data_7OD2 # _entry.id 7OD2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7OD2 pdb_00007od2 10.2210/pdb7od2/pdb WWPDB D_1292115147 ? ? BMRB 34619 ? 10.13018/BMR34619 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-04-06 2 'Structure model' 1 1 2024-11-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_entry_details 5 2 'Structure model' pdbx_modification_feature # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 2 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7OD2 _pdbx_database_status.recvd_initial_deposition_date 2021-04-28 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'NMR structure of the Anemonia erythraea AeTX-K toxin' _pdbx_database_related.db_id 34619 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Qasim, A.' 1 ? 'Qassem, N.' 2 ? 'Chill, J.H.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structural determination of AeTX-K by NMR' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Qasim, A.' 1 ? primary 'Shaked, H.' 2 ? primary 'Chill, J.H.' 3 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Kappa-actitoxin-Aer3a _entity.formula_weight 3998.740 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Kappa-AITX-Aer3a,AnerK,Potassium channel toxin AETX K' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ACKDYLPKSECTQFRCRTSMKYKYTNCKKTCGTC _entity_poly.pdbx_seq_one_letter_code_can ACKDYLPKSECTQFRCRTSMKYKYTNCKKTCGTC _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 CYS n 1 3 LYS n 1 4 ASP n 1 5 TYR n 1 6 LEU n 1 7 PRO n 1 8 LYS n 1 9 SER n 1 10 GLU n 1 11 CYS n 1 12 THR n 1 13 GLN n 1 14 PHE n 1 15 ARG n 1 16 CYS n 1 17 ARG n 1 18 THR n 1 19 SER n 1 20 MET n 1 21 LYS n 1 22 TYR n 1 23 LYS n 1 24 TYR n 1 25 THR n 1 26 ASN n 1 27 CYS n 1 28 LYS n 1 29 LYS n 1 30 THR n 1 31 CYS n 1 32 GLY n 1 33 THR n 1 34 CYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 34 _entity_src_gen.gene_src_common_name 'Sea anemone' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Anemonia erythraea' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 48400 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET-32a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 2 2 ALA ALA A . n A 1 2 CYS 2 3 3 CYS CYS A . n A 1 3 LYS 3 4 4 LYS LYS A . n A 1 4 ASP 4 5 5 ASP ASP A . n A 1 5 TYR 5 6 6 TYR TYR A . n A 1 6 LEU 6 7 7 LEU LEU A . n A 1 7 PRO 7 8 8 PRO PRO A . n A 1 8 LYS 8 9 9 LYS LYS A . n A 1 9 SER 9 10 10 SER SER A . n A 1 10 GLU 10 11 11 GLU GLU A . n A 1 11 CYS 11 12 12 CYS CYS A . n A 1 12 THR 12 13 13 THR THR A . n A 1 13 GLN 13 14 14 GLN GLN A . n A 1 14 PHE 14 15 15 PHE PHE A . n A 1 15 ARG 15 16 16 ARG ARG A . n A 1 16 CYS 16 17 17 CYS CYS A . n A 1 17 ARG 17 18 18 ARG ARG A . n A 1 18 THR 18 19 19 THR THR A . n A 1 19 SER 19 20 20 SER SER A . n A 1 20 MET 20 21 21 MET MET A . n A 1 21 LYS 21 22 22 LYS LYS A . n A 1 22 TYR 22 23 23 TYR TYR A . n A 1 23 LYS 23 24 24 LYS LYS A . n A 1 24 TYR 24 25 25 TYR TYR A . n A 1 25 THR 25 26 26 THR THR A . n A 1 26 ASN 26 27 27 ASN ASN A . n A 1 27 CYS 27 28 28 CYS CYS A . n A 1 28 LYS 28 29 29 LYS LYS A . n A 1 29 LYS 29 30 30 LYS LYS A . n A 1 30 THR 30 31 31 