F 5 HOH 233 533 175 HOH HOH A . F 5 HOH 234 534 90 HOH HOH A . F 5 HOH 235 535 136 HOH HOH A . F 5 HOH 236 536 152 HOH HOH A . F 5 HOH 237 537 122 HOH HOH A . F 5 HOH 238 538 277 HOH HOH A . F 5 HOH 239 539 232 HOH HOH A . F 5 HOH 240 540 264 HOH HOH A . F 5 HOH 241 541 149 HOH HOH A . F 5 HOH 242 542 211 HOH HOH A . F 5 HOH 243 543 239 HOH HOH A . F 5 HOH 244 544 236 HOH HOH A . F 5 HOH 245 545 241 HOH HOH A . F 5 HOH 246 546 273 HOH HOH A . F 5 HOH 247 547 293 HOH HOH A . F 5 HOH 248 548 112 HOH HOH A . F 5 HOH 249 549 226 HOH HOH A . F 5 HOH 250 550 224 HOH HOH A . F 5 HOH 251 551 46 HOH HOH A . F 5 HOH 252 552 275 HOH HOH A . F 5 HOH 253 553 284 HOH HOH A . F 5 HOH 254 554 252 HOH HOH A . F 5 HOH 255 555 204 HOH HOH A . F 5 HOH 256 556 304 HOH HOH A . F 5 HOH 257 557 266 HOH HOH A . F 5 HOH 258 558 276 HOH HOH A . F 5 HOH 259 559 289 HOH HOH A . F 5 HOH 260 560 260 HOH HOH A . F 5 HOH 261 561 268 HOH HOH A . F 5 HOH 262 562 151 HOH HOH A . F 5 HOH 263 563 297 HOH HOH A . F 5 HOH 264 564 99 HOH HOH A . F 5 HOH 265 565 88 HOH HOH A . F 5 HOH 266 566 142 HOH HOH A . F 5 HOH 267 567 242 HOH HOH A . F 5 HOH 268 568 141 HOH HOH A . F 5 HOH 269 569 292 HOH HOH A . F 5 HOH 270 570 216 HOH HOH A . F 5 HOH 271 571 178 HOH HOH A . F 5 HOH 272 572 280 HOH HOH A . F 5 HOH 273 573 134 HOH HOH A . F 5 HOH 274 574 202 HOH HOH A . F 5 HOH 275 575 251 HOH HOH A . F 5 HOH 276 576 303 HOH HOH A . F 5 HOH 277 577 305 HOH HOH A . F 5 HOH 278 578 87 HOH HOH A . F 5 HOH 279 579 296 HOH HOH A . F 5 HOH 280 580 258 HOH HOH A . F 5 HOH 281 581 131 HOH HOH A . F 5 HOH 282 582 257 HOH HOH A . F 5 HOH 283 583 281 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7O64 _cell.details ? _cell.formula_units_Z ? _cell.length_a 184.168 _cell.length_a_esd ? _cell.length_b 184.168 _cell.length_b_esd ? _cell.length_c 184.168 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 96 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7O64 _symmetry.cell_setting ? _symmetry.Int_Tables_number 209 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'F 4 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7O64 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.20 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 61.53 _exptl_crystal.description 'Octahedral crystals' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 281.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1.6-2 M MgCl2 6H2O and 0.1 M bicine pH 9.0' _exptl_crystal_grow.pdbx_pH_range ? # loop_ _diffrn.ambient_environment _diffrn.ambient_temp _diffrn.ambient_temp_details _diffrn.ambient_temp_esd _diffrn.crystal_id _diffrn.crystal_support _diffrn.crystal_treatment _diffrn.details _diffrn.id _diffrn.ambient_pressure _diffrn.ambient_pressure_esd _diffrn.ambient_pressure_gt _diffrn.ambient_pressure_lt _diffrn.ambient_temp_gt _diffrn.ambient_temp_lt _diffrn.pdbx_serial_crystal_experiment ? 100 ? ? 1 ? ? ? 1 ? ? ? ? ? ? N ? 100 ? ? 1 ? ? ? 2 ? ? ? ? ? ? N ? 100 ? ? 1 ? ? ? 3 ? ? ? ? ? ? N # loop_ _diffrn_detector.details _diffrn_detector.detector _diffrn_detector.diffrn_id _diffrn_detector.type _diffrn_detector.area_resol_mean _diffrn_detector.dtime _diffrn_detector.pdbx_frames_total _diffrn_detector.pdbx_collection_time_total _diffrn_detector.pdbx_collection_date _diffrn_detector.pdbx_frequency ? PIXEL 1 'DECTRIS PILATUS3 6M' ? ? ? ? 2018-02-19 ? ? PIXEL 2 'DECTRIS PILATUS3 6M' ? ? ? ? 2018-02-19 ? ? PIXEL 3 'DECTRIS PILATUS3 6M' ? ? ? ? 