data_7OB7 # _entry.id 7OB7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.384 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7OB7 pdb_00007ob7 10.2210/pdb7ob7/pdb WWPDB D_1292115401 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-04-27 2 'Structure model' 1 1 2022-05-25 3 'Structure model' 1 2 2024-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Derived calculations' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' atom_type 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 3 'Structure model' '_atom_type.pdbx_N_electrons' 3 3 'Structure model' '_atom_type.pdbx_scat_Z' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7OB7 _pdbx_database_status.recvd_initial_deposition_date 2021-04-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 7OB6 unspecified PDB . 7PJO unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email ehmke.pohl@durham.ac.uk _pdbx_contact_author.name_first Ehmke _pdbx_contact_author.name_last Pohl _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-9949-4471 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Cornish, K.A.S.' 1 0000-0002-2075-1851 'Pohl, E.' 2 0000-0002-9949-4471 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Biol.Chem. _citation.journal_id_ASTM JBCHA3 _citation.journal_id_CSD 0071 _citation.journal_id_ISSN 1083-351X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 298 _citation.language ? _citation.page_first 101919 _citation.page_last 101919 _citation.title 'CPR-C4 is a highly conserved novel protease from the Candidate Phyla Radiation with remote structural homology to human vasohibins.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jbc.2022.101919 _citation.pdbx_database_id_PubMed 35405098 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Cornish, K.A.S.' 1 ? primary 'Lange, J.' 2 ? primary 'Aevarsson, A.' 3 ? primary 'Pohl, E.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man CPR-C4 27174.287 1 ? ? ? ? 2 water nat water 18.015 18 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;TMITHHHHHHGSMHYKAQLQKLLTTEEKKILARLSTPQKIQDFLDTIKNKDLAEGEHTMWSPRAVLKHKHAHCMEGAMLA ALALAYHGHSPLLMDLQTTDEDEDHVVALFKIDGHWGAISKTNHPVLRYRDPIYKSVRELAMSYFHEYFIWWTKKNGGKK TLRAYSNPFDLTRYKPERWVIATGDLDWLAEALDDSKHFPILNKKMQKQLRPASRIETKAASLSEWPKRKTNS ; _entity_poly.pdbx_seq_one_letter_code_can ;TMITHHHHHHGSMHYKAQLQKLLTTEEKKILARLSTPQKIQDFLDTIKNKDLAEGEHTMWSPRAVLKHKHAHCMEGAMLA ALALAYHGHSPLLMDLQTTDEDEDHVVALFKIDGHWGAISKTNHPVLRYRDPIYKSVRELAMSYFHEYFIWWTKKNGGKK TLRAYSNPFDLTRYKPERWVIATGDLDWLAEALDDSKHFPILNKKMQKQLRPASRIETKAASLSEWPKRKTNS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 MET n 1 3 ILE n 1 4 THR n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 GLY n 1 12 SER n 1 13 MET n 1 14 HIS n 1 15 TYR n 1 16 LYS n 1 17 ALA n 1 18 GLN n 1 19 LEU n 1 20 GLN n 1 21 LYS n 1 22 LEU n 1 23 LEU n 1 24 THR n 1 25 THR n 1 26 GLU n 1 27 GLU n 1 28 LYS n 1 29 LYS n 1 30 ILE n 1 31 LEU n 1 32 ALA n 1 33 ARG n 1 34 LEU n 1 35 SER n 1 36 THR n 1 37 PRO n 1 38 GLN n 1 39 LYS n 1 40 ILE n 1 41 GLN n 1 42 ASP n 1 43 PHE n 1 44 LEU n 1 45 ASP n 1 46 THR n 1 47 ILE n 1 48 LYS n 1 49 ASN n 1 50 LYS n 1 51 ASP n 1 52 LEU n 1 53 ALA n 1 54 GLU n 1 55 GLY n 1 56 GLU n 1 57 HIS n 1 58 THR n 1 59 MET n 1 60 TRP n 1 61 SER n 1 62 PRO n 1 63 ARG n 1 64 ALA n 1 65 VAL n 1 66 LEU n 1 67 LYS n 1 68 HIS n 1 69 LYS n 1 70 HIS n 1 71 ALA n 1 72 HIS n 1 73 CYS n 1 74 MET n 1 75 GLU n 1 76 GLY n 1 77 ALA n 1 78 MET n 1 79 LEU n 1 80 ALA n 1 81 ALA n 1 82 LEU n 1 83 ALA n 1 84 LEU n 1 85 ALA n 1 86 TYR n 1 87 HIS n 1 88 GLY n 1 89 HIS n 1 90 SER n 1 91 PRO n 1 92 LEU n 1 93 LEU n 1 94 MET n 1 95 ASP n 1 96 LEU n 1 97 GLN n 1 98 THR n 1 99 THR n 1 100 ASP n 1 101 GLU n 1 102 ASP n 1 103 GLU n 1 104 ASP n 1 105 HIS n 1 106 VAL n 1 107 VAL n 1 108 ALA n 1 109 LEU n 1 110 PHE n 1 111 LYS n 1 112 ILE n 1 113 ASP n 1 114 GLY n 1 115 HIS n 1 116 TRP n 1 117 GLY n 1 118 ALA n 1 119 ILE n 1 120 SER n 1 121 LYS n 1 122 THR n 1 123 ASN n 1 124 HIS n 1 125 PRO n 1 126 VAL n 1 127 LEU n 1 128 ARG n 1 129 TYR n 1 130 ARG n 1 131 ASP n 1 132 PRO n 1 133 ILE n 1 134 TYR n 1 135 LYS n 1 136 SER n 1 137 VAL n 1 138 ARG n 1 139 GLU n 1 140 LEU n 1 141 ALA n 1 142 MET n 1 143 SER n 1 144 TYR n 1 145 PHE n 1 146 HIS n 1 147 GLU n 1 148 TYR n 1 149 PHE n 1 150 ILE n 1 151 TRP n 1 152 TRP n 1 153 THR n 1 154 LYS n 1 155 LYS n 1 156 ASN n 1 157 GLY n 1 158 GLY n 1 159 LYS n 1 160 LYS n 1 161 THR n 1 162 LEU n 1 163 ARG n 1 164 ALA n 1 165 TYR n 1 166 SER n 1 167 ASN n 1 168 PRO n 1 169 PHE n 1 170 ASP n 1 171 LEU n 1 172 THR n 1 173 ARG n 1 174 TYR n 1 175 LYS n 1 176 PRO n 1 177 GLU n 1 178 ARG n 1 179 TRP n 1 180 VAL n 1 181 ILE n 1 182 ALA n 1 183 THR n 1 184 GLY n 1 185 ASP n 1 186 LEU n 1 187 ASP n 1 188 TRP n 1 189 LEU n 1 190 ALA n 1 191 GLU n 1 192 ALA n 1 193 LEU n 1 194 ASP n 1 195 ASP n 1 196 SER n 1 197 LYS n 1 198 HIS n 1 199 PHE n 1 200 PRO n 1 201 ILE n 1 202 LEU n 1 203 ASN n 1 204 LYS n 1 205 LYS n 1 206 MET n 1 207 GLN n 1 208 LYS n 1 209 GLN n 1 210 LEU n 1 211 ARG n 1 212 PRO n 1 213 ALA n 1 214 SER n 1 215 ARG n 1 216 ILE n 1 217 GLU n 1 218 THR n 1 219 LYS n 1 220 ALA n 1 221 ALA n 1 222 SER n 1 223 LEU n 1 224 SER n 1 225 GLU n 1 226 TRP n 1 227 PRO n 1 228 LYS n 1 229 ARG n 1 230 LYS n 1 231 THR n 1 232 ASN n 1 233 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 233 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'candidate division CPR1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1618338 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 -11 ? ? ? A . n A 1 2 MET 2 -10 ? ? ? A . n A 1 3 ILE 3 -9 ? ? ? A . n A 1 4 THR 4 -8 ? ? ? A . n A 1 5 HIS 5 -7 ? ? ? A . n A 1 6 HIS 6 -6 ? ? ? A . n A 1 7 HIS 7 -5 ? ? ? A . n A 1 8 HIS 8 -4 ? ? ? A . n A 1 9 HIS 9 -3 ? ? ? A . n A 1 10 HIS 10 -2 ? ? ? A . n A 1 11 GLY 11 -1 ? ? ? A . n A 1 12 SER 12 0 ? ? ? A . n A 1 13 MET 13 1 1 MET MET A . n A 1 14 HIS 14 2 2 HIS HIS A . n A 1 15 TYR 15 3 3 TYR TYR A . n A 1 16 LYS 16 4 4 LYS LYS A . n A 1 17 ALA 17 5 5 ALA ALA A . n A 1 18 GLN 18 6 6 GLN GLN A . n A 1 19 LEU 19 7 7 LEU LEU A . n A 1 20 GLN 20 8 8 GLN GLN A . n A 1 21 LYS 21 9 9 LYS LYS A . n A 1 22 LEU 22 10 10 LEU LEU A . n A 1 23 LEU 23 11 11 LEU LEU A . n A 1 24 THR 24 12 12 THR THR A . n A 1 25 THR 25 13 13 THR THR A . n A 1 26 GLU 26 14 14 GLU GLU A . n A 1 27 GLU 27 15 15 GLU GLU A . n A 1 28 LYS 28 16 16 LYS LYS A . n A 1 29 LYS 29 17 17 LYS LYS A . n A 1 30 ILE 30 18 18 ILE ILE A . n A 1 31 LEU 31 19 19 LEU LEU A . n A 1 32 ALA 32 20 20 ALA ALA A . n A 1 33 ARG 33 21 21 ARG ARG A . n A 1 34 LEU 34 22 22 LEU LEU A . n A 1 35 SER 35 23 23 SER SER A . n A 1 36 THR 36 24 24 THR THR A . n A 1 37 PRO 37 25 25 PRO PRO A . n A 1 38 GLN 38 26 26 GLN GLN A . n A 1 39 LYS 39 27 27 LYS LYS A . n A 1 40 ILE 40 28 28 ILE ILE A . n A 1 41 GLN 41 29 29 GLN GLN A . n A 1 42 ASP 42 30 30 ASP ASP A . n A 1 43 PHE 43 31 31 PHE PHE A . n A 1 44 LEU 44 32 32 LEU LEU A . n A 1 45 ASP 45 33 33 ASP ASP A . n A 1 46 THR 46 34 34 THR THR A . n A 1 47 ILE 47 35 35 ILE ILE A . n A 1 48 LYS 48 36 36 LYS LYS A . n A 1 49 ASN 49 37 37 ASN ASN A . n A 1 50 LYS 50 38 38 LYS LYS A . n A 1 51 ASP 51 39 ? ? ? A . n A 1 52 LEU 52 40 ? ? ? A . n A 1 53 ALA 53 41 ? ? ? A . n A 1 54 GLU 54 42 ? ? ? A . n A 1 55 GLY 55 43 ? ? ? A . n A 1 56 GLU 56 44 ? ? ? A . n A 1 57 HIS 57 45 45 HIS HIS A . n A 1 58 THR 58 