THR THR A . n A 1 31 CYS 31 32 32 CYS CYS A . n A 1 32 GLY 32 33 33 GLY GLY A . n A 1 33 THR 33 34 34 THR THR A . n A 1 34 CYS 34 35 35 CYS CYS A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7OD2 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7OD2 _struct.title 'NMR structure of the Anemonia erythraea AeTX-K toxin' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7OD2 _struct_keywords.text 'Sea anemone Kv channel blockers, TOXIN' _struct_keywords.pdbx_keywords TOXIN # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code K1A_ANEER _struct_ref.pdbx_db_accession Q0EAE5 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ACKDYLPKSECTQFRCRTSMKYKYTNCKKTCGTC _struct_ref.pdbx_align_begin 50 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7OD2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 34 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q0EAE5 _struct_ref_seq.db_align_beg 50 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 83 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 35 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 12 ? SER A 19 ? THR A 13 SER A 20 1 ? 8 HELX_P HELX_P2 AA2 SER A 19 ? THR A 25 ? SER A 20 THR A 26 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 2 SG ? ? ? 1_555 A CYS 34 SG ? ? A CYS 3 A CYS 35 1_555 ? ? ? ? ? ? ? 2.034 ? ? disulf2 disulf ? ? A CYS 11 SG ? ? ? 1_555 A CYS 27 SG ? ? A CYS 12 A CYS 28 1_555 ? ? ? ? ? ? ? 2.027 ? ? disulf3 disulf ? ? A CYS 16 SG ? ? ? 1_555 A CYS 31 SG ? ? A CYS 17 A CYS 32 1_555 ? ? ? ? ? ? ? 2.030 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 2 ? CYS A 34 ? CYS A 3 ? 1_555 CYS A 35 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 11 ? CYS A 27 ? CYS A 12 ? 1_555 CYS A 28 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 16 ? CYS A 31 ? CYS A 17 ? 1_555 CYS A 32 ? 1_555 SG SG . . . None 'Disulfide bridge' # _pdbx_entry_details.entry_id 7OD2 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 8 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 TYR _pdbx_validate_close_contact.auth_seq_id_1 23 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 H _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 CYS _pdbx_validate_close_contact.auth_seq_id_2 28 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 7 ? ? -174.36 -174.74 2 2 LEU A 7 ? ? -174.06 -174.89 3 3 LEU A 7 ? ? -175.59 -175.51 4 4 LEU A 7 ? ? -174.56 -174.81 5 5 LEU A 7 ? ? -175.88 -174.93 6 6 LEU A 7 ? ? -174.43 -174.90 7 7 LEU A 7 ? ? -175.70 -174.84 8 8 LEU A 7 ? ? -176.10 -174.05 9 9 LEU A 7 ? ? -176.04 -176.11 10 10 LEU A 7 ? ? -176.47 -174.85 11 11 LEU A 7 ? ? -176.11 -174.44 12 12 LEU A 7 ? ? -174.78 -174.90 13 13 LEU A 7 ? ? -174.10 -175.11 14 14 LEU A 7 ? ? -176.08 -175.79 15 15 LEU A 7 ? ? -176.49 -175.11 16 16 LEU A 7 ? ? -176.10 -174.73 17 17 LEU A 7 ? ? -176.35 -174.77 18 18 LEU A 7 ? ? -174.56 -174.91 19 19 LEU A 7 ? ? -174.14 -174.86 20 20 LEU A 7 ? ? -176.42 -174.79 21 21 LEU A 7 ? ? -174.19 -174.79 22 22 LEU A 7 ? ? -176.36 -174.76 23 23 LEU A 7 ? ? -174.49 -174.91 # _pdbx_nmr_ensemble.entry_id 7OD2 _pdbx_nmr_ensemble.conformers_calculated_total_number 