2018-02-19 ? # loop_ _diffrn_radiation.collimation _diffrn_radiation.diffrn_id _diffrn_radiation.filter_edge _diffrn_radiation.inhomogeneity _diffrn_radiation.monochromator _diffrn_radiation.polarisn_norm _diffrn_radiation.polarisn_ratio _diffrn_radiation.probe _diffrn_radiation.type _diffrn_radiation.xray_symbol _diffrn_radiation.wavelength_id _diffrn_radiation.pdbx_monochromatic_or_laue_m_l _diffrn_radiation.pdbx_wavelength_list _diffrn_radiation.pdbx_wavelength _diffrn_radiation.pdbx_diffrn_protocol _diffrn_radiation.pdbx_analyzer _diffrn_radiation.pdbx_scattering_type ? 1 ? ? 'Si(111)' ? ? ? ? ? 1 M ? ? MAD ? x-ray ? 2 ? ? 'Si(111)' ? ? ? ? ? 2 M ? ? MAD ? x-ray ? 3 ? ? 'Si(111)' ? ? ? ? ? 3 M ? ? MAD ? x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.97622 1.0 2 1.73940 1.0 3 1.74380 1.0 # loop_ _diffrn_source.current _diffrn_source.details _diffrn_source.diffrn_id _diffrn_source.power _diffrn_source.size _diffrn_source.source _diffrn_source.target _diffrn_source.type _diffrn_source.voltage _diffrn_source.take-off_angle _diffrn_source.pdbx_wavelength_list _diffrn_source.pdbx_wavelength _diffrn_source.pdbx_synchrotron_beamline _diffrn_source.pdbx_synchrotron_site ? ? 1 ? ? SYNCHROTRON ? 'DIAMOND BEAMLINE I03' ? ? 0.97622 ? I03 Diamond ? ? 2 ? ? SYNCHROTRON ? 'DIAMOND BEAMLINE I03' ? ? 1.73940 ? I03 Diamond ? ? 3 ? ? SYNCHROTRON ? 'DIAMOND BEAMLINE I03' ? ? 1.74380 ? I03 Diamond # loop_ _reflns.B_iso_Wilson_estimate _reflns.entry_id _reflns.data_reduction_details _reflns.data_reduction_method _reflns.d_resolution_high _reflns.d_resolution_low _reflns.details _reflns.limit_h_max _reflns.limit_h_min _reflns.limit_k_max _reflns.limit_k_min _reflns.limit_l_max _reflns.limit_l_min _reflns.number_all _reflns.number_obs _reflns.observed_criterion _reflns.observed_criterion_F_max _reflns.observed_criterion_F_min _reflns.observed_criterion_I_max _reflns.observed_criterion_I_min _reflns.observed_criterion_sigma_F _reflns.observed_criterion_sigma_I _reflns.percent_possible_obs _reflns.R_free_details _reflns.Rmerge_F_all _reflns.Rmerge_F_obs _reflns.Friedel_coverage _reflns.number_gt _reflns.threshold_expression _reflns.pdbx_redundancy _reflns.pdbx_Rmerge_I_obs _reflns.pdbx_Rmerge_I_all _reflns.pdbx_Rsym_value _reflns.pdbx_netI_over_av_sigmaI _reflns.pdbx_netI_over_sigmaI _reflns.pdbx_res_netI_over_av_sigmaI_2 _reflns.pdbx_res_netI_over_sigmaI_2 _reflns.pdbx_chi_squared _reflns.pdbx_scaling_rejects _reflns.pdbx_d_res_high_opt _reflns.pdbx_d_res_low_opt _reflns.pdbx_d_res_opt_method _reflns.phase_calculation_details _reflns.pdbx_Rrim_I_all _reflns.pdbx_Rpim_I_all _reflns.pdbx_d_opt _reflns.pdbx_number_measured_all _reflns.pdbx_diffrn_id _reflns.pdbx_ordinal _reflns.pdbx_CC_half _reflns.pdbx_CC_star _reflns.pdbx_R_split _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] _reflns.pdbx_aniso_diffraction_limit_1 _reflns.pdbx_aniso_diffraction_limit_2 _reflns.pdbx_aniso_diffraction_limit_3 _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] _reflns.pdbx_aniso_B_tensor_eigenvalue_1 _reflns.pdbx_aniso_B_tensor_eigenvalue_2 _reflns.pdbx_aniso_B_tensor_eigenvalue_3 _reflns.pdbx_orthogonalization_convention _reflns.pdbx_percent_possible_ellipsoidal _reflns.pdbx_percent_possible_spherical _reflns.pdbx_percent_possible_ellipsoidal_anomalous _reflns.pdbx_percent_possible_spherical_anomalous _reflns.pdbx_redundancy_anomalous _reflns.pdbx_CC_half_anomalous _reflns.pdbx_absDiff_over_sigma_anomalous _reflns.pdbx_percent_possible_anomalous _reflns.pdbx_observed_signal_threshold _reflns.pdbx_signal_type _reflns.pdbx_signal_details _reflns.pdbx_signal_software_id 20.2 7O64 ? ? 1.96 65.11 ? ? ? ? ? ? ? ? 17419 ? ? ? ? ? ? 2.00 87.7 ? ? ? ? ? ? 21.0 0.166 ? ? ? 11.3 ? ? ? ? ? ? ? ? 0.172 0.037 ? ? 1 1 0.997 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 20.2 7O64 ? ? 2.70 65.26 ? ? ? ? ? ? ? ? 7873 ? ? ? ? ? ? 2.00 100.0 ? ? ? ? ? ? 19.6 0.292 ? ? ? 7.7 ? ? ? ? ? ? ? ? 0.307 0.069 ? ? 