data_7ON5 # _entry.id 7ON5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7ON5 pdb_00007on5 10.2210/pdb7on5/pdb WWPDB D_1292114036 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-08-11 2 'Structure model' 1 1 2021-10-13 3 'Structure model' 1 2 2024-01-31 4 'Structure model' 1 3 2024-10-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Refinement description' 5 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' database_PDB_rev 4 2 'Structure model' database_PDB_rev_record 5 2 'Structure model' pdbx_database_proc 6 3 'Structure model' chem_comp_atom 7 3 'Structure model' chem_comp_bond 8 3 'Structure model' pdbx_initial_refinement_model 9 4 'Structure model' pdbx_entry_details 10 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation_author.identifier_ORCID' 3 4 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7ON5 _pdbx_database_status.recvd_initial_deposition_date 2021-05-25 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Aksu, M.' 1 0000-0001-8627-7526 'Guttler, T.' 2 0000-0002-1456-7310 'Gorlich, D.' 3 0000-0002-4343-5210 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Embo J.' _citation.journal_id_ASTM EMJODG _citation.journal_id_CSD 0897 _citation.journal_id_ISSN 1460-2075 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 40 _citation.language ? _citation.page_first e107985 _citation.page_last e107985 _citation.title 'Neutralization of SARS-CoV-2 by highly potent, hyperthermostable, and mutation-tolerant nanobodies.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.15252/embj.2021107985 _citation.pdbx_database_id_PubMed 34302370 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Guttler, T.' 1 0000-0002-1456-7310 primary 'Aksu, M.' 2 0000-0001-8627-7526 primary 'Dickmanns, A.' 3 ? primary 'Stegmann, K.M.' 4 0000-0001-8099-708X primary 'Gregor, K.' 5 ? primary 'Rees, R.' 6 ? primary 'Taxer, W.' 7 ? primary 'Rymarenko, O.' 8 0000-0002-4912-7788 primary 'Schunemann, J.' 9 ? primary 'Dienemann, C.' 10 ? primary 'Gunkel, P.' 11 0000-0003-4287-9482 primary 'Mussil, B.' 12 ? primary 'Krull, J.' 13 ? primary 'Teichmann, U.' 14 0000-0001-8152-5543 primary 'Gross, U.' 15 ? primary 'Cordes, V.C.' 16 0000-0003-4731-0148 primary 'Dobbelstein, M.' 17 0000-0001-5052-3967 primary 'Gorlich, D.' 18 0000-0002-4343-5210 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Nanobody Re5D06' 14354.760 1 ? ? ? ? 2 non-polymer nat 1,2-ETHANEDIOL 62.068 1 ? ? ? ? 3 non-polymer syn ETHANOL 46.068 1 ? ? ? ? 4 water nat water 18.015 204 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;EGSQVQLVESGGGLVQPGGSLRLSCAASGITLDYYAIGWFRQAPGKEREGVSRIRSSDGSTNYADSVKGRFTMSRDNAKN TVYLQMNSLKPEDTAVYYCAYGPLTKYGSSWYWPYEYDYWGQGTQVTVSS ; _entity_poly.pdbx_seq_one_letter_code_can ;EGSQVQLVESGGGLVQPGGSLRLSCAASGITLDYYAIGWFRQAPGKEREGVSRIRSSDGSTNYADSVKGRFTMSRDNAKN TVYLQMNSLKPEDTAVYYCAYGPLTKYGSSWYWPYEYDYWGQGTQVTVSS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 1,2-ETHANEDIOL EDO 3 ETHANOL EOH 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 GLY n 1 3 SER n 1 4 GLN n 1 5 VAL n 1 6 GLN n 1 7 LEU n 1 8 VAL n 1 9 GLU n 1 10 SER n 1 11 GLY n 1 12 GLY n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 GLN n 1 17 PRO n 1 18 GLY n 1 19 GLY n 1 20 SER n 1 21 LEU n 1 22 ARG n 1 23 LEU n 1 24 SER n 1 25 CYS n 1 26 ALA n 1 27 ALA n 1 28 SER n 1 29 GLY n 1 30 ILE n 1 31 THR n 1 32 LEU n 1 33 ASP n 1 34 TYR n 1 35 TYR n 1 36 ALA n 1 37 ILE n 1 38 GLY n 1 39 TRP n 1 40 PHE n 1 41 ARG n 1 42 GLN n 1 43 ALA n 1 44 PRO n 1 45 GLY n 1 46 LYS n 1 47 GLU n 1 48 ARG n 1 49 GLU n 1 50 GLY n 1 51 VAL n 1 52 SER n 1 53 ARG n 1 54 ILE n 1 55 ARG n 1 56 SER n 1 57 SER n 1 58 ASP n 1 59 GLY n 1 60 SER n 1 61 THR n 1 62 ASN n 1 63 TYR n 1 64 ALA n 1 65 ASP n 1 66 SER n 1 67 VAL n 1 68 LYS n 1 69 GLY n 1 70 ARG n 1 71 PHE n 1 72 THR n 1 73 MET n 1 74 SER n 1 75 ARG n 1 76 ASP n 1 77 ASN n 1 78 ALA n 1 79 LYS n 1 80 ASN n 1 81 THR n 1 82 VAL n 1 83 TYR n 1 84 LEU n 1 85 GLN n 1 86 MET n 1 87 ASN n 1 88 SER n 1 89 LEU n 1 90 LYS n 1 91 PRO n 1 92 GLU n 1 93 ASP n 1 94 THR n 1 95 ALA n 1 96 VAL n 1 97 TYR n 1 98 TYR n 1 99 CYS n 1 100 ALA n 1 101 TYR n 1 102 GLY n 1 103 PRO n 1 104 LEU n 1 105 THR n 1 106 LYS n 1 107 TYR n 1 108 GLY n 1 109 SER n 1 110 SER n 1 111 TRP n 1 112 TYR n 1 113 TRP n 1 114 PRO n 1 115 TYR n 1 116 GLU n 1 117 TYR n 1 118 ASP n 1 119 TYR n 1 120 TRP n 1 121 GLY n 1 122 GLN n 1 123 GLY n 1 124 THR n 1 125 GLN n 1 126 VAL n 1 127 THR n 1 128 VAL n 1 129 SER n 1 130 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 130 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Vicugna pacos' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 30538 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Komagataella pastoris' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 4922 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 EOH non-polymer . ETHANOL ? 