46 46 THR THR A . n A 1 59 MET 59 47 47 MET MET A . n A 1 60 TRP 60 48 48 TRP TRP A . n A 1 61 SER 61 49 49 SER SER A . n A 1 62 PRO 62 50 50 PRO PRO A . n A 1 63 ARG 63 51 51 ARG ARG A . n A 1 64 ALA 64 52 52 ALA ALA A . n A 1 65 VAL 65 53 53 VAL VAL A . n A 1 66 LEU 66 54 54 LEU LEU A . n A 1 67 LYS 67 55 55 LYS LYS A . n A 1 68 HIS 68 56 56 HIS HIS A . n A 1 69 LYS 69 57 57 LYS LYS A . n A 1 70 HIS 70 58 58 HIS HIS A . n A 1 71 ALA 71 59 59 ALA ALA A . n A 1 72 HIS 72 60 60 HIS HIS A . n A 1 73 CYS 73 61 61 CYS CYS A . n A 1 74 MET 74 62 62 MET MET A . n A 1 75 GLU 75 63 63 GLU GLU A . n A 1 76 GLY 76 64 64 GLY GLY A . n A 1 77 ALA 77 65 65 ALA ALA A . n A 1 78 MET 78 66 66 MET MET A . n A 1 79 LEU 79 67 67 LEU LEU A . n A 1 80 ALA 80 68 68 ALA ALA A . n A 1 81 ALA 81 69 69 ALA ALA A . n A 1 82 LEU 82 70 70 LEU LEU A . n A 1 83 ALA 83 71 71 ALA ALA A . n A 1 84 LEU 84 72 72 LEU LEU A . n A 1 85 ALA 85 73 73 ALA ALA A . n A 1 86 TYR 86 74 74 TYR TYR A . n A 1 87 HIS 87 75 75 HIS HIS A . n A 1 88 GLY 88 76 76 GLY GLY A . n A 1 89 HIS 89 77 77 HIS HIS A . n A 1 90 SER 90 78 78 SER SER A . n A 1 91 PRO 91 79 79 PRO PRO A . n A 1 92 LEU 92 80 80 LEU LEU A . n A 1 93 LEU 93 81 81 LEU LEU A . n A 1 94 MET 94 82 82 MET MET A . n A 1 95 ASP 95 83 83 ASP ASP A . n A 1 96 LEU 96 84 84 LEU LEU A . n A 1 97 GLN 97 85 85 GLN GLN A . n A 1 98 THR 98 86 86 THR THR A . n A 1 99 THR 99 87 87 THR THR A . n A 1 100 ASP 100 88 88 ASP ASP A . n A 1 101 GLU 101 89 89 GLU GLU A . n A 1 102 ASP 102 90 90 ASP ASP A . n A 1 103 GLU 103 91 91 GLU GLU A . n A 1 104 ASP 104 92 92 ASP ASP A . n A 1 105 HIS 105 93 93 HIS HIS A . n A 1 106 VAL 106 94 94 VAL VAL A . n A 1 107 VAL 107 95 95 VAL VAL A . n A 1 108 ALA 108 96 96 ALA ALA A . n A 1 109 LEU 109 97 97 LEU LEU A . n A 1 110 PHE 110 98 98 PHE PHE A . n A 1 111 LYS 111 99 99 LYS LYS A . n A 1 112 ILE 112 100 100 ILE ILE A . n A 1 113 ASP 113 101 101 ASP ASP A . n A 1 114 GLY 114 102 102 GLY GLY A . n A 1 115 HIS 115 103 103 HIS HIS A . n A 1 116 TRP 116 104 104 TRP TRP A . n A 1 117 GLY 117 105 105 GLY GLY A . n A 1 118 ALA 118 106 106 ALA ALA A . n A 1 119 ILE 119 107 107 ILE ILE A . n A 1 120 SER 120 108 108 SER SER A . n A 1 121 LYS 121 109 109 LYS LYS A . n A 1 122 THR 122 110 110 THR THR A . n A 1 123 ASN 123 111 111 ASN ASN A . n A 1 124 HIS 124 112 112 HIS HIS A . n A 1 125 PRO 125 113 113 PRO PRO A . n A 1 126 VAL 126 114 114 VAL VAL A . n A 1 127 LEU 127 115 115 LEU LEU A . n A 1 128 ARG 128 116 116 ARG ARG A . n A 1 129 TYR 129 117 117 TYR TYR A . n A 1 130 ARG 130 118 118 ARG ARG A . n A 1 131 ASP 131 119 119 ASP ASP A . n A 1 132 PRO 132 120 120 PRO PRO A . n A 1 133 ILE 133 121 121 ILE ILE A . n A 1 134 TYR 134 122 122 TYR TYR A . n A 1 135 LYS 135 123 123 LYS LYS A . n A 1 136 SER 136 124 124 SER SER A . n A 1 137 VAL 137 125 125 VAL VAL A . n A 1 138 ARG 138 126 126 ARG ARG A . n A 1 139 GLU 139 127 127 GLU GLU A . n A 1 140 LEU 140 128 128 LEU LEU A . n A 1 141 ALA 141 129 129 ALA ALA A . n A 1 142 MET 142 130 130 MET MET A . n A 1 143 SER 143 131 131 SER SER A . n A 1 144 TYR 144 132 132 TYR TYR A . n A 1 145 PHE 145 133 133 PHE PHE A . n A 1 146 HIS 146 134 134 HIS HIS A . n A 1 147 GLU 147 135 135 GLU GLU A . n A 1 148 TYR 148 136 136 TYR TYR A . n A 1 149 PHE 149 137 137 PHE PHE A . n A 1 150 ILE 150 138 138 ILE ILE A . n A 1 151 TRP 151 139 139 TRP TRP A . n A 1 152 TRP 152 140 140 TRP TRP A . n A 1 153 THR 153 141 141 THR THR A . n A 1 154 LYS 154 142 142 LYS LYS A . n A 1 155 LYS 155 143 143 LYS LYS A . n A 1 156 ASN 156 144 144 ASN ASN A . n A 1 157 GLY 157 145 145 GLY GLY A . n A 1 158 GLY 158 146 146 GLY GLY A . n A 1 159 LYS 159 147 147 