2 2 0.964 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 20.2 7O64 ? ? 2.85 65.31 ? ? ? ? ? ? ? ? 6756 ? ? ? ? ? ? 2.00 100.0 ? ? ? ? ? ? 19.6 0.375 ? ? ? 5.8 ? ? ? ? ? ? ? ? 0.390 0.087 ? ? 3 3 0.967 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 1.96 2.07 ? 3.4 ? ? ? ? 2829 100.0 ? ? ? ? 0.672 ? ? ? ? ? ? ? ? 21.5 ? ? ? ? 0.696 0.149 ? 1 1 0.949 ? ? ? ? ? ? ? ? ? ? 2.70 2.85 ? 3.4 ? ? ? ? 1101 100.0 ? ? ? ? 0.684 ? ? ? ? ? ? ? ? 19.0 ? ? ? ? 0.715 0.163 ? 2 2 0.932 ? ? ? ? ? ? ? ? ? ? 2.85 3.00 ? 2.9 ? ? ? ? 936 100.0 ? ? ? ? 0.611 ? ? ? ? ? ? ? ? 20.1 ? ? ? ? 0.635 0.140 ? 3 3 0.950 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] 0.0000 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 0.0000 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 0.0000 _refine.B_iso_max 75.360 _refine.B_iso_mean 28.4530 _refine.B_iso_min 15.540 _refine.correlation_coeff_Fo_to_Fc 0.9640 _refine.correlation_coeff_Fo_to_Fc_free 0.9480 _refine.details 'U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7O64 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.9600 _refine.ls_d_res_low 55.5900 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 16533 _refine.ls_number_reflns_R_free 803 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 87.5200 _refine.ls_percent_reflns_R_free 4.6000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1647 _refine.ls_R_factor_R_free 0.2043 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1628 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1R03 _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.1440 _refine.pdbx_overall_ESU_R_Free 0.1380 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 2.9270 _refine.overall_SU_ML 0.0840 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 7O64 _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.1882 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.9600 _refine_hist.d_res_low 55.5900 _refine_hist.number_atoms_solvent 283 _refine_hist.number_atoms_total 1694 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 173 _refine_hist.pdbx_B_iso_mean_ligand 30.45 _refine_hist.pdbx_B_iso_mean_solvent 39.59 _refine_hist.pdbx_number_atoms_protein 1407 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 4 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 0.012 1484 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 1.692 1.631 2013 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 5.736 5.000 186 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 38.194 23.158 95 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 13.575 15.000 268 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 18.041 15.000 10 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.109 0.200 180 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.009 0.020 1164 ? r_gen_planes_refined ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.9600 _refine_ls_shell.d_res_low 2.0110 _refine_ls_shell.number_reflns_all 1423 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 64 _refine_ls_shell.number_reflns_R_work 1359 _refine_ls_shell.percent_reflns_obs 98.8900 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3350 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.2160 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7O64 _struct.title 'Crystal structure of human mitochondrial ferritin (hMTF) Fe(II)-loaded for 1 minute.' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7O64 _struct_keywords.text 'human mitochondrial ferritin, hMTF, oxidoreductase, time-controlled iron loading, ferroxidase site' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? F N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FTMT_HUMAN _struct_ref.pdbx_db_accession Q8N4E7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;PAAGPSRVRQNFHPDSEAAINRQINLELYASYVYLSMAYYFSRDDVALNNFSRYFLHQSREETEHAEKLMRLQNQRGGRI RLQDIKKPEQDDWESGLHAMECALLLEKNVNQSLLELHALASDKGDPHLCDFLETYYLNEQVKSIKELGDHVHNLVKMGA PDAGLAEYLFDTHTLGNENKQN ; _struct_ref.pdbx_align_begin 61 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7O64 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 183 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8N4E7 _struct_ref_seq.db_align_beg 61 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 242 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 182 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 7O64 _struct_ref_seq_dif.mon_id MET _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q8N4E7 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'initiating methionine' _struct_ref_seq_dif.pdbx_auth_seq_num 0 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details 24-meric _pdbx_struct_assembly.oligomeric_count 24 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 93090 ? 1 MORE -762 ? 1 'SSA (A^2)' 143400 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_565 -x,-y+1,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 184.1680000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_565 x,-y+1,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 184.1680000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 5 'crystal symmetry operation' 21_555 z,y,-x 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 6 'crystal symmetry operation' 22_565 z,-y+1,x 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 184.1680000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 7 'crystal symmetry operation' 23_555 -z,y,x 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 8 'crystal symmetry operation' 24_565 -z,-y+1,-x 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 184.1680000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 9 'crystal symmetry operation' 29_554 z,x+1/2,y-1/2 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 92.0840000000 0.0000000000 1.0000000000 0.0000000000 -92.0840000000 10 'crystal symmetry operation' 30_555 z,-x+1/2,-y+1/2 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 92.0840000000 0.0000000000 -1.0000000000 0.0000000000 92.0840000000 11 'crystal symmetry operation' 31_554 -z,-x+1/2,y-1/2 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 92.0840000000 0.0000000000 1.0000000000 0.0000000000 -92.0840000000 12 'crystal symmetry operation' 32_555 -z,x+1/2,-y+1/2 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 92.0840000000 0.0000000000 -1.0000000000 0.0000000000 92.0840000000 13 'crystal symmetry operation' 41_555 x,z+1/2,-y+1/2 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 92.0840000000 0.0000000000 -1.0000000000 0.0000000000 92.0840000000 14 'crystal symmetry operation' 42_554 -x,z+1/2,y-1/2 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 92.0840000000 0.0000000000 1.0000000000 0.0000000000 -92.0840000000 15 'crystal symmetry operation' 43_555 -x,-z+1/2,-y+1/2 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 92.0840000000 0.0000000000 -1.0000000000 0.0000000000 92.0840000000 16 'crystal symmetry operation' 44_554 x,-z+1/2,y-1/2 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 92.0840000000 0.0000000000 1.0000000000 0.0000000000 -92.0840000000 17 'crystal symmetry operation' 81_455 y-1/2,z+1/2,x 0.0000000000 1.0000000000 0.0000000000 -92.0840000000 0.0000000000 0.0000000000 1.0000000000 92.0840000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 18 'crystal symmetry operation' 82_555 -y+1/2,z+1/2,-x 0.0000000000 -1.0000000000 0.0000000000 92.0840000000 0.0000000000 0.0000000000 1.0000000000 92.0840000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 