'C2 H6 O' 46.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 -2 ? ? ? A . n A 1 2 GLY 2 -1 ? ? ? A . n A 1 3 SER 3 0 ? ? ? A . n A 1 4 GLN 4 1 1 GLN GLN A . n A 1 5 VAL 5 2 2 VAL VAL A . n A 1 6 GLN 6 3 3 GLN GLN A . n A 1 7 LEU 7 4 4 LEU LEU A . n A 1 8 VAL 8 5 5 VAL VAL A . n A 1 9 GLU 9 6 6 GLU GLU A . n A 1 10 SER 10 7 7 SER SER A . n A 1 11 GLY 11 8 8 GLY GLY A . n A 1 12 GLY 12 9 9 GLY GLY A . n A 1 13 GLY 13 10 10 GLY GLY A . n A 1 14 LEU 14 11 11 LEU LEU A . n A 1 15 VAL 15 12 12 VAL VAL A . n A 1 16 GLN 16 13 13 GLN GLN A . n A 1 17 PRO 17 14 14 PRO PRO A . n A 1 18 GLY 18 15 15 GLY GLY A . n A 1 19 GLY 19 16 16 GLY GLY A . n A 1 20 SER 20 17 17 SER SER A . n A 1 21 LEU 21 18 18 LEU LEU A . n A 1 22 ARG 22 19 19 ARG ARG A . n A 1 23 LEU 23 20 20 LEU LEU A . n A 1 24 SER 24 21 21 SER SER A . n A 1 25 CYS 25 22 22 CYS CYS A . n A 1 26 ALA 26 23 23 ALA ALA A . n A 1 27 ALA 27 24 24 ALA ALA A . n A 1 28 SER 28 25 25 SER SER A . n A 1 29 GLY 29 26 26 GLY GLY A . n A 1 30 ILE 30 27 27 ILE ILE A . n A 1 31 THR 31 28 28 THR THR A . n A 1 32 LEU 32 29 29 LEU LEU A . n A 1 33 ASP 33 30 30 ASP ASP A . n A 1 34 TYR 34 31 31 TYR TYR A . n A 1 35 TYR 35 32 32 TYR TYR A . n A 1 36 ALA 36 33 33 ALA ALA A . n A 1 37 ILE 37 34 34 ILE ILE A . n A 1 38 GLY 38 35 35 GLY GLY A . n A 1 39 TRP 39 36 36 TRP TRP A . n A 1 40 PHE 40 37 37 PHE PHE A . n A 1 41 ARG 41 38 38 ARG ARG A . n A 1 42 GLN 42 39 39 GLN GLN A . n A 1 43 ALA 43 40 40 ALA ALA A . n A 1 44 PRO 44 41 41 PRO PRO A . n A 1 45 GLY 45 42 42 GLY GLY A . n A 1 46 LYS 46 43 43 LYS LYS A . n A 1 47 GLU 47 44 44 GLU GLU A . n A 1 48 ARG 48 45 45 ARG ARG A . n A 1 49 GLU 49 46 46 GLU GLU A . n A 1 50 GLY 50 47 47 GLY GLY A . n A 1 51 VAL 51 48 48 VAL VAL A . n A 1 52 SER 52 49 49 SER SER A . n A 1 53 ARG 53 50 50 ARG ARG A . n A 1 54 ILE 54 51 51 ILE ILE A . n A 1 55 ARG 55 52 52 ARG ARG A . n A 1 56 SER 56 53 53 SER SER A . n A 1 57 SER 57 54 54 SER SER A . n A 1 58 ASP 58 55 55 ASP ASP A . n A 1 59 GLY 59 56 56 GLY GLY A . n A 1 60 SER 60 57 57 SER SER A . n A 1 61 THR 61 58 58 THR THR A . n A 1 62 ASN 62 59 59 ASN ASN A . n A 1 63 TYR 63 60 60 TYR TYR A . n A 1 64 ALA 64 61 61 ALA ALA A . n A 1 65 ASP 65 62 62 ASP ASP A . n A 1 66 SER 66 63 63 SER SER A . n A 1 67 VAL 67 64 64 VAL VAL A . n A 1 68 LYS 68 65 65 LYS LYS A . n A 1 69 GLY 69 66 66 GLY GLY A . n A 1 70 ARG 70 67 67 ARG ARG A . n A 1 71 PHE 71 68 68 PHE PHE A . n A 1 72 THR 72 69 69 THR THR A . n A 1 73 MET 73 70 70 MET MET A . n A 1 74 SER 74 71 71 SER SER A . n A 1 75 ARG 75 72 72 ARG ARG A . n A 1 76 ASP 76 73 73 ASP ASP A . n A 1 77 ASN 77 74 74 ASN ASN A . n A 1 78 ALA 78 75 75 ALA ALA A . n A 1 79 LYS 79 76 76 LYS LYS A . n A 1 80 ASN 80 77 77 ASN ASN A . n A 1 81 THR 81 78 78 THR THR A . n A 1 82 VAL 82 79 79 VAL VAL A . n A 1 83 TYR 83 80 80 TYR TYR A . n A 1 84 LEU 84 81 81 LEU LEU A . n A 1 85 GLN 85 82 82 GLN GLN A . n A 1 86 MET 86 83 83 MET MET A . n A 1 87 ASN 87 84 84 ASN ASN A . n A 1 88 SER 88 85 85 SER SER A . n A 1 89 LEU 89 86 86 LEU LEU A . n A 1 90 LYS 90 87 87 LYS LYS A . n A 1 91 PRO 91 88 88 PRO PRO A . n A 1 92 GLU 92 89 89 GLU GLU A . n A 1 93 ASP 93 90 90 ASP ASP A . n A 1 94 THR 94 91 91 THR THR A . n A 1 95 ALA 95 92 92 ALA ALA A . n A 1 96 VAL 96 93 93 VAL VAL A . n A 1 97 TYR 97 94 94 TYR TYR A . n A 1 98 TYR 98 95 95 TYR TYR A . n A 1 99 CYS 99 96 96 CYS CYS A . n A 1 100 ALA 100 97 97 ALA ALA A . n A 1 101 TYR 101 98 98 TYR TYR A . n A 1 102 GLY 102 99 99 GLY GLY A . n A 1 103 PRO 103 100 100 PRO PRO A . n A 1 104 LEU 104 101 101 LEU LEU A . n A 1 105 THR 105 102 102 THR THR A . n A 1 106 LYS 106 103 103 LYS LYS A . n A 1 107 TYR 107 104 104 TYR TYR A . n A 1 108 GLY 108 105 105 GLY GLY A . n A 1 109 SER 109 106 106 SER SER A . n A 1 110 SER 110 107 107 SER SER A . n A 1 111 TRP 111 108 108 TRP TRP A . n A 1 112 TYR 112 109 109 TYR TYR A . n A 1 113 TRP 113 110 110 TRP TRP A . n A 1 114 PRO 114 111 111 PRO PRO A . n A 1 115 TYR 115 112 112 TYR TYR A . n A 1 116 GLU 116 113 113 GLU GLU A . n A 1 117 TYR 117 114 114 TYR TYR A . n A 1 118 ASP 118 115 115 ASP ASP A . n A 1 119 TYR 119 116 116 TYR TYR A . n A 1 120 TRP 120 117 117 TRP TRP A . n A 1 121 GLY 121 118 118 GLY GLY A . n A 1 122 GLN 122 119 119 GLN GLN A . n A 1 123 GLY 123 120 120 GLY GLY A . n A 1 124 THR 124 121 121 THR THR A . n A 1 125 GLN 125 122 122 GLN GLN A . n A 1 126 VAL 126 123 123 VAL VAL A . n A 1 127 THR 127 124 124 THR THR A . n A 1 128 VAL 128 125 125 VAL VAL A . n A 1 129 SER 129 126 126 