data_7OO4 # _entry.id 7OO4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.384 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7OO4 pdb_00007oo4 10.2210/pdb7oo4/pdb WWPDB D_1292116118 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-07-21 2 'Structure model' 1 1 2021-10-20 3 'Structure model' 1 2 2021-12-22 4 'Structure model' 1 3 2024-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Database references' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_database_proc 5 3 'Structure model' citation 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond 8 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.pdbx_database_id_PubMed' 7 2 'Structure model' '_citation.title' 8 2 'Structure model' '_citation.year' 9 2 'Structure model' '_citation_author.identifier_ORCID' 10 2 'Structure model' '_citation_author.name' 11 2 'Structure model' '_database_2.pdbx_DOI' 12 2 'Structure model' '_database_2.pdbx_database_accession' 13 3 'Structure model' '_citation.journal_volume' 14 3 'Structure model' '_citation.page_first' 15 3 'Structure model' '_citation.page_last' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7OO4 _pdbx_database_status.recvd_initial_deposition_date 2021-05-26 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Stein, A.' 1 0000-0002-2526-506X 'Liang, A.D.' 2 0000-0002-9897-2822 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country GE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Chembiochem _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1439-7633 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 22 _citation.language ? _citation.page_first 3398 _citation.page_last 3401 _citation.title 'HaloTag Engineering for Enhanced Fluorogenicity and Kinetics with a Styrylpyridium Dye.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/cbic.202100424 _citation.pdbx_database_id_PubMed 34609782 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Miro-Vinyals, C.' 1 ? primary 'Stein, A.' 2 ? primary 'Fischer, S.' 3 ? primary 'Ward, T.R.' 4 ? primary 'Deliz Liang, A.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Haloalkane dehalogenase' 34216.027 1 3.8.1.5 ? ? ? 2 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 3 non-polymer syn '4-[(E)-2-[1-(7-chloranylheptyl)pyridin-1-ium-4-yl]ethenyl]-N,N-dimethyl-aniline' 357.940 1 ? ? ? ? 4 water nat water 18.015 37 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAEIGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYVWRNIIPHVAPTHRCIAPDLIGMGKSDKPDLGYF FDDHVRFMDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIAFMEFIRPIPTWDEWPEFARETFQAFRTTDVGRK LIIDQNVFIEGTLPMGVVRPLTEVEMDHYREPFLNPVDREPLWRFPNELPIAGEPANIVALVEEYMDWLHQSPVPKLLFW GTPGVLIPPAEAARLAKSLPNCKAVDIGPGLNLLQEDNPDLIGSEIARWLSTLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MAEIGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYVWRNIIPHVAPTHRCIAPDLIGMGKSDKPDLGYF FDDHVRFMDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIAFMEFIRPIPTWDEWPEFARETFQAFRTTDVGRK LIIDQNVFIEGTLPMGVVRPLTEVEMDHYREPFLNPVDREPLWRFPNELPIAGEPANIVALVEEYMDWLHQSPVPKLLFW GTPGVLIPPAEAARLAKSLPNCKAVDIGPGLNLLQEDNPDLIGSEIARWLSTLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CHLORIDE ION' CL 3 '4-[(E)-2-[1-(7-chloranylheptyl)pyridin-1-ium-4-yl]ethenyl]-N,N-dimethyl-aniline' VF2 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 GLU n 1 4 ILE n 1 5 GLY n 1 6 THR n 1 7 GLY n 1 8 PHE n 1 9 PRO n 1 10 PHE n 1 11 ASP n 1 12 PRO n 1 13 HIS n 1 14 TYR n 1 15 VAL n 1 16 GLU n 1 17 VAL n 1 18 LEU n 1 19 GLY n 1 20 GLU n 1 21 ARG n 1 22 MET n 1 23 HIS n 1 24 TYR n 1 25 VAL n 1 26 ASP n 1 27 VAL n 1 28 GLY n 1 29 PRO n 1 30 ARG n 1 31 ASP n 1 32 GLY n 1 33 THR n 1 34 PRO n 1 35 VAL n 1 36 LEU n 1 37 PHE n 1 38 LEU n 1 39 HIS n 1 40 GLY n 1 41 ASN n 1 42 PRO n 1 43 THR n 1 44 SER n 1 45 SER n 1 46 TYR n 1 47 VAL n 1 48 TRP n 1 49 ARG n 1 50 ASN n 1 51 ILE n 1 52 ILE n 1 53 PRO n 1 54 HIS n 1 55 VAL n 1 56 ALA n 1 57 PRO n 1 58 THR n 1 59 HIS n 1 60 ARG n 1 61 CYS n 1 62 ILE n 1 63 ALA n 1 64 PRO n 1 65 ASP n 1 66 LEU n 1 67 ILE n 1 68 GLY n 1 69 MET n 1 70 GLY n 1 71 LYS n 1 72 SER n 1 73 ASP n 1 74 LYS n 1 75 PRO n 1 76 ASP n 1 77 LEU n 1 78 GLY n 1 79 TYR n 1 80 PHE n 1 81 PHE n 1 82 ASP n 1 83 ASP n 1 84 HIS n 1 85 VAL n 1 86 ARG n 1 87 PHE n 1 