LYS LYS A . n A 1 160 LYS 160 148 148 LYS LYS A . n A 1 161 THR 161 149 149 THR THR A . n A 1 162 LEU 162 150 150 LEU LEU A . n A 1 163 ARG 163 151 151 ARG ARG A . n A 1 164 ALA 164 152 152 ALA ALA A . n A 1 165 TYR 165 153 153 TYR TYR A . n A 1 166 SER 166 154 154 SER SER A . n A 1 167 ASN 167 155 155 ASN ASN A . n A 1 168 PRO 168 156 156 PRO PRO A . n A 1 169 PHE 169 157 157 PHE PHE A . n A 1 170 ASP 170 158 158 ASP ASP A . n A 1 171 LEU 171 159 159 LEU LEU A . n A 1 172 THR 172 160 160 THR THR A . n A 1 173 ARG 173 161 161 ARG ARG A . n A 1 174 TYR 174 162 162 TYR TYR A . n A 1 175 LYS 175 163 163 LYS LYS A . n A 1 176 PRO 176 164 164 PRO PRO A . n A 1 177 GLU 177 165 165 GLU GLU A . n A 1 178 ARG 178 166 166 ARG ARG A . n A 1 179 TRP 179 167 167 TRP TRP A . n A 1 180 VAL 180 168 168 VAL VAL A . n A 1 181 ILE 181 169 169 ILE ILE A . n A 1 182 ALA 182 170 170 ALA ALA A . n A 1 183 THR 183 171 171 THR THR A . n A 1 184 GLY 184 172 172 GLY GLY A . n A 1 185 ASP 185 173 173 ASP ASP A . n A 1 186 LEU 186 174 174 LEU LEU A . n A 1 187 ASP 187 175 175 ASP ASP A . n A 1 188 TRP 188 176 176 TRP TRP A . n A 1 189 LEU 189 177 177 LEU LEU A . n A 1 190 ALA 190 178 178 ALA ALA A . n A 1 191 GLU 191 179 179 GLU GLU A . n A 1 192 ALA 192 180 180 ALA ALA A . n A 1 193 LEU 193 181 181 LEU LEU A . n A 1 194 ASP 194 182 182 ASP ASP A . n A 1 195 ASP 195 183 183 ASP ASP A . n A 1 196 SER 196 184 184 SER SER A . n A 1 197 LYS 197 185 185 LYS LYS A . n A 1 198 HIS 198 186 186 HIS HIS A . n A 1 199 PHE 199 187 187 PHE PHE A . n A 1 200 PRO 200 188 188 PRO PRO A . n A 1 201 ILE 201 189 189 ILE ILE A . n A 1 202 LEU 202 190 190 LEU LEU A . n A 1 203 ASN 203 191 191 ASN ASN A . n A 1 204 LYS 204 192 192 LYS LYS A . n A 1 205 LYS 205 193 193 LYS LYS A . n A 1 206 MET 206 194 194 MET MET A . n A 1 207 GLN 207 195 195 GLN GLN A . n A 1 208 LYS 208 196 196 LYS LYS A . n A 1 209 GLN 209 197 197 GLN GLN A . n A 1 210 LEU 210 198 198 LEU LEU A . n A 1 211 ARG 211 199 199 ARG ARG A . n A 1 212 PRO 212 200 200 PRO PRO A . n A 1 213 ALA 213 201 201 ALA ALA A . n A 1 214 SER 214 202 202 SER SER A . n A 1 215 ARG 215 203 203 ARG ARG A . n A 1 216 ILE 216 204 204 ILE ILE A . n A 1 217 GLU 217 205 205 GLU GLU A . n A 1 218 THR 218 206 206 THR THR A . n A 1 219 LYS 219 207 207 LYS LYS A . n A 1 220 ALA 220 208 208 ALA ALA A . n A 1 221 ALA 221 209 209 ALA ALA A . n A 1 222 SER 222 210 210 SER SER A . n A 1 223 LEU 223 211 211 LEU LEU A . n A 1 224 SER 224 212 212 SER SER A . n A 1 225 GLU 225 213 213 GLU GLU A . n A 1 226 TRP 226 214 214 TRP TRP A . n A 1 227 PRO 227 215 215 PRO PRO A . n A 1 228 LYS 228 216 216 LYS LYS A . n A 1 229 ARG 229 217 217 ARG ARG A . n A 1 230 LYS 230 218 ? ? ? A . n A 1 231 THR 231 219 ? ? ? A . n A 1 232 ASN 232 220 ? ? ? A . n A 1 233 SER 233 221 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 301 12 HOH HOH A . B 2 HOH 2 302 5 HOH HOH A . B 2 HOH 3 303 2 HOH HOH A . B 2 HOH 4 304 3 HOH HOH A . B 2 HOH 5 305 4 HOH HOH A . B 2 HOH 6 306 16 HOH HOH A . B 2 HOH 7 307 10 HOH HOH A . B 2 HOH 8 308 1 HOH HOH A . B 2 HOH 9 309 18 HOH HOH A . B 2 HOH 10 310 8 HOH HOH A . B 2 HOH 11 311 15 HOH HOH A . B 2 HOH 12 312 13 HOH HOH A . B 2 HOH 13 313 14 HOH HOH A . B 2 HOH 14 314 6 HOH HOH A . B 2 HOH 15 315 7 HOH HOH A . B 2 HOH 16 316 11 HOH HOH A . B 2 HOH 17 317 9 HOH HOH A . B 2 HOH 18 318 17 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A MET 1 ? CG ? A MET 13 CG 2 1 Y 1 A MET 1 ? SD ? A MET 13 SD 3 1 Y 1 A MET 1 ? CE ? A MET 13 CE 4 1 Y 1 A LYS 9 ? CG ? A LYS 21 CG 5 1 Y 1 A LYS 9 ? CD ? A LYS 21 CD 6 1 Y 1 A LYS 9 ? CE ? A LYS 21 CE 7 1 Y 1 A LYS 9 ? NZ ? A LYS 21 NZ 8 1 Y 1 A LYS 36 ? CG ? A LYS 48 CG 9 1 Y 1 A LYS 36 ? CD ? A LYS 48 CD 10 1 Y 1 A LYS 36 ? CE ? A LYS 48 CE 11 1 Y 1 A LYS 36 ? NZ ? A LYS 48 NZ 12 1 Y 1 A HIS 45 ? CG ? A HIS 57 CG 13 1 Y 1 A HIS 45 ? ND1 ? A HIS 57 ND1 14 1 Y 1 A HIS 45 ? CD2 ? A HIS 57 CD2 15 1 Y 1 A HIS 45 ? CE1 ? A HIS 57 CE1 16 1 Y 1 A HIS 45 ? NE2 ? A HIS 57 NE2 17 1 Y 1 A LYS 55 ? CG ? A LYS 67 CG 18 1 Y 1 A LYS 55 ? CD ? A LYS 67 CD 19 1 Y 1 A LYS 55 ? CE ? A LYS 67 CE 20 1 Y 1 A LYS 55 ? NZ ? A LYS 67 NZ 21 1 Y 1 A LYS 57 ? CG ? A LYS 69 CG 22 1 Y 1 A LYS 57 ? CD ? A LYS 69 CD 23 1 Y 1 A LYS 57 ? CE ? A LYS 69 CE 24 1 Y 1 A LYS 57 ? NZ ? A LYS 69 NZ 25 1 Y 1 A ASP 88 ? CG ? A ASP 100 CG 26 1 Y 1 A ASP 88 ? OD1 ? A ASP 100 OD1 27 1 Y 1 A ASP 88 ? OD2 ? A ASP 100 OD2 28 1 Y 1 A GLU 91 ? CG ? A GLU 103 CG 29 1 Y 1 A GLU 91 ? CD ? A GLU 103 CD 30 1 Y 1 A GLU 91 ? OE1 ? A GLU 103 OE1 31 1 Y 1 A GLU 91 ? OE2 ? A GLU 103 OE2 32 1 Y 1 A ASP 101 ? CG ? A ASP 113 CG 33 1 Y 1 A ASP 101 ? OD1 ? A ASP 113 OD1 34 1 Y 1 A ASP 101 ? OD2 ? A ASP 113 OD2 35 1 Y 1 A LYS 123 ? CG ? A LYS 135 CG 36 1 Y 1 A LYS 123 ? CD ? A LYS 135 CD 37 1 Y 1 A LYS 123 ? CE ? A LYS 135 CE 38 1 Y 1 A LYS 123 ? NZ ? A LYS 135 NZ 39 1 Y 1 A LYS 142 ? CG ? A LYS 154 CG 40 1 Y 1 A LYS 142 ? CD ? A LYS 154 CD 41 1 Y 1 A LYS 142 ? CE ? A LYS 154 CE 42 1 Y 1 A LYS 142 ? NZ ? A LYS 154 NZ 43 1 Y 1 A LYS 143 ? CG ? A LYS 155 CG 44 1 Y 1 A LYS 143 ? CD ? A LYS 155 CD 45 1 Y 1 A LYS 143 ? CE ? A LYS 155 CE 46 1 Y 1 A LYS 143 ? NZ ? A LYS 155 NZ 47 1 Y 1 A ARG 161 ? CG ? A ARG 173 CG 48 1 Y 1 A ARG 161 ? CD ? A ARG 173 CD 49 1 Y 1 A ARG 161 ? NE ? A ARG 173 NE 50 1 Y 1 A ARG 161 ? CZ ? A ARG 173 CZ 51 1 Y 1 A ARG 161 ? NH1 ? A ARG 173 NH1 52 1 Y 1 A ARG 161 ? NH2 ? A ARG 173 NH2 53 1 Y 1 A LYS 163 ? CG ? A LYS 175 CG 54 1 Y 1 A LYS 163 ? CD ? A LYS 175 CD 55 1 Y 1 A LYS 163 ? CE ? A LYS 175 CE 56 1 Y 1 A LYS 163 ? NZ ? A LYS 175 NZ 57 1 Y 1 A ASP 183 ? CG ? A ASP 195 CG 58 1 Y 1 A ASP 183 ? OD1 ? A ASP 195 OD1 59 1 Y 1 A ASP 183 ? OD2 ? A ASP 195 OD2 60 1 Y 1 A LYS 192 ? CG ? A LYS 204 CG 61 1 Y 1 A LYS 192 ? CD ? A LYS 204 CD 62 1 Y 1 A LYS 192 ? CE ? A LYS 204 CE 63 1 Y 1 A LYS 192 ? NZ ? A LYS 204 NZ 64 1 Y 1 A LYS 193 ? CG ? A LYS 205 CG 65 1 Y 1 A LYS 193 ? CD ? A LYS 205 CD 66 1 Y 1 A LYS 193 ? CE ? A LYS 205 CE 67 1 Y 1 A LYS 193 ? NZ ? A LYS 205 NZ 68 1 Y 1 A LYS 196 ? CG ? A LYS 208 CG 69 1 Y 1 A LYS 196 ? CD ? A LYS 208 CD 70 1 Y 1 A LYS 196 ? CE ? A LYS 208 CE 71 1 Y 1 A LYS 196 ? NZ ? A LYS 208 NZ 72 1 Y 1 A ARG 203 ? CG ? A ARG 215 CG 73 1 Y 1 A ARG 203 ? CD ? A ARG 215 CD 74 1 Y 1 A ARG 203 ? NE ? A ARG 215 NE 75 1 Y 1 A ARG 203 ? CZ ? A ARG 215 CZ 76 1 Y 1 A ARG 203 ? NH1 ? A ARG 215 NH1 77 1 Y 1 A ARG 203 ? NH2 ? A ARG 215 NH2 78 1 Y 1 A LYS 216 ? CG ? A LYS 228 CG 79 1 Y 1 A LYS 216 ? CD ? A LYS 228 CD 80 1 Y 1 A LYS 216 ? CE ? A LYS 228 CE 81 1 Y 1 A LYS 216 ? NZ ? A LYS 228 NZ 82 1 Y 1 A ARG 217 ? CG ? A ARG 229 CG 83 1 Y 1 A ARG 217 ? CD ? A ARG 229 CD 84 1 Y 1 A ARG 217 ? NE ? A ARG 229 NE 85 1 Y 1 A ARG 217 ? CZ ? A ARG 229 CZ 86 1 Y 1 A ARG 217 ? NH1 ? A ARG 229 NH1 87 1 Y 1 A ARG 217 ? NH2 ? A ARG 229 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? . 4 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? pointless ? ? ? . 5 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 6 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7OB7 _cell.details ? _cell.formula_units_Z ? _cell.length_a 56.307 _cell.length_a_esd ? _cell.length_b 79.731 _cell.length_b_esd ? _cell.length_c 126.196 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7OB7 _symmetry.cell_setting ? _symmetry.Int_Tables_number 23 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7OB7 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.61 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 52.80 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'sodium malonate dibasic monohydrate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-12-08 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.2819 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I24' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.2819 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I24 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7OB7 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.581 _reflns.d_resolution_low 67.405 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9190 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.7 _reflns.pdbx_Rmerge_I_obs 0.505 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 6.8 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.562 _reflns.pdbx_Rpim_I_all 0.243 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.968 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 8.93 67.40 ? ? ? ? ? ? 260 ? ? ? ? ? 0.133 ? ? ? ? ? ? ? ? 8.4 ? ? ? ? 0.150 0.068 ? 1 1 0.986 ? ? ? ? ? ? ? ? ? ? 2.581 2.69 ? ? ? ? ? ? 1015 ? ? ? ? ? 7.895 ? ? ? ? ? ? ? ? 8.2 ? ? ? ? 8.889 3.982 ? 2 1 0.181 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] -1.940 _refine.aniso_B[1][2] -0.000 _refine.aniso_B[1][3] -0.000 _refine.aniso_B[2][2] 6.080 _refine.aniso_B[2][3] 0.000 _refine.aniso_B[3][3] -4.140 _refine.B_iso_max ? _refine.B_iso_mean 49.032 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.919 _refine.correlation_coeff_Fo_to_Fc_free 0.914 _refine.details 'Hydrogens have not been used' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7OB7 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.682 _refine.ls_d_res_low 67.405 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8193 _refine.ls_number_reflns_R_free 398 _refine.ls_number_reflns_R_work 7795 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.747 _refine.ls_percent_reflns_R_free 4.858 _refine.ls_R_factor_all 0.236 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2506 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2348 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 7OB6 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.789 _refine.pdbx_overall_ESU_R_Free 0.318 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 17.409 _refine.overall_SU_ML 0.324 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.682 _refine_hist.d_res_low 67.405 _refine_hist.number_atoms_solvent 18 _refine_hist.number_atoms_total 1671 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1653 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 0.012 1700 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.223 0.100 27272 ? r_ext_dist_refined_d ? ? 'X-RAY DIFFRACTION' ? 1.406 1.632 2317 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 7.331 5.000 209 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 32.876 22.000 80 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 14.335 15.000 266 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 19.829 15.000 8 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.093 0.200 227 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 0.020 1286 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.195 0.200 663 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.296 0.200 1153 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.128 0.200 35 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.304 0.200 31 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.194 0.200 5 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 3.833 4.894 842 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 5.989 7.330 1049 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 5.740 5.308 858 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 8.816 7.776 1268 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 14.438 188.929 27361 ? r_lrange_it ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.682 2.751 621 . 33 515 88.2448 . 0.391 . 0.408 . 0.390 . . . . . 0.353 . 20 . 0.330 0.253 'X-RAY DIFFRACTION' 2.751 2.827 560 . 24 534 99.6429 . 0.369 . 0.375 . 0.369 . . . . . 0.318 . 20 . 0.477 0.454 'X-RAY DIFFRACTION' 2.827 2.908 563 . 29 534 100.0000 . 0.326 . 0.346 . 0.325 . . . . . 0.291 . 20 . 0.588 0.548 'X-RAY DIFFRACTION' 2.908 2.998 558 . 26 532 100.0000 . 0.319 . 0.331 . 0.319 . . . . . 0.295 . 20 . 0.711 0.682 'X-RAY DIFFRACTION' 2.998 3.096 533 . 27 505 99.8124 . 0.283 . 0.337 . 0.280 . . . . . 0.246 . 20 . 0.812 0.815 'X-RAY DIFFRACTION' 3.096 3.204 522 . 29 492 99.8084 . 0.258 . 0.328 . 0.254 . . . . . 0.222 . 20 . 0.848 0.835 'X-RAY DIFFRACTION' 3.204 3.325 524 . 37 487 100.0000 . 0.229 . 0.239 . 0.228 . . . . . 0.200 . 20 . 0.895 0.877 'X-RAY DIFFRACTION' 3.325 3.460 488 . 20 466 99.5902 . 0.220 . 0.297 . 0.217 . . . . . 0.183 . 20 . 0.902 0.886 'X-RAY DIFFRACTION' 3.460 3.614 451 . 19 431 99.7783 . 0.199 . 0.173 . 0.200 . . . . . 0.177 . 20 . 0.930 0.952 'X-RAY DIFFRACTION' 3.614 3.790 448 . 17 431 100.0000 . 0.177 . 0.211 . 0.175 . . . . . 0.152 . 20 . 0.952 0.938 'X-RAY DIFFRACTION' 3.790 3.994 432 . 22 406 99.0741 . 0.173 . 0.195 . 0.171 . . . . . 0.160 . 20 . 0.954 0.952 'X-RAY DIFFRACTION' 3.994 4.235 399 . 24 369 98.4962 . 0.170 . 0.180 . 0.169 . . . . . 0.154 . 20 . 0.953 0.955 'X-RAY DIFFRACTION' 4.235 4.527 375 . 19 356 100.0000 . 0.180 . 0.204 . 0.179 . . . . . 0.165 . 20 . 0.948 0.960 'X-RAY DIFFRACTION' 4.527 4.887 366 . 22 338 98.3607 . 0.197 . 0.212 . 0.196 . . . . . 0.184 . 20 . 0.947 0.931 'X-RAY DIFFRACTION' 4.887 5.351 336 . 8 325 99.1071 . 0.210 . 0.301 . 0.208 . . . . . 0.198 . 20 . 0.938 0.914 'X-RAY DIFFRACTION' 5.351 5.978 298 . 10 286 99.3289 . 0.241 . 0.204 . 0.243 . . . . . 0.234 . 20 . 0.941 0.931 'X-RAY DIFFRACTION' 5.978 6.894 271 . 8 263 100.0000 . 0.266 . 0.210 . 0.268 . . . . . 0.259 . 20 . 0.926 0.947 'X-RAY DIFFRACTION' 6.894 8.421 237 . 11 226 100.0000 . 0.196 . 0.216 . 0.195 . . . . . 0.200 . 20 . 0.958 0.960 'X-RAY DIFFRACTION' 8.421 11.817 191 . 6 184 99.4764 . 0.206 . 0.276 . 0.204 . . . . . 0.229 . 20 . 0.975 0.966 'X-RAY DIFFRACTION' 11.817 67.405 123 . 6 115 98.3740 . 0.400 . 0.339 . 0.403 . . . . . 0.422 . 20 . 0.863 0.920 # _struct.entry_id 7OB7 _struct.title 'CPR-C4 - novel protease from the Candidate Phyla Radiation (CPR)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7OB7 _struct_keywords.text 'cysteine protease, peptidase, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 7OB7 _struct_ref.pdbx_db_accession 7OB7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7OB7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 233 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 7OB7 _struct_ref_seq.db_align_beg -11 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 221 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -11 _struct_ref_seq.pdbx_auth_seq_align_end 221 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3170 ? 1 MORE -13 ? 1 'SSA (A^2)' 17270 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 3_655 -x+1,y,-z -1.0000000000 0.0000000000 0.0000000000 56.3070000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 MET A 13 ? LEU A 23 ? MET A 1 LEU A 11 1 ? 11 HELX_P HELX_P2 AA2 THR A 24 ? LEU A 34 ? THR A 12 LEU A 22 1 ? 