SER SER A . n A 1 130 SER 130 127 127 SER SER A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 EDO 1 201 201 EDO EDO A . C 3 EOH 1 202 202 EOH EOH A . D 4 HOH 1 301 224 HOH HOH A . D 4 HOH 2 302 234 HOH HOH A . D 4 HOH 3 303 101 HOH HOH A . D 4 HOH 4 304 152 HOH HOH A . D 4 HOH 5 305 156 HOH HOH A . D 4 HOH 6 306 53 HOH HOH A . D 4 HOH 7 307 149 HOH HOH A . D 4 HOH 8 308 9 HOH HOH A . D 4 HOH 9 309 38 HOH HOH A . D 4 HOH 10 310 62 HOH HOH A . D 4 HOH 11 311 25 HOH HOH A . D 4 HOH 12 312 83 HOH HOH A . D 4 HOH 13 313 80 HOH HOH A . D 4 HOH 14 314 18 HOH HOH A . D 4 HOH 15 315 51 HOH HOH A . D 4 HOH 16 316 11 HOH HOH A . D 4 HOH 17 317 135 HOH HOH A . D 4 HOH 18 318 63 HOH HOH A . D 4 HOH 19 319 102 HOH HOH A . D 4 HOH 20 320 142 HOH HOH A . D 4 HOH 21 321 36 HOH HOH A . D 4 HOH 22 322 89 HOH HOH A . D 4 HOH 23 323 19 HOH HOH A . D 4 HOH 24 324 57 HOH HOH A . D 4 HOH 25 325 24 HOH HOH A . D 4 HOH 26 326 58 HOH HOH A . D 4 HOH 27 327 30 HOH HOH A . D 4 HOH 28 328 78 HOH HOH A . D 4 HOH 29 329 173 HOH HOH A . D 4 HOH 30 330 160 HOH HOH A . D 4 HOH 31 331 124 HOH HOH A . D 4 HOH 32 332 190 HOH HOH A . D 4 HOH 33 333 70 HOH HOH A . D 4 HOH 34 334 125 HOH HOH A . D 4 HOH 35 335 217 HOH HOH A . D 4 HOH 36 336 111 HOH HOH A . D 4 HOH 37 337 73 HOH HOH A . D 4 HOH 38 338 113 HOH HOH A . D 4 HOH 39 339 75 HOH HOH A . D 4 HOH 40 340 231 HOH HOH A . D 4 HOH 41 341 183 HOH HOH A . D 4 HOH 42 342 5 HOH HOH A . D 4 HOH 43 343 108 HOH HOH A . D 4 HOH 44 344 178 HOH HOH A . D 4 HOH 45 345 82 HOH HOH A . D 4 HOH 46 346 211 HOH HOH A . D 4 HOH 47 347 95 HOH HOH A . D 4 HOH 48 348 7 HOH HOH A . D 4 HOH 49 349 14 HOH HOH A . D 4 HOH 50 350 10 HOH HOH A . D 4 HOH 51 351 186 HOH HOH A . D 4 HOH 52 352 151 HOH HOH A . D 4 HOH 53 353 64 HOH HOH A . D 4 HOH 54 354 128 HOH HOH A . D 4 HOH 55 355 144 HOH HOH A . D 4 HOH 56 356 28 HOH HOH A . D 4 HOH 57 357 181 HOH HOH A . D 4 HOH 58 358 8 HOH HOH A . D 4 HOH 59 359 67 HOH HOH A . D 4 HOH 60 360 4 HOH HOH A . D 4 HOH 61 361 21 HOH HOH A . D 4 HOH 62 362 120 HOH HOH A . D 4 HOH 63 363 94 HOH HOH A . D 4 HOH 64 364 227 HOH HOH A . D 4 HOH 65 365 1 HOH HOH A . D 4 HOH 66 366 169 HOH HOH A . D 4 HOH 67 367 147 HOH HOH A . D 4 HOH 68 368 69 HOH HOH A . D 4 HOH 69 369 155 HOH HOH A . D 4 HOH 70 370 138 HOH HOH A . D 4 HOH 71 371 112 HOH HOH A . D 4 HOH 72 372 140 HOH HOH A . D 4 HOH 73 373 119 HOH HOH A . D 4 HOH 74 374 116 HOH HOH A . D 4 HOH 75 375 3 HOH HOH A . D 4 HOH 76 376 66 HOH HOH A . D 4 HOH 77 377 218 HOH HOH A . D 4 HOH 78 378 40 HOH HOH A . D 4 HOH 79 379 137 HOH HOH A . D 4 HOH 80 380 143 HOH HOH A . D 4 HOH 81 381 126 HOH HOH A . D 4 HOH 82 382 16 HOH HOH A . D 4 HOH 83 383 170 HOH HOH A . D 4 HOH 84 384 42 HOH HOH A . D 4 HOH 85 385 32 HOH HOH A . D 4 HOH 86 386 2 HOH HOH A . D 4 HOH 87 387 20 HOH HOH A . D 4 HOH 88 388 26 HOH HOH A . D 4 HOH 89 389 46 HOH HOH A . D 4 HOH 90 390 77 HOH HOH A . D 4 HOH 91 391 72 HOH HOH A . D 4 HOH 92 392 47 HOH HOH A . D 4 HOH 93 393 99 HOH HOH A . D 4 HOH 94 394 65 HOH HOH A . D 4 HOH 95 395 134 HOH HOH A . D 4 HOH 96 396 226 HOH HOH A . D 4 HOH 97 397 54 HOH HOH A . D 4 HOH 98 398 164 HOH HOH A . D 4 HOH 99 399 49 HOH HOH A . D 4 HOH 100 400 219 HOH HOH A . D 4 HOH 101 401 145 HOH HOH A . D 4 HOH 102 402 31 HOH HOH A . D 4 HOH 103 403 180 HOH HOH A . D 4 HOH 104 404 122 HOH HOH A . D 4 HOH 105 405 110 HOH HOH A . D 4 HOH 106 406 56 HOH HOH A . D 4 HOH 107 407 167 HOH HOH A . D 4 HOH 108 408 34 HOH HOH A . D 4 HOH 109 409 44 HOH HOH A . D 4 HOH 110 410 17 HOH HOH A . D 4 HOH 111 411 129 HOH HOH A . D 4 HOH 112 412 79 HOH HOH A . D 4 HOH 113 413 115 HOH HOH A . D 4 HOH 114 414 27 HOH HOH A . D 4 HOH 115 415 205 HOH HOH A . D 4 HOH 116 416 29 HOH HOH A . D 4 HOH 117 417 96 HOH HOH A . D 4 HOH 118 418 61 HOH HOH A . D 4 HOH 119 419 199 HOH HOH A . D 4 HOH 120 420 133 HOH HOH A . D 4 HOH 121 421 60 HOH HOH A . D 4 HOH 122 422 81 HOH HOH A . D 4 HOH 123 423 12 HOH HOH A . D 4 HOH 124 424 139 HOH HOH A . D 4 HOH 125 425 100 HOH HOH A . D 4 HOH 126 426 123 HOH HOH A . D 4 HOH 127 427 52 HOH HOH A . D 4 HOH 128 428 50 HOH HOH A . D 4 HOH 129 429 43 HOH HOH A . D 4 HOH 130 430 188 HOH HOH A . D 4 HOH 131 431 132 HOH HOH A . D 4 HOH 132 432 45 HOH HOH A . D 4 HOH 133 433 209 HOH HOH A . D 4 HOH 134 434 232 HOH HOH A . D 4 HOH 135 435 175 HOH HOH A . D 4 HOH 136 436 6 HOH HOH A . D 4 HOH 137 437 223 HOH HOH A . D 4 HOH 138 438 109 HOH HOH A . D 4 HOH 139 439 157 HOH HOH A . D 4 HOH 140 440 35 HOH HOH A . D 4 HOH 141 441 146 HOH HOH A . D 4 HOH 142 442 233 HOH HOH A . D 4 HOH 143 443 106 HOH HOH A . D 4 HOH 144 444 127 HOH HOH A . D 4 HOH 145 445 136 HOH HOH A . D 4 HOH 146 446 166 HOH HOH A . D 4 HOH 147 447 229 HOH HOH A . D 4 HOH 148 448 15 HOH HOH A . D 4 HOH 149 449 74 HOH HOH A . D 4 HOH 150 450 103 HOH HOH A . D 4 HOH 151 451 187 HOH HOH A . D 4 HOH 152 452 210 HOH HOH A . D 4 HOH 153 453 150 HOH HOH A . D 4 HOH 154 454 198 HOH HOH A . D 4 HOH 155 455 153 HOH HOH A . D 4 HOH 156 456 76 HOH HOH A . D 4 HOH 157 457 130 HOH HOH A . D 4 HOH 158 458 235 HOH HOH A . D 4 HOH 159 459 171 HOH HOH A . D 4 HOH 160 460 208 HOH HOH A . D 4 HOH 161 461 121 HOH HOH A . D 4 HOH 162 462 154 HOH HOH A . D 4 HOH 163 463 215 HOH HOH A . D 4 HOH 164 464 41 HOH HOH A . D 4 HOH 165 465 86 HOH HOH A . D 4 HOH 166 466 228 HOH HOH A . D 4 HOH 167 467 201 HOH HOH A . D 4 HOH 168 468 68 HOH HOH A . D 4 HOH 169 469 88 HOH HOH A . D 4 HOH 170 470 85 HOH HOH A . D 4 HOH 171 471 39 HOH HOH A . D 4 HOH 172 472 97 HOH HOH A . D 4 HOH 173 473 220 HOH HOH A . D 4 HOH 174 474 193 HOH HOH A . D 4 HOH 175 475 230 HOH HOH A . D 4 HOH 176 476 48 HOH HOH A . D 4 HOH 177 477 90 HOH HOH A . D 4 HOH 178 478 148 HOH HOH A . D 4 HOH 179 479 216 HOH HOH A . D 4 HOH 180 480 141 HOH HOH A . D 4 HOH 181 481 104 HOH HOH A . D 4 HOH 182 482 182 HOH HOH A . D 4 HOH 183 483 117 HOH HOH A . D 4 HOH 184 484 93 HOH HOH A . D 4 HOH 185 485 98 HOH HOH A . D 4 HOH 186 486 84 HOH HOH A . D 4 HOH 187 487 33 HOH HOH A . D 4 HOH 188 488 92 HOH HOH A . D 4 HOH 189 489 161 HOH HOH A . D 4 HOH 190 490 37 HOH HOH A . D 4 HOH 191 491 71 HOH HOH A . D 4 HOH 192 492 174 HOH HOH A . D 4 HOH 193 493 22 HOH HOH A . D 4 HOH 194 494 55 HOH HOH A . D 4 HOH 195 495 13 HOH HOH A . D 4 HOH 196 496 202 HOH HOH A . D 4 HOH 197 497 168 HOH HOH A . D 4 HOH 198 498 189 HOH HOH A . D 4 HOH 199 499 91 HOH HOH A . D 4 HOH 200 500 213 HOH HOH A . D 4 HOH 201 501 107 HOH HOH A . D 4 HOH 202 502 59 HOH HOH A . D 4 HOH 203 503 118 HOH HOH A . D 4 HOH 204 504 23 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 1 ? CG ? A GLN 4 CG 2 1 Y 1 A GLN 1 ? CD ? A GLN 4 CD 3 1 Y 1 A GLN 1 ? OE1 ? A GLN 4 OE1 4 1 Y 1 A GLN 1 ? NE2 ? A GLN 4 NE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.18.2_3874 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7ON5 _cell.details ? _cell.formula_units_Z ? _cell.length_a 44.611 _cell.length_a_esd ? _cell.length_b 44.611 _cell.length_b_esd ? _cell.length_c 144.155 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7ON5 _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7ON5 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.50 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 50.76 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100 mM MES: pH 6.0, 200 mM zinc acetate, 15% (v/v) ethanol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-11-06 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X06SA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X06SA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7ON5 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.25 _reflns.d_resolution_low 42.620 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 41182 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.43 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 23.8 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.05427 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 38.44 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.0555 _reflns.pdbx_Rpim_I_all 0.01136 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.25 _reflns_shell.d_res_low 1.295 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 7.60 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 3846 _reflns_shell.percent_possible_all 95.13 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 14.8 _reflns_shell.pdbx_Rsym_value 0.3971 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.4114 _reflns_shell.pdbx_Rpim_I_all 0.1053 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.973 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 79.420 _refine.B_iso_mean 17.6578 _refine.B_iso_min 7.930 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7ON5 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.2500 _refine.ls_d_res_low 42.6200 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 41179 _refine.ls_number_reflns_R_free 2058 _refine.ls_number_reflns_R_work 39121 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.4300 _refine.ls_percent_reflns_R_free 5.