88 MET n 1 89 ASP n 1 90 ALA n 1 91 PHE n 1 92 ILE n 1 93 GLU n 1 94 ALA n 1 95 LEU n 1 96 GLY n 1 97 LEU n 1 98 GLU n 1 99 GLU n 1 100 VAL n 1 101 VAL n 1 102 LEU n 1 103 VAL n 1 104 ILE n 1 105 HIS n 1 106 ASP n 1 107 TRP n 1 108 GLY n 1 109 SER n 1 110 ALA n 1 111 LEU n 1 112 GLY n 1 113 PHE n 1 114 HIS n 1 115 TRP n 1 116 ALA n 1 117 LYS n 1 118 ARG n 1 119 ASN n 1 120 PRO n 1 121 GLU n 1 122 ARG n 1 123 VAL n 1 124 LYS n 1 125 GLY n 1 126 ILE n 1 127 ALA n 1 128 PHE n 1 129 MET n 1 130 GLU n 1 131 PHE n 1 132 ILE n 1 133 ARG n 1 134 PRO n 1 135 ILE n 1 136 PRO n 1 137 THR n 1 138 TRP n 1 139 ASP n 1 140 GLU n 1 141 TRP n 1 142 PRO n 1 143 GLU n 1 144 PHE n 1 145 ALA n 1 146 ARG n 1 147 GLU n 1 148 THR n 1 149 PHE n 1 150 GLN n 1 151 ALA n 1 152 PHE n 1 153 ARG n 1 154 THR n 1 155 THR n 1 156 ASP n 1 157 VAL n 1 158 GLY n 1 159 ARG n 1 160 LYS n 1 161 LEU n 1 162 ILE n 1 163 ILE n 1 164 ASP n 1 165 GLN n 1 166 ASN n 1 167 VAL n 1 168 PHE n 1 169 ILE n 1 170 GLU n 1 171 GLY n 1 172 THR n 1 173 LEU n 1 174 PRO n 1 175 MET n 1 176 GLY n 1 177 VAL n 1 178 VAL n 1 179 ARG n 1 180 PRO n 1 181 LEU n 1 182 THR n 1 183 GLU n 1 184 VAL n 1 185 GLU n 1 186 MET n 1 187 ASP n 1 188 HIS n 1 189 TYR n 1 190 ARG n 1 191 GLU n 1 192 PRO n 1 193 PHE n 1 194 LEU n 1 195 ASN n 1 196 PRO n 1 197 VAL n 1 198 ASP n 1 199 ARG n 1 200 GLU n 1 201 PRO n 1 202 LEU n 1 203 TRP n 1 204 ARG n 1 205 PHE n 1 206 PRO n 1 207 ASN n 1 208 GLU n 1 209 LEU n 1 210 PRO n 1 211 ILE n 1 212 ALA n 1 213 GLY n 1 214 GLU n 1 215 PRO n 1 216 ALA n 1 217 ASN n 1 218 ILE n 1 219 VAL n 1 220 ALA n 1 221 LEU n 1 222 VAL n 1 223 GLU n 1 224 GLU n 1 225 TYR n 1 226 MET n 1 227 ASP n 1 228 TRP n 1 229 LEU n 1 230 HIS n 1 231 GLN n 1 232 SER n 1 233 PRO n 1 234 VAL n 1 235 PRO n 1 236 LYS n 1 237 LEU n 1 238 LEU n 1 239 PHE n 1 240 TRP n 1 241 GLY n 1 242 THR n 1 243 PRO n 1 244 GLY n 1 245 VAL n 1 246 LEU n 1 247 ILE n 1 248 PRO n 1 249 PRO n 1 250 ALA n 1 251 GLU n 1 252 ALA n 1 253 ALA n 1 254 ARG n 1 255 LEU n 1 256 ALA n 1 257 LYS n 1 258 SER n 1 259 LEU n 1 260 PRO n 1 261 ASN n 1 262 CYS n 1 263 LYS n 1 264 ALA n 1 265 VAL n 1 266 ASP n 1 267 ILE n 1 268 GLY n 1 269 PRO n 1 270 GLY n 1 271 LEU n 1 272 ASN n 1 273 LEU n 1 274 LEU n 1 275 GLN n 1 276 GLU n 1 277 ASP n 1 278 ASN n 1 279 PRO n 1 280 ASP n 1 281 LEU n 1 282 ILE n 1 283 GLY n 1 284 SER n 1 285 GLU n 1 286 ILE n 1 287 ALA n 1 288 ARG n 1 289 TRP n 1 290 LEU n 1 291 SER n 1 292 THR n 1 293 LEU n 1 294 GLU n 1 295 HIS n 1 296 HIS n 1 297 HIS n 1 298 HIS n 1 299 HIS n 1 300 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 300 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene dhaA _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rhodococcus sp.' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1831 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET30 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 VF2 non-polymer . '4-[(E)-2-[1-(7-chloranylheptyl)pyridin-1-ium-4-yl]ethenyl]-N,N-dimethyl-aniline' ? 'C22 H30 Cl N2 1' 357.940 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 HIS 13 13 13 HIS HIS A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 MET 22 22 22 MET MET A . n A 1 23 HIS 23 23 23 HIS HIS A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 TYR 46 46 46 TYR TYR A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 TRP 48 48 48 TRP TRP A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 HIS 54 54 54 HIS HIS A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 HIS 59 59 59 HIS HIS A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 CYS 61 61 61 CYS CYS A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 MET 69 69 69 MET MET A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 TYR 79 79 79 TYR TYR A . n A 1 80 PHE 80 80 80 PHE PHE A . n A 1 81 PHE 81 81 81 PHE PHE A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 HIS 84 84 84 HIS HIS A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 PHE 87 87 87 PHE PHE A . n A 1 88 MET 88 88 88 MET MET A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 PHE 91 91 91 PHE PHE A . n A 1 92 ILE 92 92 92 ILE ILE A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 HIS 105 105 105 HIS HIS A . n A 1 106 ASP 106 106 106 ASP GLY A . n A 1 107 TRP 107 107 