11 HELX_P HELX_P3 AA3 THR A 36 ? THR A 46 ? THR A 24 THR A 34 1 ? 11 HELX_P HELX_P4 AA4 SER A 61 ? LYS A 69 ? SER A 49 LYS A 57 1 ? 9 HELX_P HELX_P5 AA5 HIS A 72 ? HIS A 87 ? HIS A 60 HIS A 75 1 ? 16 HELX_P HELX_P6 AA6 SER A 136 ? SER A 143 ? SER A 124 SER A 131 1 ? 8 HELX_P HELX_P7 AA7 TYR A 144 ? TYR A 148 ? TYR A 132 TYR A 136 5 ? 5 HELX_P HELX_P8 AA8 THR A 172 ? TYR A 174 ? THR A 160 TYR A 162 5 ? 3 HELX_P HELX_P9 AA9 LYS A 175 ? TRP A 179 ? LYS A 163 TRP A 167 5 ? 5 HELX_P HELX_P10 AB1 LEU A 186 ? SER A 196 ? LEU A 174 SER A 184 1 ? 11 HELX_P HELX_P11 AB2 ASN A 203 ? LEU A 210 ? ASN A 191 LEU A 198 1 ? 8 HELX_P HELX_P12 AB3 SER A 214 ? LEU A 223 ? SER A 202 LEU A 211 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 5 ? AA3 ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel AA3 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 48 ? ASN A 49 ? LYS A 36 ASN A 37 AA1 2 HIS A 70 ? ALA A 71 ? HIS A 58 ALA A 59 AA2 1 ARG A 130 ? TYR A 134 ? ARG A 118 TYR A 122 AA2 2 HIS A 115 ? ILE A 119 ? HIS A 103 ILE A 107 AA2 3 HIS A 105 ? ILE A 112 ? HIS A 93 ILE A 100 AA2 4 LEU A 92 ? THR A 98 ? LEU A 80 THR A 86 AA2 5 PHE A 169 ? ASP A 170 ? PHE A 157 ASP A 158 AA3 1 ARG A 130 ? TYR A 134 ? ARG A 118 TYR A 122 AA3 2 HIS A 115 ? ILE A 119 ? HIS A 103 ILE A 107 AA3 3 HIS A 105 ? ILE A 112 ? HIS A 93 ILE A 100 AA3 4 LEU A 92 ? THR A 98 ? LEU A 80 THR A 86 AA3 5 LEU A 162 ? SER A 166 ? LEU A 150 SER A 154 AA3 6 HIS A 198 ? PRO A 200 ? HIS A 186 PRO A 188 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LYS A 48 ? N LYS A 36 O ALA A 71 ? O ALA A 59 AA2 1 2 O TYR A 134 ? O TYR A 122 N TRP A 116 ? N TRP A 104 AA2 2 3 O GLY A 117 ? O GLY A 105 N PHE A 110 ? N PHE A 98 AA2 3 4 O HIS A 105 ? O HIS A 93 N LEU A 96 ? N LEU A 84 AA2 4 5 N LEU A 93 ? N LEU A 81 O PHE A 169 ? O PHE A 157 AA3 1 2 O TYR A 134 ? O TYR A 122 N TRP A 116 ? N TRP A 104 AA3 2 3 O GLY A 117 ? O GLY A 105 N PHE A 110 ? N PHE A 98 AA3 3 4 O HIS A 105 ? O HIS A 93 N LEU A 96 ? N LEU A 84 AA3 4 5 N GLN A 97 ? N GLN A 85 O ALA A 164 ? O ALA A 152 AA3 5 6 N TYR A 165 ? N TYR A 153 O PHE A 199 ? O PHE A 187 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 113 ? ? -76.36 24.61 2 1 TRP A 167 ? ? -137.42 -37.36 3 1 ASP A 173 ? ? 72.09 123.85 4 1 LYS A 216 ? ? -91.52 30.66 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A THR -11 ? A THR 1 2 1 Y 1 A MET -10 ? A MET 2 3 1 Y 1 A ILE -9 ? A ILE 3 4 1 Y 1 A THR -8 ? A THR 4 5 1 Y 1 A HIS -7 ? A HIS 5 6 1 Y 1 A HIS -6 ? A HIS 6 7 1 Y 1 A HIS -5 ? A HIS 7 8 1 Y 1 A HIS -4 ? A HIS 8 9 1 Y 1 A HIS -3 ? A HIS 9 10 1 Y 1 A HIS -2 ? A HIS 10 11 1 Y 1 A GLY -1 ? A GLY 11 12 1 Y 1 A SER 0 ? A SER 12 13 1 Y 1 A ASP 39 ? A ASP 51 14 1 Y 1 A LEU 40 ? A LEU 52 15 1 Y 1 A ALA 41 ? A ALA 53 16 1 Y 1 A GLU 42 ? A GLU 54 17 1 Y 1 A GLY 43 ? A GLY 55 18 1 Y 1 A GLU 44 ? A GLU 56 19 1 Y 1 A LYS 218 ? A LYS 230 20 1 Y 1 A THR 219 ? A THR 231 21 1 Y 1 A ASN 220 ? A ASN 232 22 1 Y 1 A SER 221 ? A SER 233 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization 'European Commission' _pdbx_audit_support.country 'European Union' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 7OB6 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7OB7 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.017760 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012542 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007924 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 C 6 6 2.310 20.844 1.020 10.208 1.589 0.569 0.865 51.651 N 7 7 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 O 8 8 3.049 13.277 2.287 5.701 1.546 0.324 0.867 32.909 S 16 16 6.905 1.468 5.203 22.215 1.438 0.254 1.586 56.172 # loop_ #