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1470 _refine.ls_R_factor_R_free 0.1668 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1460 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.430 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 7OLZ _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 14.6200 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.0900 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.2500 _refine_hist.d_res_low 42.6200 _refine_hist.number_atoms_solvent 204 _refine_hist.number_atoms_total 1200 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 127 _refine_hist.pdbx_B_iso_mean_ligand 27.22 _refine_hist.pdbx_B_iso_mean_solvent 30.57 _refine_hist.pdbx_number_atoms_protein 989 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 7 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.2500 1.2800 2548 . 127 2421 94.0000 . . . 0.2412 0.0000 0.1944 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 1.2800 1.3100 2653 . 132 2521 98.0000 . . . 0.2073 0.0000 0.1555 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 1.3100 1.3500 2695 . 135 2560 100.0000 . . . 0.1839 0.0000 0.1388 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 1.3500 1.3900 2691 . 134 2557 100.0000 . . . 0.1599 0.0000 0.1300 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 1.3900 1.4300 2716 . 136 2580 100.0000 . . . 0.1670 0.0000 0.1267 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 1.4300 1.4800 2717 . 136 2581 100.0000 . . . 0.1728 0.0000 0.1239 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 1.4800 1.5400 2743 . 138 2605 100.0000 . . . 0.1501 0.0000 0.1164 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 1.5400 1.6100 2713 . 136 2577 100.0000 . . . 0.1537 0.0000 0.1141 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 1.6100 1.7000 2733 . 135 2598 100.0000 . . . 0.1524 0.0000 0.1187 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 1.7000 1.8000 2757 . 139 2618 100.0000 . . . 0.1549 0.0000 0.1322 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 1.8000 1.9400 2762 . 138 2624 100.0000 . . . 0.1657 0.0000 0.1383 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 1.9400 2.1400 2775 . 138 2637 100.0000 . . . 0.1531 0.0000 0.1341 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 2.1400 2.4500 2791 . 140 2651 100.0000 . . . 0.1614 0.0000 0.1535 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 2.4500 3.0800 2852 . 142 2710 100.0000 . . . 0.1787 0.0000 0.1634 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 3.0800 42.6200 3033 . 152 2881 100.0000 . . . 0.1692 0.0000 0.1602 . . . . . . . 15 . . . # _struct.entry_id 7ON5 _struct.title 'Crystal structure of the SARS-CoV-2 neutralizing nanobody Re5D06' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7ON5 _struct_keywords.text 'Neutralizing VHH, IMMUNE SYSTEM' _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 7ON5 _struct_ref.pdbx_db_accession 7ON5 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7ON5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 130 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 7ON5 _struct_ref_seq.db_align_beg -2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 127 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -2 _struct_ref_seq.pdbx_auth_seq_align_end 127 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 400 ? 1 MORE 8 ? 1 'SSA (A^2)' 6990 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 77 ? LYS A 79 ? ASN A 74 LYS A 76 5 ? 3 HELX_P HELX_P2 AA2 LYS A 90 ? THR A 94 ? LYS A 87 THR A 91 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 25 SG ? ? ? 1_555 A CYS 99 SG C ? A CYS 22 A CYS 96 1_555 ? ? ? ? ? ? ? 2.055 ? ? disulf2 disulf ? ? A CYS 25 SG ? ? ? 1_555 A CYS 99 SG B ? A CYS 22 A CYS 96 1_555 ? ? ? ? ? ? ? 1.955 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 25 ? CYS A 99 C CYS A 22 ? 1_555 CYS A 96 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 25 ? CYS A 99 B CYS A 22 ? 1_555 CYS A 96 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 6 ? AA3 ? 4 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA3 1 2 ? parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLN A 6 ? SER A 10 ? GLN A 3 SER A 7 AA1 2 LEU A 21 ? SER A 28 ? LEU A 18 SER A 25 AA1 3 THR A 81 ? MET A 86 ? THR A 78 MET A 83 AA1 4 PHE A 71 ? ASP A 76 ? PHE A 68 ASP A 73 AA2 1 GLY A 13 ? VAL A 15 ? GLY A 10 VAL A 12 AA2 2 THR A 124 ? VAL A 128 ? THR A 121 VAL A 125 AA2 3 ALA A 95 ? PRO A 103 ? ALA A 92 PRO A 100 AA2 4 TYR A 35 ? GLN A 42 ? TYR A 32 GLN A 39 AA2 5 GLU A 49 ? ARG A 55 ? GLU A 46 ARG A 52 AA2 6 THR A 61 ? TYR A 63 ? THR A 58 TYR A 60 AA3 1 GLY A 13 ? VAL A 15 ? GLY A 10 VAL A 12 AA3 2 THR A 124 ? VAL A 128 ? THR A 121 VAL A 125 AA3 3 ALA A 95 ? PRO A 103 ? ALA A 92 PRO A 100 AA3 4 TYR A 119 ? TRP A 120 ? TYR A 116 TRP A 117 AA4 1 THR A 105 ? TYR A 107 ? THR A 102 TYR A 104 AA4 2 SER A 110 ? TYR A 112 ? SER A 107 TYR A 109 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N SER A 10 ? N SER A 7 O SER A 24 ? O SER A 21 AA1 2 3 N LEU A 21 ? N LEU A 18 O MET A 86 ? O MET A 83 AA1 3 4 O GLN A 85 ? O GLN A 82 N THR A 72 ? N THR A 69 AA2 1 2 N VAL A 15 ? N VAL A 12 O THR A 127 ? O THR A 124 AA2 2 3 O THR A 124 ? O THR A 121 N TYR A 97 ? N TYR A 94 AA2 3 4 O GLY A 102 ? O GLY A 99 N ALA A 36 ? N ALA A 33 AA2 4 5 N TRP A 39 ? N TRP A 36 O VAL A 51 ? O VAL A 48 AA2 5 6 N ARG A 53 ? N ARG A 50 O ASN A 62 ? O ASN A 59 AA3 1 2 N VAL A 15 ? N VAL A 12 O THR A 127 ? O THR A 124 AA3 2 3 O THR A 124 ? O THR A 121 N TYR A 97 ? N TYR A 94 AA3 3 4 N TYR A 101 ? N TYR A 98 O TYR A 119 ? O TYR A 116 AA4 1 2 N THR A 105 ? N THR A 102 O TYR A 112 ? O TYR A 109 # _pdbx_entry_details.entry_id 7ON5 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CB _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 CYS _pdbx_validate_rmsd_bond.auth_seq_id_1 96 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 B _pdbx_validate_rmsd_bond.auth_atom_id_2 SG _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 CYS _pdbx_validate_rmsd_bond.auth_seq_id_2 96 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 B _pdbx_validate_rmsd_bond.bond_value 1.716 _pdbx_validate_rmsd_bond.bond_target_value 1.812 _pdbx_validate_rmsd_bond.bond_deviation -0.096 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.016 _pdbx_validate_rmsd_bond.linker_flag N # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 458 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id D _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # _phasing.method MR # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLU -2 ? A GLU 1 2 1 Y 1 A GLY -1 ? A GLY 2 3 1 Y 1 A SER 0 ? A SER 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 EDO C1 C N N 88 EDO O1 O N N 89 EDO C2 C N N 90 EDO O2 O N N 91 EDO H11 H N N 92 EDO H12 H N N 93 EDO HO1 H N N 94 EDO H21 H N N 95 EDO H22 H N N 96 EDO HO2 H N N 97 EOH C1 C N N 98 EOH C2 C N N 99 EOH O O N N 100 EOH H11 H N N 101 EOH H12 H N N 102 EOH H21 H N N 103 EOH H22 H N N 104 EOH H23 H N N 105 EOH HO H N N 106 GLN N N N N 107 GLN CA C N S 108 GLN C C N N 109 GLN O O N N 110 GLN CB C N N 111 GLN CG C N N 112 GLN CD C N N 113 GLN OE1 O N N 114 GLN NE2 N N N 115 GLN OXT O N N 116 GLN H H N N 117 GLN H2 H N N 118 GLN HA H N N 119 GLN HB2 H N N 120 GLN HB3 H N N 121 GLN HG2 H N N 122 GLN HG3 H N N 123 GLN HE21 H N N 124 GLN HE22 H N N 125 GLN HXT H N N 126 GLU N N N N 127 GLU CA C N S 128 GLU C C N N 129 GLU O O N N 130 GLU CB C N N 131 GLU CG C N N 132 GLU CD C N N 133 GLU OE1 O N N 134 GLU OE2 O N N 135 GLU OXT O N N 136 GLU H H N N 137 GLU H2 H N N 138 GLU HA H N N 139 GLU HB2 H N N 140 GLU HB3 H N N 141 GLU HG2 H N N 142 GLU HG3 H N N 143 GLU HE2 H N N 144 GLU HXT H N N 145 GLY N N N N 146 GLY CA C N N 147 GLY C C N N 148 GLY O O N N 149 GLY OXT O N N 150 GLY H H N N 151 GLY H2 H N N 152 GLY HA2 H N N 153 GLY HA3 H N N 154 GLY HXT H N N 155 HOH O O N N 156 HOH H1 H N N 157 HOH H2 H N N 158 ILE N N N N 159 ILE CA C N S 160 ILE C C N N 161 ILE O O N N 162 ILE CB C N S 163 ILE CG1 C N N 164 ILE CG2 C N N 165 ILE CD1 C N N 166 ILE OXT O N N 167 ILE H H N N 168 ILE H2 H N N 169 ILE HA H N N 170 ILE HB H N N 171 ILE HG12 H N N 172 ILE HG13 H N N 173 ILE HG21 H N N 174 ILE HG22 H N N 175 ILE HG23 H N N 176 ILE HD11 H N N 177 ILE HD12 H N N 178 ILE HD13 H N N 179 ILE HXT H N N 180 LEU N N N N 181 LEU CA C N S 182 LEU C C N N 183 LEU O O N N 184 LEU CB C N N 185 LEU CG C N N 186 LEU CD1 C N N 187 LEU CD2 C N N 188 LEU OXT O N N 189 LEU H H N N 190 LEU H2 H N N 191 LEU HA H N N 192 LEU HB2 H N N 193 LEU HB3 H N N 194 LEU HG H N N 195 LEU HD11 H N N 196 LEU HD12 H N N 197 LEU HD13 H N N 198 LEU HD21 H N N 199 LEU HD22 H N N 200 LEU HD23 H N N 201 LEU HXT H N N 202 LYS N N N N 203 LYS CA C N S 204 LYS C C N N 205 LYS O O N N 206 LYS CB C N N 207 LYS CG C N N 208 LYS CD C N N 209 LYS CE C N N 210 LYS NZ N N N 211 LYS OXT O N N 212 LYS H H N N 213 LYS H2 H N N 214 LYS HA H N N 215 LYS HB2 H N N 216 LYS HB3 H N N 217 LYS HG2 H N N 218 LYS HG3 H N N 219 LYS HD2 H N N 220 LYS HD3 H N N 221 LYS HE2 H N N 222 LYS HE3 H N N 223 LYS HZ1 H N N 224 LYS HZ2 H N N 225 LYS HZ3 H N N 226 LYS HXT H N N 227 MET N N N N 228 MET CA C N S 229 MET C C N N 230 MET O O N N 231 MET CB C N N 232 MET CG C N N 233 MET SD S N N 234 MET CE C N N 235 MET OXT O N N 236 MET H H N N 237 MET H2 H N N 238 MET HA H N N 239 MET HB2 H N N 240 MET HB3 H N N 241 MET HG2 H N N 242 MET HG3 H N N 243 MET HE1 H N N 244 MET HE2 H N N 245 MET HE3 H N N 246 MET HXT H N N 247 PHE N N N N 248 PHE CA C N S 249 PHE C C N N 250 PHE O O N N 251 PHE CB C N N 252 PHE CG C Y N 253 PHE CD1 C Y N 254 PHE CD2 C Y N 255 PHE CE1 C Y N 256 PHE CE2 C Y N 257 PHE CZ C Y N 258 PHE OXT O N N 259 PHE H H N N 260 PHE H2 H N N 261 PHE HA H N N 262 PHE HB2 H N N 263 PHE HB3 