107 TRP TRP A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 GLY 112 112 112 GLY GLY A . n A 1 113 PHE 113 113 113 PHE PHE A . n A 1 114 HIS 114 114 114 HIS HIS A . n A 1 115 TRP 115 115 115 TRP TRP A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 ARG 118 118 118 ARG ARG A . n A 1 119 ASN 119 119 119 ASN ASN A . n A 1 120 PRO 120 120 120 PRO PRO A . n A 1 121 GLU 121 121 121 GLU GLU A . n A 1 122 ARG 122 122 122 ARG ARG A . n A 1 123 VAL 123 123 123 VAL VAL A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 GLY 125 125 125 GLY GLY A . n A 1 126 ILE 126 126 126 ILE ILE A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 PHE 128 128 128 PHE PHE A . n A 1 129 MET 129 129 129 MET MET A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 PHE 131 131 131 PHE PHE A . n A 1 132 ILE 132 132 132 ILE ILE A . n A 1 133 ARG 133 133 133 ARG ARG A . n A 1 134 PRO 134 134 134 PRO PRO A . n A 1 135 ILE 135 135 135 ILE ILE A . n A 1 136 PRO 136 136 136 PRO PRO A . n A 1 137 THR 137 137 137 THR THR A . n A 1 138 TRP 138 138 138 TRP TRP A . n A 1 139 ASP 139 139 139 ASP ASP A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 TRP 141 141 141 TRP TRP A . n A 1 142 PRO 142 142 142 PRO PRO A . n A 1 143 GLU 143 143 143 GLU GLU A . n A 1 144 PHE 144 144 144 PHE PHE A . n A 1 145 ALA 145 145 145 ALA ALA A . n A 1 146 ARG 146 146 146 ARG ARG A . n A 1 147 GLU 147 147 147 GLU GLU A . n A 1 148 THR 148 148 148 THR THR A . n A 1 149 PHE 149 149 149 PHE PHE A . n A 1 150 GLN 150 150 150 GLN GLN A . n A 1 151 ALA 151 151 151 ALA ALA A . n A 1 152 PHE 152 152 152 PHE PHE A . n A 1 153 ARG 153 153 153 ARG ARG A . n A 1 154 THR 154 154 154 THR THR A . n A 1 155 THR 155 155 155 THR THR A . n A 1 156 ASP 156 156 156 ASP ASP A . n A 1 157 VAL 157 157 157 VAL VAL A . n A 1 158 GLY 158 158 158 GLY GLY A . n A 1 159 ARG 159 159 159 ARG ARG A . n A 1 160 LYS 160 160 160 LYS LYS A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 ILE 162 162 162 ILE ILE A . n A 1 163 ILE 163 163 163 ILE ILE A . n A 1 164 ASP 164 164 164 ASP ASP A . n A 1 165 GLN 165 165 165 GLN GLN A . n A 1 166 ASN 166 166 166 ASN ASN A . n A 1 167 VAL 167 167 167 VAL VAL A . n A 1 168 PHE 168 168 168 PHE PHE A . n A 1 169 ILE 169 169 169 ILE ILE A . n A 1 170 GLU 170 170 170 GLU GLU A . n A 1 171 GLY 171 171 171 GLY GLY A . n A 1 172 THR 172 172 172 THR THR A . n A 1 173 LEU 173 173 173 LEU LEU A . n A 1 174 PRO 174 174 174 PRO PRO A . n A 1 175 MET 175 175 175 MET MET A . n A 1 176 GLY 176 176 176 GLY GLY A . n A 1 177 VAL 177 177 177 VAL VAL A . n A 1 178 VAL 178 178 178 VAL VAL A . n A 1 179 ARG 179 179 179 ARG ARG A . n A 1 180 PRO 180 180 180 PRO PRO A . n A 1 181 LEU 181 181 181 LEU LEU A . n A 1 182 THR 182 182 182 THR THR A . n A 1 183 GLU 183 183 183 GLU GLU A . n A 1 184 VAL 184 184 184 VAL VAL A . n A 1 185 GLU 185 185 185 GLU GLU A . n A 1 186 MET 186 186 186 MET MET A . n A 1 187 ASP 187 187 187 ASP ASP A . n A 1 188 HIS 188 188 188 HIS HIS A . n A 1 189 TYR 189 189 189 TYR TYR A . n A 1 190 ARG 190 190 190 ARG ARG A . n A 1 191 GLU 191 191 191 GLU GLU A . n A 1 192 PRO 192 192 192 PRO PRO A . n A 1 193 PHE 193 193 193 PHE PHE A . n A 1 194 LEU 194 194 194 LEU LEU A . n A 1 195 ASN 195 195 195 ASN ASN A . n A 1 196 PRO 196 196 196 PRO PRO A . n A 1 197 VAL 197 197 197 VAL VAL A . n A 1 198 ASP 198 198 198 ASP ASP A . n A 1 199 ARG 199 199 199 ARG ARG A . n A 1 200 GLU 200 200 200 GLU GLU A . n A 1 201 PRO 201 201 201 PRO PRO A . n A 1 202 LEU 202 202 202 LEU LEU A . n A 1 203 TRP 203 203 203 TRP TRP A . n A 1 204 ARG 204 204 204 ARG ARG A . n A 1 205 PHE 205 205 205 PHE PHE A . n A 1 206 PRO 206 206 206 PRO PRO A . n A 1 207 ASN 207 207 207 ASN ASN A . n A 1 208 GLU 208 208 208 GLU GLU A . n A 1 209 LEU 209 209 209 LEU LEU A . n A 1 210 PRO 210 210 210 PRO PRO A . n A 1 211 ILE 211 211 211 ILE ILE A . n A 1 212 ALA 212 212 212 ALA ALA A . n A 1 213 GLY 213 213 213 GLY GLY A . n A 1 214 GLU 214 214 214 GLU GLU A . n A 1 215 PRO 215 215 215 PRO PRO A . n A 1 216 ALA 216 216 216 ALA ALA A . n A 1 217 ASN 217 217 217 ASN ASN A . n A 1 218 ILE 218 218 218 ILE ILE A . n A 1 219 VAL 219 219 219 VAL VAL A . n A 1 220 ALA 220 220 220 ALA ALA A . n A 1 221 LEU 221 221 221 LEU LEU A . n A 1 222 VAL 222 222 222 VAL