82 _pdbx_nmr_ensemble.conformers_submitted_total_number 23 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7OD2 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 ;7 % [U-99% 2H] D2O, 93 % H2O, 0.01 % sodium azide, 20 mM sodium phosphate, 10 mM sodium chloride, 0.4 mM [U-98% 15N] AeTX-K toxin, 93% H2O/7% D2O ; '93% H2O/7% D2O' 15N solution 15N_AeTX-K 3 '100 % [U-99% 2H] D2O, 0.01 % sodium azide, 20 mM sodium phosphate, 10 mM sodium chloride, 0.4 mM AeTX-K toxin, 100% D2O' '100% D2O' non-label solution AeTX-K_D2O 2 ;7 % [U-99% 2H] D2O, 93 % H2O, 0.01 % sodium azide, 20 mM sodium phosphate, 10 mM sodium chloride, 0.4 mM AeTX-K toxin, 93% H2O/7% D2O ; '93% H2O/7% D2O' non-label solution AeTX-K_H2O # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 D2O 7 ? % '[U-99% 2H]' 1 H2O 93 ? % 'natural abundance' 1 'sodium azide' 0.01 ? % 'natural abundance' 1 'sodium phosphate' 20 ? mM 'natural abundance' 1 'sodium chloride' 10 ? mM 'natural abundance' 1 'AeTX-K toxin' 0.4 ? mM '[U-98% 15N]' 3 D2O 100 ? % '[U-99% 2H]' 3 'sodium azide' 0.01 ? % 'natural abundance' 3 'sodium phosphate' 20 ? mM 'natural abundance' 3 'sodium chloride' 10 ? mM 'natural abundance' 3 'AeTX-K toxin' 0.4 ? mM 'natural abundance' 2 D2O 7 ? % '[U-99% 2H]' 2 H2O 93 ? % 'natural abundance' 2 'sodium azide' 0.01 ? % 'natural abundance' 2 'sodium phosphate' 20 ? mM 'natural abundance' 2 'sodium chloride' 10 ? mM 'natural abundance' 2 'AeTX-K toxin' 0.4 ? mM 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 5.7 _pdbx_nmr_exptl_sample_conditions.ionic_strength 46 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label condition_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 2 '2D 1H-1H TOCSY' 1 isotropic 3 1 3 '2D 1H-1H TOCSY' 1 isotropic 4 1 2 '2D 1H-1H NOESY' 1 isotropic 5 1 3 '2D 1H-1H NOESY' 1 isotropic 7 1 3 '2D 1H-1H COSY' 1 isotropic 8 1 3 '2D 1H-13C HMQC' 1 isotropic # _pdbx_nmr_refine.entry_id 7OD2 _pdbx_nmr_refine.method 'DGSA-distance geometry simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 5 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'chemical shift assignment' TopSpin 3.6 'Bruker Biospin' 2 collection TopSpin 3.6 'Bruker Biospin' 3 'data analysis' TopSpin 3.6 'Bruker Biospin' 4 'peak picking' TopSpin 3.6 'Bruker Biospin' 5 'structure calculation' CNS ? 'Brunger, Adams, Clore, Gros, Nilges and Read' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 LEU N N N N 137 LEU CA C N S 138 LEU C C N N 139 LEU O O N N 140 LEU CB C N N 141 LEU CG C N N 142 LEU CD1 C N N 143 LEU CD2 C N N 144 LEU OXT O N N 145 LEU H H N N 146 LEU H2 H N N 147 LEU HA H N N 148 LEU HB2 H N N 149 LEU HB3 H N N 150 LEU HG H N N 151 LEU HD11 H N N 152 LEU HD12 H N N 153 LEU HD13 H N N 154 LEU HD21 H N N 155 LEU HD22 H N N 156 LEU HD23 H N N 157 LEU HXT H N N 158 LYS N N N N 159 LYS CA C N S 160 LYS C C N N 161 LYS O O N N 162 LYS CB C N N 163 LYS CG C N N 164 LYS CD C N N 165 LYS CE C N N 166 LYS NZ N N N 167 LYS OXT O N N 168 LYS H H N N 169 LYS H2 H N N 170 LYS HA H N N 171 LYS HB2 H N N 172 LYS HB3 H N N 173 LYS HG2 H N N 174 LYS HG3 H N N 175 LYS HD2 