19 'crystal symmetry operation' 83_455 y-1/2,-z+1/2,-x 0.0000000000 1.0000000000 0.0000000000 -92.0840000000 0.0000000000 0.0000000000 -1.0000000000 92.0840000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 20 'crystal symmetry operation' 84_555 -y+1/2,-z+1/2,x 0.0000000000 -1.0000000000 0.0000000000 92.0840000000 0.0000000000 0.0000000000 -1.0000000000 92.0840000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 21 'crystal symmetry operation' 85_455 y-1/2,x+1/2,-z 0.0000000000 1.0000000000 0.0000000000 -92.0840000000 1.0000000000 0.0000000000 0.0000000000 92.0840000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 22 'crystal symmetry operation' 86_555 -y+1/2,-x+1/2,-z 0.0000000000 -1.0000000000 0.0000000000 92.0840000000 -1.0000000000 0.0000000000 0.0000000000 92.0840000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 23 'crystal symmetry operation' 87_455 y-1/2,-x+1/2,z 0.0000000000 1.0000000000 0.0000000000 -92.0840000000 -1.0000000000 0.0000000000 0.0000000000 92.0840000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 24 'crystal symmetry operation' 88_555 -y+1/2,x+1/2,z 0.0000000000 -1.0000000000 0.0000000000 92.0840000000 1.0000000000 0.0000000000 0.0000000000 92.0840000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 14 ? PHE A 42 ? HIS A 13 PHE A 41 1 ? 29 HELX_P HELX_P2 AA2 LEU A 49 ? GLY A 78 ? LEU A 48 GLY A 77 1 ? 30 HELX_P HELX_P3 AA3 SER A 96 ? LYS A 125 ? SER A 95 LYS A 124 1 ? 30 HELX_P HELX_P4 AA4 ASP A 127 ? TYR A 138 ? ASP A 126 TYR A 137 1 ? 12 HELX_P HELX_P5 AA5 TYR A 138 ? GLY A 160 ? TYR A 137 GLY A 159 1 ? 23 HELX_P HELX_P6 AA6 ALA A 164 ? THR A 175 ? ALA A 163 THR A 174 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLU 28 OE2 ? ? ? 1_555 B FE2 . FE ? ? A GLU 27 A FE2 201 1_555 ? ? ? ? ? ? ? 2.035 ? ? metalc2 metalc ? ? A GLU 63 OE1 ? ? ? 1_555 B FE2 . FE ? ? A GLU 62 A FE2 201 1_555 ? ? ? ? ? ? ? 1.971 ? ? metalc3 metalc ? ? A HIS 66 ND1 ? ? ? 1_555 B FE2 . FE ? ? A HIS 65 A FE2 201 1_555 ? ? ? ? ? ? ? 2.159 ? ? metalc4 metalc ? ? B FE2 . FE ? ? ? 1_555 F HOH . O ? ? A FE2 201 A HOH 342 1_555 ? ? ? ? ? ? ? 1.967 ? ? metalc5 metalc ? ? B FE2 . FE ? ? ? 1_555 F HOH . O ? ? A FE2 201 A HOH 344 1_555 ? ? ? ? ? ? ? 2.234 ? ? metalc6 metalc ? ? C FE2 . FE ? ? ? 1_555 F HOH . O ? ? A FE2 202 A HOH 343 1_555 ? ? ? ? ? ? ? 2.185 ? ? metalc7 metalc ? ? C FE2 . FE ? ? ? 1_555 F HOH . O ? ? A FE2 202 A HOH 343 30_555 ? ? ? ? ? ? ? 2.185 ? ? metalc8 metalc ? ? C FE2 . FE ? ? ? 1_555 F HOH . O ? ? A FE2 202 A HOH 510 1_555 ? ? ? ? ? ? ? 2.149 ? ? metalc9 metalc ? ? C FE2 . FE ? ? ? 1_555 F HOH . O ? ? A FE2 202 A HOH 510 30_555 ? ? ? ? ? ? ? 2.149 ? ? metalc10 metalc ? ? E MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 204 A HOH 330 1_555 ? ? ? ? ? ? ? 2.097 ? ? metalc11 metalc ? ? E MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 204 A HOH 330 13_555 ? ? ? ? ? ? ? 2.097 ? ? metalc12 metalc ? ? E MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 204 A HOH 352 1_555 ? ? ? ? ? ? ? 2.053 ? ? metalc13 metalc ? ? E MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 204 A HOH 352 13_555 ? ? ? ? ? ? ? 2.053 ? ? metalc14 metalc ? ? E MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 204 A HOH 531 1_555 ? ? ? ? ? ? ? 2.290 ? ? metalc15 metalc ? ? E MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 204 A HOH 531 13_555 ? ? ? ? ? ? ? 2.290 ? ? metalc16 metalc ? ? E MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 204 A HOH 575 74_555 ? ? ? ? ? ? ? 2.104 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE2 ? A GLU 28 ? A GLU 27 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 OE1 ? A GLU 63 ? A GLU 62 ? 1_555 88.7 ? 2 OE2 ? A GLU 28 ? A GLU 27 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 ND1 ? A HIS 66 ? A HIS 65 ? 1_555 108.6 ? 3 OE1 ? A GLU 63 ? A GLU 62 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 ND1 ? A HIS 66 ? A HIS 65 ? 1_555 95.2 ? 4 OE2 ? A GLU 28 ? A GLU 27 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 O ? F HOH . ? A HOH 342 ? 1_555 150.0 ? 5 OE1 ? A GLU 63 ? A GLU 62 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 O ? F HOH . ? A HOH 342 ? 1_555 89.4 ? 6 ND1 ? A HIS 66 ? A HIS 65 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 O ? F HOH . ? A HOH 342 ? 1_555 101.4 ? 7 OE2 ? A GLU 28 ? A GLU 27 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 O ? F HOH . ? A HOH 344 ? 1_555 90.9 ? 8 OE1 ? A GLU 63 ? A GLU 62 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 O ? F HOH . ? A HOH 344 ? 1_555 169.9 ? 9 ND1 ? A HIS 66 ? A HIS 65 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 O ? F HOH . ? A HOH 344 ? 1_555 94.5 ? 10 O ? F HOH . ? A HOH 342 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 O ? F HOH . ? A HOH 344 ? 1_555 85.8 ? 11 O ? F HOH . ? A HOH 343 ? 1_555 FE ? C FE2 . ? A FE2 202 ? 1_555 O ? F HOH . ? A HOH 343 ? 30_555 91.0 ? 12 O ? F HOH . ? A HOH 343 ? 1_555 FE ? C FE2 . ? A FE2 202 ? 1_555 O ? F HOH . ? A HOH 510 ? 1_555 90.5 ? 13 O ? F HOH . ? A HOH 343 ? 30_555 FE ? C FE2 . ? A FE2 202 ? 1_555 O ? F HOH . ? A HOH 510 ? 1_555 89.4 ? 14 O ? F HOH . ? A HOH 343 ? 1_555 FE ? C FE2 . ? A FE2 202 ? 1_555 O ? F HOH . ? A HOH 510 ? 30_555 178.5 ? 15 O ? F HOH . ? A HOH 343 ? 30_555 FE ? C FE2 . ? A FE2 202 ? 1_555 O ? F HOH . ? A HOH 510 ? 30_555 90.5 ? 16 O ? F HOH . ? A HOH 510 ? 1_555 FE ? C FE2 . ? A FE2 202 ? 1_555 O ? F HOH . ? A HOH 510 ? 30_555 89.1 ? 17 O ? F HOH . ? A HOH 330 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? F HOH . ? A HOH 330 ? 13_555 0.0 ? 18 O ? F HOH . ? A HOH 330 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? F HOH . ? A HOH 352 ? 1_555 88.0 ? 19 O ? F HOH . ? A HOH 330 ? 13_555 MG ? E MG . ? A MG 204 ? 1_555 O ? F HOH . ? A HOH 352 ? 1_555 88.0 ? 20 O ? F HOH . ? A HOH 330 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? F HOH . ? A HOH 352 ? 13_555 88.0 ? 21 O ? F HOH . ? A HOH 330 ? 13_555 MG ? E MG . ? A MG 204 ? 1_555 O ? F HOH . ? A HOH 352 ? 13_555 88.0 ? 22 O ? F HOH . ? A HOH 352 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? F HOH . ? A HOH 352 ? 13_555 175.9 ? 23 O ? F HOH . ? A HOH 330 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? F HOH . ? A HOH 531 ? 1_555 89.2 ? 24 O ? F HOH . ? A HOH 330 ? 13_555 MG ? E MG . ? A MG 204 ? 1_555 O ? F HOH . ? A HOH 531 ? 1_555 89.2 ? 25 O ? F HOH . ? A HOH 352 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? F HOH . ? A HOH 531 ? 1_555 94.0 ? 26 O ? F HOH . ? A HOH 352 ? 13_555 MG ? E MG . ? A MG 204 ? 1_555 O ? F HOH . ? A HOH 531 ? 1_555 86.0 ? 27 O ? F HOH . ? A HOH 330 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? F HOH . ? A HOH 531 ? 13_555 89.2 ? 28 O ? F HOH . ? A HOH 330 ? 13_555 MG ? E MG . ? A MG 204 ? 1_555 O ? F HOH . ? A HOH 531 ? 13_555 89.2 ? 29 O ? F HOH . ? A HOH 352 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? F HOH . ? A HOH 531 ? 13_555 86.0 ? 30 O ? F HOH . ? A HOH 352 ? 13_555 MG ? E MG . ? A MG 204 ? 1_555 O ? F HOH . ? A HOH 531 ? 13_555 94.0 ? 31 O ? F HOH . ? A HOH 531 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? F HOH . ? A HOH 531 ? 13_555 178.4 ? 32 O ? F HOH . ? A HOH 330 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? F HOH . ? A HOH 575 ? 74_555 180.0 ? 33 O ? F HOH . ? A HOH 330 ? 13_555 MG ? E MG . ? A MG 204 ? 1_555 O ? F HOH . ? A HOH 575 ? 74_555 180.0 ? 34 O ? F HOH . ? A HOH 352 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? F HOH . ? A HOH 575 ? 74_555 92.0 ? 35 O ? F HOH . ? A HOH 352 ? 13_555 MG ? E MG . ? A MG 204 ? 1_555 O ? F HOH . ? A HOH 575 ? 74_555 92.0 ? 36 O ? F HOH . ? A HOH 531 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? F HOH . ? A HOH 575 ? 74_555 90.8 ? 37 O ? F HOH . ? A HOH 531 ? 13_555 MG ? E MG . ? A MG 204 ? 1_555 O ? F HOH . ? A HOH 575 ? 74_555 90.8 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ALA _struct_mon_prot_cis.label_seq_id 161 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ALA _struct_mon_prot_cis.auth_seq_id 160 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 162 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 161 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.20 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 46 ? ? -137.70 -61.99 2 1 GLU A 94 ? ? 78.91 -48.23 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A FE2 202 ? C FE2 . 2 1 A CL 203 ? D CL . 3 1 A MG 204 ? E MG . 4 1 A HOH 330 ? F HOH . 5 1 A HOH 549 ? F HOH . 6 1 A HOH 559 ? F HOH . 7 1 A HOH 574 ? F HOH . 8 1 A HOH 575 ? F HOH . # _pdbx_entry_details.entry_id 7O64 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 582 ? 6.73 . 2 1 O ? A HOH 583 ? 6.97 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 0 ? A MET 1 2 1 Y 1 A PRO 1 ? A PRO 2 3 1 Y 1 A ALA 2 ? A ALA 3 4 1 Y 1 A ALA 3 ? A ALA 4 5 1 Y 1 A ASN 177 ? A ASN 178 6 1 Y 1 A GLU 178 ? A GLU 179 7 1 Y 1 A ASN 179 ? A ASN 180 8 1 Y 1 A LYS 180 ? A LYS 181 9 1 Y 1 A GLN 181 ? A GLN 182 10 1 Y 1 A ASN 182 ? A ASN 183 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 FE2 FE FE N N 89 GLN N N N N 90 GLN CA C N S 91 GLN C C N N 92 GLN O O N N 93 GLN CB C N N 94 GLN CG C N N 95 GLN CD C N N 96 GLN OE1 O N N 97 GLN NE2 N N N 98 GLN OXT O N N 99 GLN H H N N 100 GLN H2 H N N 101 GLN HA H N N 102 GLN HB2 H N N 103 GLN HB3 H N N 104 GLN HG2 H N N 105 GLN HG3 H N N 106 GLN HE21 H N N 107 GLN HE22 H N N 108 GLN HXT H N N 109 GLU N N N N 110 GLU CA C N S 111 GLU C C N N 112 GLU O O N N 113 GLU CB C N N 114 GLU CG C N N 115 GLU CD C N N 116 GLU OE1 O N N 117 GLU OE2 O N N 118 GLU OXT O N N 119 GLU H H N N 120 GLU H2 H N N 121 GLU HA H N N 122 GLU HB2 H N N 123 GLU HB3 H N N 124 GLU HG2 H N N 125 GLU HG3 H N N 126 GLU HE2 H N N 127 GLU HXT H N N 128 GLY N N N N 129 GLY CA C N N 130 GLY C C N N 131 GLY O O N N 132 GLY OXT O N N 133 GLY H H N N 134 GLY H2 H N N 135 GLY HA2 H N N 136 GLY HA3 H N N 137 GLY HXT H N N 138 HIS N N N N 139 HIS CA C N S 140 HIS C C N N 141 HIS O O N N 142 HIS CB C N N 143 HIS CG C Y N 144 HIS ND1 N Y N 145 HIS CD2 C Y N 146 HIS CE1 C Y N 147 HIS NE2 N Y N 148 HIS OXT O N N 149 HIS H H N N 150 HIS H2 H N N 151 HIS HA H N N 152 HIS HB2 H N N 153 HIS HB3 H N N 154 HIS HD1 H N N 155 HIS HD2 H N N 156 HIS HE1 H N N 157 HIS HE2 H N N 158 HIS HXT H N N 159 HOH O O N N 160 HOH H1 H N N 161 HOH H2 H N N 162 ILE N N N N 163 ILE CA C N S 164 ILE C C N N 165 ILE O O N N 166 ILE CB C N S 167 ILE CG1 C N N 168 ILE CG2 C N N 169 ILE CD1 C N N 170 ILE OXT O N N 171 ILE H H N N 172 ILE H2 H N N 173 ILE HA H N N 174 ILE HB H N N 175 ILE HG12 H N N 176 ILE HG13 H N N 177 ILE HG21 H N N 178 ILE HG22 H N N 179 ILE HG23 H N N 180 ILE HD11 H N N 181 ILE HD12 H N N 182 ILE HD13 H N N 183 ILE HXT H N N 184 LEU N N N N 185 LEU CA C N S 186 LEU C C N N 187 LEU O O N N 188 LEU CB C N N 189 LEU CG C N N 190 LEU CD1 C N N 191 LEU CD2 C N N 192 LEU OXT O N N 193 LEU H H N N 194 LEU H2 H N N 195 LEU HA H N N 196 LEU HB2 H N N 197 LEU HB3 H N N 198 LEU HG H N N 199 LEU HD11 H N N 200 LEU HD12 H N N 201 LEU HD13 H N N 202 LEU HD21 H N N 203 LEU HD22 H N N 204 LEU HD23 H N N 205 LEU HXT H N N 206 LYS N N N N 207 LYS CA C N S 208 LYS C C N N 209 LYS O O N N 210 LYS CB C N N 211 LYS CG C N N 212 LYS CD C N N 213 LYS CE C N N 214 LYS NZ N N N 215 LYS OXT O N N 216 LYS H H N N 217 LYS H2 H N N 218 LYS HA H N N 219 LYS HB2 H N N 220 LYS HB3 H N N 221 LYS HG2 H N N 222 LYS HG3 H N N 223 LYS HD2 H N N 224 LYS HD3 H N N 225 LYS HE2 H N N 226 LYS HE3 H N N 227 LYS HZ1 H N N 228 LYS HZ2 H N N 229 LYS HZ3 H N N 230 LYS HXT H N N 231 MET N N N N 232 MET CA C N S 233 MET C C N N 234 MET O O N N 235 MET CB C N N 236 MET CG C N N 237 MET SD S N N 238 MET CE C N N 239 MET OXT O N N 240 MET H H N N 241 MET H2 H N N 242 MET HA H N N 243 MET HB2 H N N 244 MET HB3 H N N 245 MET HG2 H N N 246 MET HG3 H N N 247 MET HE1 H N N 248 MET HE2 H N N 249 MET HE3 H N N 250 MET HXT H N N 251 MG MG MG N N 252 PHE N N N N 253 PHE CA C N S 254 PHE C C N N 255 PHE O O N N 256 PHE CB C N N 257 PHE CG C Y N 258 PHE CD1 C Y N 259 PHE CD2 C Y N 260 PHE CE1 C Y N 261 PHE CE2 C Y N 262 PHE CZ C Y N 263 PHE OXT O N N 264 PHE H H N N 265 PHE H2 H N N 266 PHE HA H N N 267 PHE HB2 H N N 268 PHE HB3 H N N 269 PHE HD1 H N N 270 PHE HD2 H N N 271 PHE HE1 H N N 272 PHE HE2 H N N 273 PHE HZ H N N 274 PHE HXT H N N 275 PRO N N N N 276 PRO CA C N S 277 PRO C C N N 278 PRO O O N N 279 PRO CB C N N 280 PRO CG C N N 281 PRO CD C N N 282 PRO OXT O N N 283 PRO H H N N 284 PRO HA H N N 285 PRO HB2 H N N 286 PRO HB3 H N N 287 PRO HG2 H N N 288 PRO HG3 H N N 289 PRO HD2 H N N 290 PRO HD3 H N N 291 PRO HXT H N N 292 SER N N N N 293 SER CA C N S 294 SER C C N N 295 SER O O N N 296 SER CB C N N 297 SER OG O N N 298 SER OXT O N N 299 SER H H N N 300 SER H2 H N N 301 SER HA H N N 302 SER HB2 H N N 303 SER HB3 H N N 304 SER HG H N N 305 SER HXT H N N 306 THR N N N N 307 THR CA C N S 308 THR C C N N 309 THR O O N N 310 THR CB C N R 311 THR OG1 O N N 312 THR CG2 C N N 313 THR OXT O N N 314 THR H H N N 315 THR H2 H N N 316 THR HA H N N 317 THR HB H N N 318 THR HG1 H N N 319 THR HG21 H N N 320 THR HG22 H N N 321 THR HG23 H N N 322 THR HXT H N N 323 TRP N N N N 324 TRP CA C N S 325 TRP C C N N 326 TRP O O N N 327 TRP CB C N N 328 TRP CG C Y N 329 TRP CD1 C Y N 330 TRP CD2 C Y N 331 TRP NE1 N Y N 332 TRP CE2 C Y N 333 TRP CE3 C Y N 334 TRP CZ2 C Y N 335 TRP CZ3 C Y N 336 TRP CH2 C Y N 337 TRP OXT O N N 338 TRP H H N N 339 TRP H2 H N N 340 TRP HA H N N 341 TRP HB2 H N N 342 TRP HB3 H N N 343 TRP HD1 H N N 344 TRP HE1 H N N 345 TRP HE3 H N N 346 TRP HZ2 H N N 347 TRP HZ3 H N N 348 TRP HH2 H N N 349 TRP HXT H N N 350 TYR N N N N 351 TYR CA C N S 352 TYR C C N N 353 TYR O O N N 354 TYR CB C N N 355 TYR CG C Y N 356 TYR CD1 C Y N 357 TYR CD2 C Y N 358 TYR CE1 C Y N 359 TYR CE2 C Y N 360 TYR CZ C Y N 361 TYR OH O N N 362 TYR OXT O N N 363 TYR H H N N 364 TYR H2 H N N 365 TYR HA H N N 366 TYR HB2 H N N 367 TYR HB3 H N N 368 TYR HD1 H N N 369 TYR HD2 H N N 370 TYR HE1 H N N 371 TYR HE2 H N N 372 TYR HH H N N 373 TYR HXT H N N 374 VAL N N N N 375 VAL CA C N S 376 VAL C C N N 377 VAL O O N N 378 VAL CB C N N 379 VAL CG1 C N N 380 VAL CG2 C N N 381 VAL OXT O N N 382 VAL H H N N 383 VAL H2 H N N 384 VAL HA H N N 385 VAL HB H N N 386 VAL HG11 H N N 387 VAL HG12 H N N 388 VAL HG13 H N N 389 VAL HG21 H N N 390 VAL HG22 H N N 391 VAL HG23 H N N 392 VAL HXT H N N 393 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id FE2 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id FE2 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1R03 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7O64 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.005430 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.005430 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005430 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CL FE MG N O S # loop_