VAL A . n A 1 223 GLU 223 223 223 GLU GLU A . n A 1 224 GLU 224 224 224 GLU GLU A . n A 1 225 TYR 225 225 225 TYR TYR A . n A 1 226 MET 226 226 226 MET MET A . n A 1 227 ASP 227 227 227 ASP ASP A . n A 1 228 TRP 228 228 228 TRP TRP A . n A 1 229 LEU 229 229 229 LEU LEU A . n A 1 230 HIS 230 230 230 HIS HIS A . n A 1 231 GLN 231 231 231 GLN GLN A . n A 1 232 SER 232 232 232 SER SER A . n A 1 233 PRO 233 233 233 PRO PRO A . n A 1 234 VAL 234 234 234 VAL VAL A . n A 1 235 PRO 235 235 235 PRO PRO A . n A 1 236 LYS 236 236 236 LYS LYS A . n A 1 237 LEU 237 237 237 LEU LEU A . n A 1 238 LEU 238 238 238 LEU LEU A . n A 1 239 PHE 239 239 239 PHE PHE A . n A 1 240 TRP 240 240 240 TRP TRP A . n A 1 241 GLY 241 241 241 GLY GLY A . n A 1 242 THR 242 242 242 THR THR A . n A 1 243 PRO 243 243 243 PRO PRO A . n A 1 244 GLY 244 244 244 GLY GLY A . n A 1 245 VAL 245 245 245 VAL VAL A . n A 1 246 LEU 246 246 246 LEU LEU A . n A 1 247 ILE 247 247 247 ILE ILE A . n A 1 248 PRO 248 248 248 PRO PRO A . n A 1 249 PRO 249 249 249 PRO PRO A . n A 1 250 ALA 250 250 250 ALA ALA A . n A 1 251 GLU 251 251 251 GLU GLU A . n A 1 252 ALA 252 252 252 ALA ALA A . n A 1 253 ALA 253 253 253 ALA ALA A . n A 1 254 ARG 254 254 254 ARG ARG A . n A 1 255 LEU 255 255 255 LEU LEU A . n A 1 256 ALA 256 256 256 ALA ALA A . n A 1 257 LYS 257 257 257 LYS LYS A . n A 1 258 SER 258 258 258 SER SER A . n A 1 259 LEU 259 259 259 LEU LEU A . n A 1 260 PRO 260 260 260 PRO PRO A . n A 1 261 ASN 261 261 261 ASN ASN A . n A 1 262 CYS 262 262 262 CYS CYS A . n A 1 263 LYS 263 263 263 LYS LYS A . n A 1 264 ALA 264 264 264 ALA ALA A . n A 1 265 VAL 265 265 265 VAL VAL A . n A 1 266 ASP 266 266 266 ASP ASP A . n A 1 267 ILE 267 267 267 ILE ILE A . n A 1 268 GLY 268 268 268 GLY GLY A . n A 1 269 PRO 269 269 269 PRO PRO A . n A 1 270 GLY 270 270 270 GLY GLY A . n A 1 271 LEU 271 271 271 LEU LEU A . n A 1 272 ASN 272 272 272 ASN ASN A . n A 1 273 LEU 273 273 273 LEU LEU A . n A 1 274 LEU 274 274 274 LEU LEU A . n A 1 275 GLN 275 275 275 GLN GLN A . n A 1 276 GLU 276 276 276 GLU GLU A . n A 1 277 ASP 277 277 277 ASP ASP A . n A 1 278 ASN 278 278 278 ASN ASN A . n A 1 279 PRO 279 279 279 PRO PRO A . n A 1 280 ASP 280 280 280 ASP ASP A . n A 1 281 LEU 281 281 281 LEU LEU A . n A 1 282 ILE 282 282 282 ILE ILE A . n A 1 283 GLY 283 283 283 GLY GLY A . n A 1 284 SER 284 284 284 SER SER A . n A 1 285 GLU 285 285 285 GLU GLU A . n A 1 286 ILE 286 286 286 ILE ILE A . n A 1 287 ALA 287 287 287 ALA ALA A . n A 1 288 ARG 288 288 288 ARG ARG A . n A 1 289 TRP 289 289 289 TRP TRP A . n A 1 290 LEU 290 290 290 LEU LEU A . n A 1 291 SER 291 291 291 SER SER A . n A 1 292 THR 292 292 292 THR THR A . n A 1 293 LEU 293 293 293 LEU LEU A . n A 1 294 GLU 294 294 294 GLU GLU A . n A 1 295 HIS 295 295 ? ? ? A . n A 1 296 HIS 296 296 ? ? ? A . n A 1 297 HIS 297 297 ? ? ? A . n A 1 298 HIS 298 298 ? ? ? A . n A 1 299 HIS 299 299 ? ? ? A . n A 1 300 HIS 300 300 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CL 1 401 1 CL CL A . C 3 VF2 1 402 301 VF2 LIG A . D 4 HOH 1 501 15 HOH HOH A . D 4 HOH 2 502 17 HOH HOH A . D 4 HOH 3 503 24 HOH HOH A . D 4 HOH 4 504 25 HOH HOH A . D 4 HOH 5 505 33 HOH HOH A . D 4 HOH 6 506 8 HOH HOH A . D 4 HOH 7 507 13 HOH HOH A . D 4 HOH 8 508 11 HOH HOH A . D 4 HOH 9 509 9 HOH HOH A . D 4 HOH 10 510 16 HOH HOH A . D 4 HOH 11 511 18 HOH HOH A . D 4 HOH 12 512 43 HOH HOH A . D 4 HOH 13 513 39 HOH HOH A . D 4 HOH 14 514 34 HOH HOH A . D 4 HOH 15 515 40 HOH HOH A . D 4 HOH 16 516 35 HOH HOH A . D 4 HOH 17 517 7 HOH HOH A . D 4 HOH 18 518 36 HOH HOH A . D 4 HOH 19 519 14 HOH HOH A . D 4 HOH 20 520 5 HOH HOH A . D 4 HOH 21 521 3 HOH HOH A . D 4 HOH 22 522 12 HOH HOH A . D 4 HOH 23 523 41 HOH HOH A . D 4 HOH 24 524 22 HOH HOH A . D 4 HOH 25 525 4 HOH HOH A . D 4 HOH 26 526 38 HOH HOH A . D 4 HOH 27 527 23 HOH HOH A . D 4 HOH 28 528 19 HOH HOH A . D 4 HOH 29 529 20 HOH HOH A . D 4 HOH 30 530 21 HOH HOH A . D 4 HOH 31 531 6 HOH HOH A . D 4 HOH 32 532 26 HOH HOH A . D 4 HOH 33 533 10 HOH HOH A . D 4 HOH 34 534 30 HOH HOH A . D 4 HOH 35 535 32 HOH HOH A . D 4 HOH 36 536 44 HOH HOH A . D 4 HOH 37 537 31 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7OO4 _cell.details ? _cell.formula_units_Z ? _cell.length_a 52.319 _cell.length_a_esd ? _cell.length_b 68.986 _cell.length_b_esd ? _cell.length_c 86.020 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7OO4 _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7OO4 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.27 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 45.78 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.6 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.1 M Na3 Cit 5.6 pH 20 %v/v 2-PropOH 20 %w/v PEG 4K ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 2M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-03-20 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.000031 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X06DA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.000031 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X06DA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7OO4 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.1 _reflns.d_resolution_low 43.05 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 18774 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.90 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.6 _reflns.pdbx_Rmerge_I_obs 0.1213 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 15.50 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.1265 _reflns.pdbx_Rpim_I_all 0.03554 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.1 _reflns_shell.d_res_low 2.175 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.75 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1842 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.9583 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.9984 _reflns_shell.pdbx_Rpim_I_all 0.2778 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.88 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] -0.2100 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] -0.0000 _refine.aniso_B[2][2] -4.4900 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 4.7100 _refine.B_iso_max 90.050 _refine.B_iso_mean 37.9390 _refine.B_iso_min 23.020 _refine.correlation_coeff_Fo_to_Fc 0.9540 _refine.correlation_coeff_Fo_to_Fc_free 0.9200 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7OO4 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.1000 _refine.ls_d_res_low 43.0500 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 17847 _refine.ls_number_reflns_R_free 914 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9100 _refine.ls_percent_reflns_R_free 4.9000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2123 _refine.ls_R_factor_R_free 0.2632 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2097 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5y2x _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.2420 _refine.pdbx_overall_ESU_R_Free 0.2070 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 8.3290 _refine.overall_SU_ML 0.2020 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.1000 _refine_hist.d_res_low 43.0500 _refine_hist.number_atoms_solvent 37 _refine_hist.number_atoms_total 2408 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 292 _refine_hist.pdbx_B_iso_mean_ligand 43.75 _refine_hist.pdbx_B_iso_mean_solvent 34.98 _refine_hist.pdbx_number_atoms_protein 2342 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 29 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 0.013 2451 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 2247 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.673 1.659 3346 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.309 1.570 5187 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.273 5.000 291 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 29.084 21.667 132 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 16.292 15.000 369 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 19.213 15.000 17 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.082 0.200 300 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.009 0.020 2748 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 558 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.1000 _refine_ls_shell.d_res_low 2.1550 _refine_ls_shell.number_reflns_all 1373 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 69 _refine_ls_shell.number_reflns_R_work 1304 _refine_ls_shell.percent_reflns_obs 100.0000 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3610 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.3530 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7OO4 _struct.title 'HaloTag Engineering for Enhanced Fluorogenicity and Kinetics with a Styrylpyridine Dye' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7OO4 _struct_keywords.text 'HaloTag, Fluorescence, Imaging, mammalian cells, fluorescent reporter, channel dye, directed evolution, FLUORESCENT PROTEIN' _struct_keywords.pdbx_keywords 'FLUORESCENT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DHAA_RHOSO _struct_ref.pdbx_db_accession P0A3G3 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EIGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFD DHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIPTWDEWPEFARETFQAFRTADVGRELI IDQNAFIEGALPKCVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGT PGVLIPPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPAL ; _struct_ref.pdbx_align_begin 3 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7OO4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 293 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0A3G3 _struct_ref_seq.db_align_beg 3 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 293 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 293 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7OO4 MET A 1 ? UNP P0A3G3 ? ? 'initiating methionine' 1 1 1 7OO4 ALA A 2 ? UNP P0A3G3 ? ? 'expression tag' 2 2 1 7OO4 VAL A 47 ? UNP P0A3G3 LEU 47 'engineered mutation' 47 3 1 7OO4 THR A 58 ? UNP P0A3G3 SER 58 'engineered mutation' 58 4 1 7OO4 GLY A 78 ? UNP P0A3G3 ASP 78 'engineered mutation' 78 5 1 7OO4 PHE A 87 ? UNP P0A3G3 TYR 87 'engineered mutation' 87 6 1 7OO4 MET A 88 ? UNP P0A3G3 LEU 88 'engineered mutation' 88 7 1 7OO4 PHE A 128 ? UNP P0A3G3 CYS 128 'engineered mutation' 128 8 1 7OO4 THR A 155 ? UNP P0A3G3 ALA 155 'engineered mutation' 155 9 1 7OO4 LYS A 160 ? UNP P0A3G3 GLU 160 'engineered mutation' 160 10 1 7OO4 VAL A 167 ? UNP P0A3G3 ALA 167 'engineered mutation' 167 11 1 7OO4 THR A 172 ? UNP P0A3G3 ALA 172 'engineered mutation' 172 12 1 7OO4 MET A 175 ? UNP P0A3G3 LYS 175 'engineered mutation' 175 13 1 7OO4 GLY A 176 ? UNP P0A3G3 CYS 176 'engineered mutation' 176 14 1 7OO4 ASN A 195 ? UNP P0A3G3 LYS 195 'engineered mutation' 195 15 1 7OO4 GLU A 224 ? UNP P0A3G3 ALA 224 'engineered mutation' 224 16 1 7OO4 ASP A 227 ? UNP P0A3G3 ASN 227 'engineered mutation' 227 17 1 7OO4 LYS A 257 ? UNP P0A3G3 GLU 257 'engineered mutation' 257 18 1 7OO4 ALA A 264 ? UNP P0A3G3 THR 264 'engineered mutation' 264 19 1 7OO4 ASN A 272 ? UNP P0A3G3 HIS 272 'engineered mutation' 272 20 1 7OO4 LEU A 273 ? UNP P0A3G3 TYR 273 'engineered mutation' 273 21 1 7OO4 SER A 291 ? UNP P0A3G3 PRO 291 'engineered mutation' 291 22 1 7OO4 THR A 292 ? UNP P0A3G3 ALA 292 'engineered mutation' 292 23 1 7OO4 GLU A 294 ? UNP P0A3G3 ? ? 'expression tag' 294 24 1 7OO4 HIS A 295 ? UNP P0A3G3 ? ? 'expression tag' 295 25 1 7OO4 HIS A 296 ? UNP P0A3G3 ? ? 'expression tag' 296 26 1 7OO4 HIS A 297 ? UNP P0A3G3 ? ? 'expression tag' 297 27 1 7OO4 HIS A 298 ? UNP P0A3G3 ? ? 'expression tag' 298 28 1 7OO4 HIS A 299 ? UNP P0A3G3 ? ? 'expression tag' 299 29 1 7OO4 HIS A 300 ? UNP P0A3G3 ? ? 'expression tag' 300 30 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 130 ? 1 MORE -13 ? 1 'SSA (A^2)' 11660 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 44 ? ARG A 49 ? SER A 44 ARG A 49 5 ? 6 HELX_P HELX_P2 AA2 ILE A 51 ? ALA A 56 ? ILE A 51 ALA A 56 1 ? 6 HELX_P HELX_P3 AA3 PHE A 80 ? LEU A 95 ? PHE A 80 LEU A 95 1 ? 16 HELX_P HELX_P4 AA4 ASP A 106 ? ASN A 119 ? ASP A 106 ASN A 119 1 ? 14 HELX_P HELX_P5 AA5 PRO A 142 ? PHE A 144 ? PRO A 142 PHE A 144 5 ? 3 HELX_P HELX_P6 AA6 ALA A 145 ? ARG A 153 ? ALA A 145 ARG A 153 1 ? 9 HELX_P HELX_P7 AA7 ASP A 156 ? ILE A 163 ? ASP A 156 ILE A 163 1 ? 8 HELX_P HELX_P8 AA8 ASN A 166 ? GLY A 171 ? ASN A 166 GLY A 171 1 ? 6 HELX_P HELX_P9 AA9 GLY A 171 ? GLY A 176 ? GLY A 171 GLY A 176 1 ? 6 HELX_P HELX_P10 AB1 THR A 182 ? GLU A 191 ? THR A 182 GLU A 191 1 ? 10 HELX_P HELX_P11 AB2 PRO A 192 ? LEU A 194 ? PRO A 192 LEU A 194 5 ? 3 HELX_P HELX_P12 AB3 ASN A 195 ? ASP A 198 ? ASN A 195 ASP A 198 5 ? 4 HELX_P HELX_P13 AB4 ARG A 199 ? LEU A 209 ? ARG A 199 LEU A 209 1 ? 11 HELX_P HELX_P14 AB5 PRO A 215 ? SER A 232 ? PRO A 215 SER A 232 1 ? 18 HELX_P HELX_P15 AB6 PRO A 248 ? LEU A 259 ? PRO A 248 LEU A 259 1 ? 12 HELX_P HELX_P16 AB7 LEU A 273 ? ASP A 277 ? LEU A 273 ASP A 277 5 ? 5 HELX_P HELX_P17 AB8 ASN A 278 ? THR A 292 ? ASN A 278 THR A 292 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag none _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id ASP _struct_conn.ptnr1_label_seq_id 106 _struct_conn.ptnr1_label_atom_id OD1 _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id C _struct_conn.ptnr2_label_comp_id VF2 _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C20 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id ASP _struct_conn.ptnr1_auth_seq_id 106 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id VF2 _struct_conn.ptnr2_auth_seq_id 402 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.440 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ASN 41 A . ? ASN 41 A PRO 42 A ? PRO 42 A 1 -10.99 2 GLU 214 A . ? GLU 214 A PRO 215 A ? PRO 215 A 1 0.62 3 THR 242 A . ? THR 242 A PRO 243 A ? PRO 243 A 1 5.03 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 8 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? parallel AA1 7 8 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 HIS A 13 ? VAL A 17 ? HIS A 13 VAL A 17 AA1 2 GLU A 20 ? VAL A 27 ? GLU A 20 VAL A 27 AA1 3 CYS A 61 ? PRO A 64 ? CYS A 61 PRO A 64 AA1 4 VAL A 35 ? LEU A 38 ? VAL A 35 LEU A 38 AA1 5 VAL A 100 ? HIS A 105 ? VAL A 100 HIS A 105 AA1 6 VAL A 123 ? MET A 129 ? VAL A 123 MET A 129 AA1 7 LYS A 236 ? PRO A 243 ? LYS A 236 PRO A 243 AA1 8 CYS A 262 ? GLY A 270 ? CYS A 262 GLY A 270 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 17 ? N VAL A 17 O GLU A 20 ? O GLU A 20 AA1 2 3 N VAL A 27 ? N VAL A 27 O CYS A 61 ? O CYS A 61 AA1 3 4 O ILE A 62 ? O ILE A 62 N VAL A 35 ? N VAL A 35 AA1 4 5 N LEU A 36 ? N LEU A 36 O VAL A 101 ? O VAL A 101 AA1 5 6 N LEU A 102 ? N LEU A 102 O ALA A 127 ? O ALA A 127 AA1 6 7 N PHE A 128 ? N PHE A 128 O LEU A 237 ? O LEU A 237 AA1 7 8 N TRP A 240 ? N TRP A 240 O ILE A 267 ? O ILE A 267 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CG _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 ASP _pdbx_validate_rmsd_bond.auth_seq_id_1 106 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 OD1 _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 ASP _pdbx_validate_rmsd_bond.auth_seq_id_2 106 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.401 _pdbx_validate_rmsd_bond.bond_target_value 1.249 _pdbx_validate_rmsd_bond.bond_deviation 0.152 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.023 _pdbx_validate_rmsd_bond.linker_flag N # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CB _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ASP _pdbx_validate_rmsd_angle.auth_seq_id_1 106 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CA _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ASP _pdbx_validate_rmsd_angle.auth_seq_id_2 106 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 C _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ASP _pdbx_validate_rmsd_angle.auth_seq_id_3 106 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 122.42 _pdbx_validate_rmsd_angle.angle_target_value 110.40 _pdbx_validate_rmsd_angle.angle_deviation 12.02 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.00 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 42 ? ? -104.16 50.71 2 1 ASP A 76 ? ? -100.48 73.86 3 1 GLU A 98 ? ? -92.49 -82.87 4 1 ASP A 106 ? ? 55.31 -125.45 5 1 ASN A 119 ? ? -142.76 43.03 6 1 ARG A 153 ? ? -88.15 48.59 7 1 ASP A 156 ? ? -96.96 -66.84 8 1 VAL A 245 ? ? -126.36 -69.81 9 1 LEU A 271 ? ? -121.47 -105.67 # _pdbx_entry_details.entry_id 7OO4 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A HIS 295 ? A HIS 295 4 1 Y 1 A HIS 296 ? A HIS 296 5 1 Y 1 A HIS 297 ? A HIS 297 6 1 Y 1 A HIS 298 ? A HIS 298 7 1 Y 1 A HIS 299 ? A HIS 299 8 1 Y 1 A HIS 300 ? A HIS 300 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 THR N N N N 305 THR CA C N S 306 THR C C N N 307 THR O O N N 308 THR CB C N R 309 THR OG1 O N N 310 THR CG2 C N N 311 THR OXT O N N 312 THR H H N N 313 THR H2 H N N 314 THR HA H N N 315 THR HB H N N 316 THR HG1 H N N 317 THR HG21 H N N 318 THR HG22 H N N 319 THR HG23 H N N 320 THR HXT H N N 321 TRP N N N N 322 TRP CA C N S 323 TRP C C N N 324 TRP O O N N 325 TRP CB C N N 326 TRP CG C Y N 327 TRP CD1 C Y N 328 TRP CD2 C Y N 329 TRP NE1 N Y N 330 TRP CE2 C Y N 331 TRP CE3 C Y N 332 TRP CZ2 C Y N 333 TRP CZ3 C Y N 334 TRP CH2 C Y N 335 TRP OXT O N N 336 TRP H H N N 337 TRP H2 H N N 338 TRP HA H N N 339 TRP HB2 H N N 340 TRP HB3 H N N 341 TRP HD1 H N N 342 TRP HE1 H N N 343 TRP HE3 H N N 344 TRP HZ2 H N N 345 TRP HZ3 H N N 346 TRP HH2 H N N 347 TRP HXT H N N 348 TYR N N N N 349 TYR CA C N S 350 TYR C C N N 351 TYR O O N N 352 TYR CB C N N 353 TYR CG C Y N 354 TYR CD1 C Y N 355 TYR CD2 C Y N 356 TYR CE1 C Y N 357 TYR CE2 C Y N 358 TYR CZ C Y N 359 TYR OH O N N 360 TYR OXT O N N 361 TYR H H N N 362 TYR H2 H N N 363 TYR HA H N N 364 TYR HB2 H N N 365 TYR HB3 H N N 366 TYR HD1 H N N 367 TYR HD2 H N N 368 TYR HE1 H N N 369 TYR HE2 H N N 370 TYR HH H N N 371 TYR HXT H N N 372 VAL N N N N 373 VAL CA C N S 374 VAL C C N N 375 VAL O O N N 376 VAL CB C N N 377 VAL CG1 C N N 378 VAL CG2 C N N 379 VAL OXT O N N 380 VAL H H N N 381 VAL H2 H N N 382 VAL HA H N N 383 VAL HB H N N 384 VAL HG11 H N N 385 VAL HG12 H N N 386 VAL HG13 H N N 387 VAL HG21 H N N 388 VAL HG22 H N N 389 VAL HG23 H N N 390 VAL HXT H N N 391 VF2 C10 C Y N 392 VF2 C15 C N N 393 VF2 C17 C N N 394 VF2 C20 C N N 395 VF2 C22 C Y N 396 VF2 C24 C Y N 397 VF2 C01 C N N 398 VF2 N02 N N N 399 VF2 C03 C N N 400 VF2 C04 C Y N 401 VF2 C05 C Y N 402 VF2 C06 C Y N 403 VF2 C07 C Y N 404 VF2 C08 C N N 405 VF2 C09 C N N 406 VF2 C11 C Y N 407 VF2 C12 C Y N 408 VF2 N13 N Y N 409 VF2 C14 C N N 410 VF2 C16 C N N 411 VF2 C18 C N N 412 VF2 C19 C N N 413 VF2 C23 C Y N 414 VF2 C25 C Y N 415 VF2 CL1 CL N N 416 VF2 H1 H N N 417 VF2 H2 H N N 418 VF2 H3 H N N 419 VF2 H4 H N N 420 VF2 H5 H N N 421 VF2 H6 H N N 422 VF2 H7 H N N 423 VF2 H8 H N N 424 VF2 H9 H N N 425 VF2 H10 H N N 426 VF2 H11 H N N 427 VF2 H12 H N N 428 VF2 H13 H N N 429 VF2 H14 H N N 430 VF2 H15 H N N 431 VF2 H16 H N N 432 VF2 H17 H N N 433 VF2 H18 H N N 434 VF2 H19 H N N 435 VF2 H20 H N N 436 VF2 H21 H N N 437 VF2 H22 H N N 438 VF2 H23 H N N 439 VF2 H24 H N N 440 VF2 H25 H N N 441 VF2 H26 H N N 442 VF2 H27 H N N 443 VF2 H28 H N N 444 VF2 H29 H N N 445 VF2 H30 H N N 446 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 VF2 C03 N02 sing N N 376 VF2 C01 N02 sing N N 377 VF2 N02 C04 sing N N 378 VF2 C25 C04 doub Y N 379 VF2 C25 C24 sing Y N 380 VF2 C04 C05 sing Y N 381 VF2 C24 C07 doub Y N 382 VF2 C05 C06 doub Y N 383 VF2 C07 C06 sing Y N 384 VF2 C07 C08 sing N N 385 VF2 C08 C09 doub N E 386 VF2 C09 C10 sing N N 387 VF2 C11 C10 doub Y N 388 VF2 C11 C12 sing Y N 389 VF2 C10 C23 sing Y N 390 VF2 C12 N13 doub Y N 391 VF2 C23 C22 doub Y N 392 VF2 N13 C22 sing Y N 393 VF2 N13 C14 sing N N 394 VF2 C15 C14 sing N N 395 VF2 C15 C16 sing N N 396 VF2 C17 C16 sing N N 397 VF2 C17 C18 sing N N 398 VF2 C19 C18 sing N N 399 VF2 C19 C20 sing N N 400 VF2 C20 CL1 sing N N 401 VF2 C15 H1 sing N N 402 VF2 C15 H2 sing N N 403 VF2 C17 H3 sing N N 404 VF2 C17 H4 sing N N 405 VF2 C20 H5 sing N N 406 VF2 C20 H6 sing N N 407 VF2 C22 H7 sing N N 408 VF2 C24 H8 sing N N 409 VF2 C01 H9 sing N N 410 VF2 C01 H10 sing N N 411 VF2 C01 H11 sing N N 412 VF2 C03 H12 sing N N 413 VF2 C03 H13 sing N N 414 VF2 C03 H14 sing N N 415 VF2 C05 H15 sing N N 416 VF2 C06 H16 sing N N 417 VF2 C08 H17 sing N N 418 VF2 C09 H18 sing N N 419 VF2 C11 H19 sing N N 420 VF2 C12 H20 sing N N 421 VF2 C14 H21 sing N N 422 VF2 C14 H22 sing N N 423 VF2 C16 H23 sing N N 424 VF2 C16 H24 sing N N 425 VF2 C18 H25 sing N N 426 VF2 C18 H26 sing N N 427 VF2 C19 H27 sing N N 428 VF2 C19 H28 sing N N 429 VF2 C23 H29 sing N N 430 VF2 C25 H30 sing N N 431 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id VF2 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id VF2 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5Y2X _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7OO4 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.019114 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014496 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011625 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CL N O S # loop_