H N N 176 LYS HD3 H N N 177 LYS HE2 H N N 178 LYS HE3 H N N 179 LYS HZ1 H N N 180 LYS HZ2 H N N 181 LYS HZ3 H N N 182 LYS HXT H N N 183 MET N N N N 184 MET CA C N S 185 MET C C N N 186 MET O O N N 187 MET CB C N N 188 MET CG C N N 189 MET SD S N N 190 MET CE C N N 191 MET OXT O N N 192 MET H H N N 193 MET H2 H N N 194 MET HA H N N 195 MET HB2 H N N 196 MET HB3 H N N 197 MET HG2 H N N 198 MET HG3 H N N 199 MET HE1 H N N 200 MET HE2 H N N 201 MET HE3 H N N 202 MET HXT H N N 203 PHE N N N N 204 PHE CA C N S 205 PHE C C N N 206 PHE O O N N 207 PHE CB C N N 208 PHE CG C Y N 209 PHE CD1 C Y N 210 PHE CD2 C Y N 211 PHE CE1 C Y N 212 PHE CE2 C Y N 213 PHE CZ C Y N 214 PHE OXT O N N 215 PHE H H N N 216 PHE H2 H N N 217 PHE HA H N N 218 PHE HB2 H N N 219 PHE HB3 H N N 220 PHE HD1 H N N 221 PHE HD2 H N N 222 PHE HE1 H N N 223 PHE HE2 H N N 224 PHE HZ H N N 225 PHE HXT H N N 226 PRO N N N N 227 PRO CA C N S 228 PRO C C N N 229 PRO O O N N 230 PRO CB C N N 231 PRO CG C N N 232 PRO CD C N N 233 PRO OXT O N N 234 PRO H H N N 235 PRO HA H N N 236 PRO HB2 H N N 237 PRO HB3 H N N 238 PRO HG2 H N N 239 PRO HG3 H N N 240 PRO HD2 H N N 241 PRO HD3 H N N 242 PRO HXT H N N 243 SER N N N N 244 SER CA C N S 245 SER C C N N 246 SER O O N N 247 SER CB C N N 248 SER OG O N N 249 SER OXT O N N 250 SER H H N N 251 SER H2 H N N 252 SER HA H N N 253 SER HB2 H N N 254 SER HB3 H N N 255 SER HG H N N 256 SER HXT H N N 257 THR N N N N 258 THR CA C N S 259 THR C C N N 260 THR O O N N 261 THR CB C N R 262 THR OG1 O N N 263 THR CG2 C N N 264 THR OXT O N N 265 THR H H N N 266 THR H2 H N N 267 THR HA H N N 268 THR HB H N N 269 THR HG1 H N N 270 THR HG21 H N N 271 THR HG22 H N N 272 THR HG23 H N N 273 THR HXT H N N 274 TYR N N N N 275 TYR CA C N S 276 TYR C C N N 277 TYR O O N N 278 TYR CB C N N 279 TYR CG C Y N 280 TYR CD1 C Y N 281 TYR CD2 C Y N 282 TYR CE1 C Y N 283 TYR CE2 C Y N 284 TYR CZ C Y N 285 TYR OH O N N 286 TYR OXT O N N 287 TYR H H N N 288 TYR H2 H N N 289 TYR HA H N N 290 TYR HB2 H N N 291 TYR HB3 H N N 292 TYR HD1 H N N 293 TYR HD2 H N N 294 TYR HE1 H N N 295 TYR HE2 H N N 296 TYR HH H N N 297 TYR HXT H N N 298 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 LEU N CA sing N N 129 LEU N H sing N N 130 LEU N H2 sing N N 131 LEU CA C sing N N 132 LEU CA CB sing N N 133 LEU CA HA sing N N 134 LEU C O doub N N 135 LEU C OXT sing N N 136 LEU CB CG sing N N 137 LEU CB HB2 sing N N 138 LEU CB HB3 sing N N 139 LEU CG CD1 sing N N 140 LEU CG CD2 sing N N 141 LEU CG HG sing N N 142 LEU CD1 HD11 sing N N 143 LEU CD1 HD12 sing N N 144 LEU CD1 HD13 sing N N 145 LEU CD2 HD21 sing N N 146 LEU CD2 HD22 sing N N 147 LEU CD2 HD23 sing N N 148 LEU OXT HXT sing N N 149 LYS N CA sing N N 150 LYS N H sing N N 151 LYS N H2 sing N N 152 LYS CA C sing N N 153 LYS CA CB sing N N 154 LYS CA HA sing N N 155 LYS C O doub N N 156 LYS C OXT sing N N 157 LYS CB CG sing N N 158 LYS CB HB2 sing N N 159 LYS CB HB3 sing N N 160 LYS CG CD sing N N 161 LYS CG HG2 sing N N 162 LYS CG HG3 sing N N 163 LYS CD CE sing N N 164 LYS CD HD2 sing N N 165 LYS CD HD3 sing N N 166 LYS CE NZ sing N N 167 LYS CE HE2 