H N N 264 PHE HD1 H N N 265 PHE HD2 H N N 266 PHE HE1 H N N 267 PHE HE2 H N N 268 PHE HZ H N N 269 PHE HXT H N N 270 PRO N N N N 271 PRO CA C N S 272 PRO C C N N 273 PRO O O N N 274 PRO CB C N N 275 PRO CG C N N 276 PRO CD C N N 277 PRO OXT O N N 278 PRO H H N N 279 PRO HA H N N 280 PRO HB2 H N N 281 PRO HB3 H N N 282 PRO HG2 H N N 283 PRO HG3 H N N 284 PRO HD2 H N N 285 PRO HD3 H N N 286 PRO HXT H N N 287 SER N N N N 288 SER CA C N S 289 SER C C N N 290 SER O O N N 291 SER CB C N N 292 SER OG O N N 293 SER OXT O N N 294 SER H H N N 295 SER H2 H N N 296 SER HA H N N 297 SER HB2 H N N 298 SER HB3 H N N 299 SER HG H N N 300 SER HXT H N N 301 THR N N N N 302 THR CA C N S 303 THR C C N N 304 THR O O N N 305 THR CB C N R 306 THR OG1 O N N 307 THR CG2 C N N 308 THR OXT O N N 309 THR H H N N 310 THR H2 H N N 311 THR HA H N N 312 THR HB H N N 313 THR HG1 H N N 314 THR HG21 H N N 315 THR HG22 H N N 316 THR HG23 H N N 317 THR HXT H N N 318 TRP N N N N 319 TRP CA C N S 320 TRP C C N N 321 TRP O O N N 322 TRP CB C N N 323 TRP CG C Y N 324 TRP CD1 C Y N 325 TRP CD2 C Y N 326 TRP NE1 N Y N 327 TRP CE2 C Y N 328 TRP CE3 C Y N 329 TRP CZ2 C Y N 330 TRP CZ3 C Y N 331 TRP CH2 C Y N 332 TRP OXT O N N 333 TRP H H N N 334 TRP H2 H N N 335 TRP HA H N N 336 TRP HB2 H N N 337 TRP HB3 H N N 338 TRP HD1 H N N 339 TRP HE1 H N N 340 TRP HE3 H N N 341 TRP HZ2 H N N 342 TRP HZ3 H N N 343 TRP HH2 H N N 344 TRP HXT H N N 345 TYR N N N N 346 TYR CA C N S 347 TYR C C N N 348 TYR O O N N 349 TYR CB C N N 350 TYR CG C Y N 351 TYR CD1 C Y N 352 TYR CD2 C Y N 353 TYR CE1 C Y N 354 TYR CE2 C Y N 355 TYR CZ C Y N 356 TYR OH O N N 357 TYR OXT O N N 358 TYR H H N N 359 TYR H2 H N N 360 TYR HA H N N 361 TYR HB2 H N N 362 TYR HB3 H N N 363 TYR HD1 H N N 364 TYR HD2 H N N 365 TYR HE1 H N N 366 TYR HE2 H N N 367 TYR HH H N N 368 TYR HXT H N N 369 VAL N N N N 370 VAL CA C N S 371 VAL C C N N 372 VAL O O N N 373 VAL CB C N N 374 VAL CG1 C N N 375 VAL CG2 C N N 376 VAL OXT O N N 377 VAL H H N N 378 VAL H2 H N N 379 VAL HA H N N 380 VAL HB H N N 381 VAL HG11 H N N 382 VAL HG12 H N N 383 VAL HG13 H N N 384 VAL HG21 H N N 385 VAL HG22 H N N 386 VAL HG23 H N N 387 VAL HXT H N N 388 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 EDO C1 O1 sing N N 83 EDO C1 C2 sing N N 84 EDO C1 H11 sing N N 85 EDO C1 H12 sing N N 86 EDO O1 HO1 sing N N 87 EDO C2 O2 sing N N 88 EDO C2 H21 sing N N 89 EDO C2 H22 sing N N 90 EDO O2 HO2 sing N N 91 EOH C1 C2 sing N N 92 EOH C1 O sing N N 93 EOH C1 H11 sing N N 94 EOH C1 H12 sing N N 95 EOH C2 H21 sing N N 96 EOH C2 H22 sing N N 97 EOH C2 H23 sing N N 98 EOH O HO sing N N 99 GLN N CA sing N N 100 GLN N H sing N N 101 GLN N H2 sing N N 102 GLN CA C sing N N 103 GLN CA CB sing N N 104 GLN CA HA sing N N 105 GLN C O doub N N 106 GLN C OXT sing N N 107 GLN CB CG sing N N 108 GLN CB HB2 sing N N 109 GLN CB HB3 sing N N 110 GLN CG CD sing N N 111 GLN CG HG2 sing N N 112 GLN CG HG3 sing N N 113 GLN CD OE1 doub N N 114 GLN CD NE2 sing N N 115 GLN NE2 HE21 sing N N 116 GLN NE2 HE22 sing N N 117 GLN OXT HXT sing N N 118 GLU N CA sing N N 119 GLU N H sing N N 120 GLU N H2 sing N N 121 GLU CA C sing N N 122 GLU CA CB sing N N 123 GLU CA HA sing N N 124 GLU C O doub N N 125 GLU C OXT sing N N 126 GLU CB CG sing N N 127 GLU CB HB2 sing N N 128 GLU CB HB3 sing N N 129 GLU CG CD sing N N 130 GLU CG HG2 sing N N 131 GLU CG HG3 sing N N 132 GLU CD OE1 doub N N 133 GLU CD OE2 sing N N 134 GLU OE2 HE2 sing N N 135 GLU OXT HXT sing N N 136 GLY N CA sing N N 137 GLY N H sing N N 138 GLY N H2 sing N N 139 GLY CA C sing N N 140 GLY CA HA2 sing N N 141 GLY CA HA3 sing N N 142 GLY C O doub N N 143 GLY C OXT sing N N 144 GLY OXT HXT sing N N 145 HOH O H1 sing N N 146 HOH O H2 sing N N 147 ILE N CA sing N N 148 ILE N H sing N N 149 ILE N H2 sing N N 150 ILE CA C sing N N 151 ILE CA CB sing N N 152 ILE CA HA sing N N 153 ILE C O doub N N 154 ILE C OXT sing N N 155 ILE CB CG1 sing N N 156 ILE CB CG2 sing N N 157 ILE CB HB sing N N 158 ILE CG1 CD1 sing N N 159 ILE CG1 HG12 sing N N 160 ILE CG1 HG13 sing N N 161 ILE CG2 HG21 sing N N 162 ILE CG2 HG22 sing N N 163 ILE CG2 HG23 sing N N 164 ILE CD1 HD11 sing N N 165 ILE CD1 HD12 sing N N 166 ILE CD1 HD13 sing N N 167 ILE OXT HXT sing N N 168 LEU N CA sing N N 169 LEU N H sing N N 170 LEU N H2 sing N N 171 LEU CA C sing N N 172 LEU CA CB sing N N 173 LEU CA HA sing N N 174 LEU C O doub N N 175 LEU C OXT sing N N 176 LEU CB CG sing N N 177 LEU CB HB2 sing N N 178 LEU CB HB3 sing N N 179 LEU CG CD1 sing N N 180 LEU CG CD2 sing N N 181 LEU CG HG sing N N 182 LEU CD1 HD11 sing N N 183 LEU CD1 HD12 sing N N 184 LEU CD1 HD13 sing N N 185 LEU CD2 HD21 sing N N 186 LEU CD2 HD22 sing N N 187 LEU CD2 HD23 sing N N 188 LEU OXT HXT sing N N 189 LYS N CA sing N N 190 LYS N H sing N N 191 LYS N H2 sing N N 192 LYS CA C sing N N 193 LYS CA CB sing N N 194 LYS CA HA sing N N 195 LYS C O doub N N 196 LYS C OXT sing N N 197 LYS CB CG sing N N 198 LYS CB HB2 sing N N 199 LYS CB HB3 sing N N 200 LYS CG CD sing N N 201 LYS CG HG2 sing N N 202 LYS CG HG3 sing N N 203 LYS CD CE sing N N 204 LYS CD HD2 sing N N 205 LYS CD HD3 sing N N 206 LYS CE NZ sing N N 207 LYS CE HE2 sing N N 208 LYS CE HE3 sing N N 209 LYS NZ HZ1 sing N N 210 LYS NZ HZ2 sing N N 211 LYS NZ HZ3 sing N N 212 LYS OXT HXT sing N N 213 MET N CA sing N N 214 MET N H sing N N 215 MET N H2 sing N N 216 MET CA C sing N N 217 MET CA CB sing N N 218 MET CA HA sing N N 219 MET C O doub N N 220 MET C OXT sing N N 221 MET CB CG sing N N 222 MET CB HB2 sing N N 223 MET CB HB3 sing N N 224 MET CG SD sing N N 225 MET CG HG2 sing N N 226 MET CG HG3 sing N N 227 MET SD CE sing N N 228 MET CE HE1 sing N N 229 MET CE HE2 sing N N 230 MET CE HE3 sing N N 231 MET OXT HXT sing N N 232 PHE N CA sing N N 233 PHE N H sing N N 234 PHE N H2 sing N N 235 PHE CA C sing N N 236 PHE CA CB sing N N 237 PHE CA HA sing N N 238 PHE C O doub N N 239 PHE C OXT sing N N 240 PHE CB CG sing N N 241 PHE CB HB2 sing N N 242 PHE CB HB3 sing N N 243 PHE CG CD1 doub Y N 244 PHE CG CD2 sing Y N 245 PHE CD1 CE1 sing Y N 246 PHE CD1 HD1 sing N N 247 PHE CD2 CE2 doub Y N 248 PHE CD2 HD2 sing N N 249 PHE CE1 CZ doub Y N 250 PHE CE1 HE1 sing N N 251 PHE CE2 CZ sing Y N 252 PHE CE2 HE2 sing N N 253 PHE CZ HZ sing N N 254 PHE OXT HXT sing N N 255 PRO N CA sing N N 256 PRO N CD sing N N 257 PRO N H sing N N 258 PRO CA C sing N N 259 PRO CA CB sing N N 260 PRO CA HA sing N N 261 PRO C O doub N N 262 PRO C OXT sing N N 263 PRO CB CG sing N N 264 PRO CB HB2 sing N N 265 PRO CB HB3 sing N N 266 PRO CG CD sing N N 267 PRO CG HG2 sing N N 268 PRO CG HG3 sing N N 269 PRO CD HD2 sing N N 270 PRO CD HD3 sing N N 271 PRO OXT HXT sing N N 272 SER N CA sing N N 273 SER N H sing N N 274 SER N H2 sing N N 275 SER CA C sing N N 276 SER CA CB sing N N 277 SER CA HA sing N N 278 SER C O doub N N 279 SER C OXT sing N N 280 SER CB OG sing N N 281 SER CB HB2 sing N N 282 SER CB HB3 sing N N 283 SER OG HG sing N N 284 SER OXT HXT sing N N 285 THR N CA sing N N 286 THR N H sing N N 287 THR N H2 sing N N 288 THR CA C sing N N 289 THR CA CB sing N N 290 THR CA HA sing N N 291 THR C O doub N N 292 THR C OXT sing N N 293 THR CB OG1 sing N N 294 THR CB CG2 sing N N 295 THR CB HB sing N N 296 THR OG1 HG1 sing N N 297 THR CG2 HG21 sing N N 298 THR CG2 HG22 sing N N 299 THR CG2 HG23 sing N N 300 THR OXT HXT sing N N 301 TRP N CA sing N N 302 TRP N H sing N N 303 TRP N H2 sing N N 304 TRP CA C sing N N 305 TRP CA CB sing N N 306 TRP CA HA sing N N 307 TRP C O doub N N 308 TRP C OXT sing N N 309 TRP CB CG sing N N 310 TRP CB HB2 sing N N 311 TRP CB HB3 sing N N 312 TRP CG CD1 doub Y N 313 TRP CG CD2 sing Y N 314 TRP CD1 NE1 sing Y N 315 TRP CD1 HD1 sing N N 316 TRP CD2 CE2 doub Y N 317 TRP CD2 CE3 sing Y N 318 TRP NE1 CE2 sing Y N 319 TRP NE1 HE1 sing N N 320 TRP CE2 CZ2 sing Y N 321 TRP CE3 CZ3 doub Y N 322 TRP CE3 HE3 sing N N 323 TRP CZ2 CH2 doub Y N 324 TRP CZ2 HZ2 sing N N 325 TRP CZ3 CH2 sing Y N 326 TRP CZ3 HZ3 sing N N 327 TRP CH2 HH2 sing N N 328 TRP OXT HXT sing N N 329 TYR N CA sing N N 330 TYR N H sing N N 331 TYR N H2 sing N N 332 TYR CA C sing N N 333 TYR CA CB sing N N 334 TYR CA HA sing N N 335 TYR C O doub N N 336 TYR C OXT sing N N 337 TYR CB CG sing N N 338 TYR CB HB2 sing N N 339 TYR CB HB3 sing N N 340 TYR CG CD1 doub Y N 341 TYR CG CD2 sing Y N 342 TYR CD1 CE1 sing Y N 343 TYR CD1 HD1 sing N N 344 TYR CD2 CE2 doub Y N 345 TYR CD2 HD2 sing N N 346 TYR CE1 CZ doub Y N 347 TYR CE1 HE1 sing N N 348 TYR CE2 CZ sing Y N 349 TYR CE2 HE2 sing N N 350 TYR CZ OH sing N N 351 TYR OH HH sing N N 352 TYR OXT HXT sing N N 353 VAL N CA sing N N 354 VAL N H sing N N 355 VAL N H2 sing N N 356 VAL CA C sing N N 357 VAL CA CB sing N N 358 VAL CA HA sing N N 359 VAL C O doub N N 360 VAL C OXT sing N N 361 VAL CB CG1 sing N N 362 VAL CB CG2 sing N N 363 VAL CB HB sing N N 364 VAL CG1 HG11 sing N N 365 VAL CG1 HG12 sing N N 366 VAL CG1 HG13 sing N N 367 VAL CG2 HG21 sing N N 368 VAL CG2 HG22 sing N N 369 VAL CG2 HG23 sing N N 370 VAL OXT HXT sing N N 371 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 7OLZ _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7ON5 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.022416 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022416 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006937 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_