sing N N 168 LYS CE HE3 sing N N 169 LYS NZ HZ1 sing N N 170 LYS NZ HZ2 sing N N 171 LYS NZ HZ3 sing N N 172 LYS OXT HXT sing N N 173 MET N CA sing N N 174 MET N H sing N N 175 MET N H2 sing N N 176 MET CA C sing N N 177 MET CA CB sing N N 178 MET CA HA sing N N 179 MET C O doub N N 180 MET C OXT sing N N 181 MET CB CG sing N N 182 MET CB HB2 sing N N 183 MET CB HB3 sing N N 184 MET CG SD sing N N 185 MET CG HG2 sing N N 186 MET CG HG3 sing N N 187 MET SD CE sing N N 188 MET CE HE1 sing N N 189 MET CE HE2 sing N N 190 MET CE HE3 sing N N 191 MET OXT HXT sing N N 192 PHE N CA sing N N 193 PHE N H sing N N 194 PHE N H2 sing N N 195 PHE CA C sing N N 196 PHE CA CB sing N N 197 PHE CA HA sing N N 198 PHE C O doub N N 199 PHE C OXT sing N N 200 PHE CB CG sing N N 201 PHE CB HB2 sing N N 202 PHE CB HB3 sing N N 203 PHE CG CD1 doub Y N 204 PHE CG CD2 sing Y N 205 PHE CD1 CE1 sing Y N 206 PHE CD1 HD1 sing N N 207 PHE CD2 CE2 doub Y N 208 PHE CD2 HD2 sing N N 209 PHE CE1 CZ doub Y N 210 PHE CE1 HE1 sing N N 211 PHE CE2 CZ sing Y N 212 PHE CE2 HE2 sing N N 213 PHE CZ HZ sing N N 214 PHE OXT HXT sing N N 215 PRO N CA sing N N 216 PRO N CD sing N N 217 PRO N H sing N N 218 PRO CA C sing N N 219 PRO CA CB sing N N 220 PRO CA HA sing N N 221 PRO C O doub N N 222 PRO C OXT sing N N 223 PRO CB CG sing N N 224 PRO CB HB2 sing N N 225 PRO CB HB3 sing N N 226 PRO CG CD sing N N 227 PRO CG HG2 sing N N 228 PRO CG HG3 sing N N 229 PRO CD HD2 sing N N 230 PRO CD HD3 sing N N 231 PRO OXT HXT sing N N 232 SER N CA sing N N 233 SER N H sing N N 234 SER N H2 sing N N 235 SER CA C sing N N 236 SER CA CB sing N N 237 SER CA HA sing N N 238 SER C O doub N N 239 SER C OXT sing N N 240 SER CB OG sing N N 241 SER CB HB2 sing N N 242 SER CB HB3 sing N N 243 SER OG HG sing N N 244 SER OXT HXT sing N N 245 THR N CA sing N N 246 THR N H sing N N 247 THR N H2 sing N N 248 THR CA C sing N N 249 THR CA CB sing N N 250 THR CA HA sing N N 251 THR C O doub N N 252 THR C OXT sing N N 253 THR CB OG1 sing N N 254 THR CB CG2 sing N N 255 THR CB HB sing N N 256 THR OG1 HG1 sing N N 257 THR CG2 HG21 sing N N 258 THR CG2 HG22 sing N N 259 THR CG2 HG23 sing N N 260 THR OXT HXT sing N N 261 TYR N CA sing N N 262 TYR N H sing N N 263 TYR N H2 sing N N 264 TYR CA C sing N N 265 TYR CA CB sing N N 266 TYR CA HA sing N N 267 TYR C O doub N N 268 TYR C OXT sing N N 269 TYR CB CG sing N N 270 TYR CB HB2 sing N N 271 TYR CB HB3 sing N N 272 TYR CG CD1 doub Y N 273 TYR CG CD2 sing Y N 274 TYR CD1 CE1 sing Y N 275 TYR CD1 HD1 sing N N 276 TYR CD2 CE2 doub Y N 277 TYR CD2 HD2 sing N N 278 TYR CE1 CZ doub Y N 279 TYR CE1 HE1 sing N N 280 TYR CE2 CZ sing Y N 281 TYR CE2 HE2 sing N N 282 TYR CZ OH sing N N 283 TYR OH HH sing N N 284 TYR OXT HXT sing N N 285 # _pdbx_audit_support.funding_organization 'United States - Israel Binational Science Foundation (BSF)' _pdbx_audit_support.country Israel _pdbx_audit_support.grant_number 2017243 _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model DRX700 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 7OD2 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #