data_7P4V
# 
_entry.id   7P4V 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.384 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   7P4V         pdb_00007p4v 10.2210/pdb7p4v/pdb 
WWPDB D_1292116956 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2021-10-06 
2 'Structure model' 1 1 2024-01-31 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'        
2 2 'Structure model' 'Refinement description' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' chem_comp_atom                
2 2 'Structure model' chem_comp_bond                
3 2 'Structure model' pdbx_initial_refinement_model 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        7P4V 
_pdbx_database_status.recvd_initial_deposition_date   2021-07-13 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Mueller, M.-C.' 1 0000-0002-2617-2826 
'Wagner, T.'     2 0000-0002-3382-8969 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   CH 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Int J Mol Sci' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1422-0067 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            22 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     
;The Oxoglutarate Binding Site and Regulatory Mechanism Are Conserved in Ammonium Transporter Inhibitors GlnKs from Methanococcales .
;
_citation.year                      2021 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.3390/ijms22168631 
_citation.pdbx_database_id_PubMed   34445335 
_citation.pdbx_database_id_patent   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Muller, M.C.' 1 0000-0002-2617-2826 
primary 'Wagner, T.'   2 ?                   
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'GlnK1 from Methanothermococcus thermolithotrophicus' 14648.796 1  ? ? ? 
'Protein was expressed with a His-tag in the N-terminal.' 
2 non-polymer syn "2'-DEOXYADENOSINE-5'-DIPHOSPHATE"                    411.202   1  ? ? ? ? 
3 non-polymer syn 'CHLORIDE ION'                                        35.453    2  ? ? ? ? 
4 water       nat water                                                 18.015    23 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGSSHHHHHHSSGLVPRGSHMKKVEAIIRPERLDIVKNALSDAGYVGMTVSEVKGRGIQGGIVERYRGREYIVDLLPKIK
IEMAVNDEDVEKVIDIICENAKTGEFGDGKIFVIPIEEVVRVRTGERGNDAI
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGSSHHHHHHSSGLVPRGSHMKKVEAIIRPERLDIVKNALSDAGYVGMTVSEVKGRGIQGGIVERYRGREYIVDLLPKIK
IEMAVNDEDVEKVIDIICENAKTGEFGDGKIFVIPIEEVVRVRTGERGNDAI
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 "2'-DEOXYADENOSINE-5'-DIPHOSPHATE" DAT 
3 'CHLORIDE ION'                     CL  
4 water                              HOH 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  HIS n 
1 21  MET n 
1 22  LYS n 
1 23  LYS n 
1 24  VAL n 
1 25  GLU n 
1 26  ALA n 
1 27  ILE n 
1 28  ILE n 
1 29  ARG n 
1 30  PRO n 
1 31  GLU n 
1 32  ARG n 
1 33  LEU n 
1 34  ASP n 
1 35  ILE n 
1 36  VAL n 
1 37  LYS n 
1 38  ASN n 
1 39  ALA n 
1 40  LEU n 
1 41  SER n 
1 42  ASP n 
1 43  ALA n 
1 44  GLY n 
1 45  TYR n 
1 46  VAL n 
1 47  GLY n 
1 48  MET n 
1 49  THR n 
1 50  VAL n 
1 51  SER n 
1 52  GLU n 
1 53  VAL n 
1 54  LYS n 
1 55  GLY n 
1 56  ARG n 
1 57  GLY n 
1 58  ILE n 
1 59  GLN n 
1 60  GLY n 
1 61  GLY n 
1 62  ILE n 
1 63  VAL n 
1 64  GLU n 
1 65  ARG n 
1 66  TYR n 
1 67  ARG n 
1 68  GLY n 
1 69  ARG n 
1 70  GLU n 
1 71  TYR n 
1 72  ILE n 
1 73  VAL n 
1 74  ASP n 
1 75  LEU n 
1 76  LEU n 
1 77  PRO n 
1 78  LYS n 
1 79  ILE n 
1 80  LYS n 
1 81  ILE n 
1 82  GLU n 
1 83  MET n 
1 84  ALA n 
1 85  VAL n 
1 86  ASN n 
1 87  ASP n 
1 88  GLU n 
1 89  ASP n 
1 90  VAL n 
1 91  GLU n 
1 92  LYS n 
1 93  VAL n 
1 94  ILE n 
1 95  ASP n 
1 96  ILE n 
1 97  ILE n 
1 98  CYS n 
1 99  GLU n 
1 100 ASN n 
1 101 ALA n 
1 102 LYS n 
1 103 THR n 
1 104 GLY n 
1 105 GLU n 
1 106 PHE n 
1 107 GLY n 
1 108 ASP n 
1 109 GLY n 
1 110 LYS n 
1 111 ILE n 
1 112 PHE n 
1 113 VAL n 
1 114 ILE n 
1 115 PRO n 
1 116 ILE n 
1 117 GLU n 
1 118 GLU n 
1 119 VAL n 
1 120 VAL n 
1 121 ARG n 
1 122 VAL n 
1 123 ARG n 
1 124 THR n 
1 125 GLY n 
1 126 GLU n 
1 127 ARG n 
1 128 GLY n 
1 129 ASN n 
1 130 ASP n 
1 131 ALA n 
1 132 ILE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   132 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 glnk1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'DSM 2095' 
_entity_src_gen.gene_src_tissue                    / 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   / 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Methanothermococcus thermolithotrophicus DSM 2095' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     523845 
_entity_src_gen.pdbx_gene_src_variant              / 
_entity_src_gen.pdbx_gene_src_cell_line            / 
_entity_src_gen.pdbx_gene_src_atcc                 / 
_entity_src_gen.pdbx_gene_src_organ                / 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 / 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                / 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               / 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              / 
_entity_src_gen.pdbx_host_org_cell_line            / 
_entity_src_gen.pdbx_host_org_atcc                 / 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 / 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pET-28a(+)' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                            ?    'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                           ?    'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                         ?    'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                    ?    'C4 H7 N O4'       133.103 
CL  non-polymer         . 'CHLORIDE ION'                     ?    'Cl -1'            35.453  
CYS 'L-peptide linking' y CYSTEINE                           ?    'C3 H7 N O2 S'     121.158 
DAT non-polymer         . "2'-DEOXYADENOSINE-5'-DIPHOSPHATE" DADP 'C10 H15 N5 O9 P2' 411.202 
GLN 'L-peptide linking' y GLUTAMINE                          ?    'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                    ?    'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                            ?    'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                          ?    'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                              ?    'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                         ?    'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                            ?    'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                             ?    'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                         ?    'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                      ?    'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                            ?    'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                             ?    'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                          ?    'C4 H9 N O3'       119.119 
TYR 'L-peptide linking' y TYROSINE                           ?    'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                             ?    'C5 H11 N O2'      117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -19 ?   ?   ?   A . n 
A 1 2   GLY 2   -18 ?   ?   ?   A . n 
A 1 3   SER 3   -17 ?   ?   ?   A . n 
A 1 4   SER 4   -16 ?   ?   ?   A . n 
A 1 5   HIS 5   -15 ?   ?   ?   A . n 
A 1 6   HIS 6   -14 ?   ?   ?   A . n 
A 1 7   HIS 7   -13 ?   ?   ?   A . n 
A 1 8   HIS 8   -12 ?   ?   ?   A . n 
A 1 9   HIS 9   -11 ?   ?   ?   A . n 
A 1 10  HIS 10  -10 ?   ?   ?   A . n 
A 1 11  SER 11  -9  ?   ?   ?   A . n 
A 1 12  SER 12  -8  ?   ?   ?   A . n 
A 1 13  GLY 13  -7  ?   ?   ?   A . n 
A 1 14  LEU 14  -6  ?   ?   ?   A . n 
A 1 15  VAL 15  -5  ?   ?   ?   A . n 
A 1 16  PRO 16  -4  ?   ?   ?   A . n 
A 1 17  ARG 17  -3  ?   ?   ?   A . n 
A 1 18  GLY 18  -2  ?   ?   ?   A . n 
A 1 19  SER 19  -1  ?   ?   ?   A . n 
A 1 20  HIS 20  0   0   HIS HIS A . n 
A 1 21  MET 21  1   1   MET MET A . n 
A 1 22  LYS 22  2   2   LYS LYS A . n 
A 1 23  LYS 23  3   3   LYS LYS A . n 
A 1 24  VAL 24  4   4   VAL VAL A . n 
A 1 25  GLU 25  5   5   GLU GLU A . n 
A 1 26  ALA 26  6   6   ALA ALA A . n 
A 1 27  ILE 27  7   7   ILE ILE A . n 
A 1 28  ILE 28  8   8   ILE ILE A . n 
A 1 29  ARG 29  9   9   ARG ARG A . n 
A 1 30  PRO 30  10  10  PRO PRO A . n 
A 1 31  GLU 31  11  11  GLU GLU A . n 
A 1 32  ARG 32  12  12  ARG ARG A . n 
A 1 33  LEU 33  13  13  LEU LEU A . n 
A 1 34  ASP 34  14  14  ASP ASP A . n 
A 1 35  ILE 35  15  15  ILE ILE A . n 
A 1 36  VAL 36  16  16  VAL VAL A . n 
A 1 37  LYS 37  17  17  LYS LYS A . n 
A 1 38  ASN 38  18  18  ASN ASN A . n 
A 1 39  ALA 39  19  19  ALA ALA A . n 
A 1 40  LEU 40  20  20  LEU LEU A . n 
A 1 41  SER 41  21  21  SER SER A . n 
A 1 42  ASP 42  22  22  ASP ASP A . n 
A 1 43  ALA 43  23  23  ALA ALA A . n 
A 1 44  GLY 44  24  24  GLY GLY A . n 
A 1 45  TYR 45  25  25  TYR TYR A . n 
A 1 46  VAL 46  26  26  VAL VAL A . n 
A 1 47  GLY 47  27  27  GLY GLY A . n 
A 1 48  MET 48  28  28  MET MET A . n 
A 1 49  THR 49  29  29  THR THR A . n 
A 1 50  VAL 50  30  30  VAL VAL A . n 
A 1 51  SER 51  31  31  SER SER A . n 
A 1 52  GLU 52  32  32  GLU GLU A . n 
A 1 53  VAL 53  33  33  VAL VAL A . n 
A 1 54  LYS 54  34  34  LYS LYS A . n 
A 1 55  GLY 55  35  35  GLY GLY A . n 
A 1 56  ARG 56  36  36  ARG ARG A . n 
A 1 57  GLY 57  37  37  GLY GLY A . n 
A 1 58  ILE 58  38  38  ILE ILE A . n 
A 1 59  GLN 59  39  39  GLN GLN A . n 
A 1 60  GLY 60  40  40  GLY GLY A . n 
A 1 61  GLY 61  41  41  GLY GLY A . n 
A 1 62  ILE 62  42  42  ILE ILE A . n 
A 1 63  VAL 63  43  43  VAL VAL A . n 
A 1 64  GLU 64  44  44  GLU GLU A . n 
A 1 65  ARG 65  45  45  ARG ARG A . n 
A 1 66  TYR 66  46  46  TYR TYR A . n 
A 1 67  ARG 67  47  47  ARG ARG A . n 
A 1 68  GLY 68  48  48  GLY GLY A . n 
A 1 69  ARG 69  49  49  ARG ARG A . n 
A 1 70  GLU 70  50  50  GLU GLU A . n 
A 1 71  TYR 71  51  51  TYR TYR A . n 
A 1 72  ILE 72  52  52  ILE ILE A . n 
A 1 73  VAL 73  53  53  VAL VAL A . n 
A 1 74  ASP 74  54  54  ASP ASP A . n 
A 1 75  LEU 75  55  55  LEU LEU A . n 
A 1 76  LEU 76  56  56  LEU LEU A . n 
A 1 77  PRO 77  57  57  PRO PRO A . n 
A 1 78  LYS 78  58  58  LYS LYS A . n 
A 1 79  ILE 79  59  59  ILE ILE A . n 
A 1 80  LYS 80  60  60  LYS LYS A . n 
A 1 81  ILE 81  61  61  ILE ILE A . n 
A 1 82  GLU 82  62  62  GLU GLU A . n 
A 1 83  MET 83  63  63  MET MET A . n 
A 1 84  ALA 84  64  64  ALA ALA A . n 
A 1 85  VAL 85  65  65  VAL VAL A . n 
A 1 86  ASN 86  66  66  ASN ASN A . n 
A 1 87  ASP 87  67  67  ASP ASP A . n 
A 1 88  GLU 88  68  68  GLU GLU A . n 
A 1 89  ASP 89  69  69  ASP ASP A . n 
A 1 90  VAL 90  70  70  VAL VAL A . n 
A 1 91  GLU 91  71  71  GLU GLU A . n 
A 1 92  LYS 92  72  72  LYS LYS A . n 
A 1 93  VAL 93  73  73  VAL VAL A . n 
A 1 94  ILE 94  74  74  ILE ILE A . n 
A 1 95  ASP 95  75  75  ASP ASP A . n 
A 1 96  ILE 96  76  76  ILE ILE A . n 
A 1 97  ILE 97  77  77  ILE ILE A . n 
A 1 98  CYS 98  78  78  CYS CYS A . n 
A 1 99  GLU 99  79  79  GLU GLU A . n 
A 1 100 ASN 100 80  80  ASN ASN A . n 
A 1 101 ALA 101 81  81  ALA ALA A . n 
A 1 102 LYS 102 82  82  LYS LYS A . n 
A 1 103 THR 103 83  83  THR THR A . n 
A 1 104 GLY 104 84  84  GLY GLY A . n 
A 1 105 GLU 105 85  85  GLU GLU A . n 
A 1 106 PHE 106 86  86  PHE PHE A . n 
A 1 107 GLY 107 87  87  GLY GLY A . n 
A 1 108 ASP 108 88  88  ASP ASP A . n 
A 1 109 GLY 109 89  89  GLY GLY A . n 
A 1 110 LYS 110 90  90  LYS LYS A . n 
A 1 111 ILE 111 91  91  ILE ILE A . n 
A 1 112 PHE 112 92  92  PHE PHE A . n 
A 1 113 VAL 113 93  93  VAL VAL A . n 
A 1 114 ILE 114 94  94  ILE ILE A . n 
A 1 115 PRO 115 95  95  PRO PRO A . n 
A 1 116 ILE 116 96  96  ILE ILE A . n 
A 1 117 GLU 117 97  97  GLU GLU A . n 
A 1 118 GLU 118 98  98  GLU GLU A . n 
A 1 119 VAL 119 99  99  VAL VAL A . n 
A 1 120 VAL 120 100 100 VAL VAL A . n 
A 1 121 ARG 121 101 101 ARG ARG A . n 
A 1 122 VAL 122 102 102 VAL VAL A . n 
A 1 123 ARG 123 103 103 ARG ARG A . n 
A 1 124 THR 124 104 104 THR THR A . n 
A 1 125 GLY 125 105 105 GLY GLY A . n 
A 1 126 GLU 126 106 106 GLU GLU A . n 
A 1 127 ARG 127 107 107 ARG ARG A . n 
A 1 128 GLY 128 108 108 GLY GLY A . n 
A 1 129 ASN 129 109 109 ASN ASN A . n 
A 1 130 ASP 130 110 110 ASP ASP A . n 
A 1 131 ALA 131 111 111 ALA ALA A . n 
A 1 132 ILE 132 112 112 ILE ILE A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 DAT 1  201 201 DAT DAT A . 
C 3 CL  1  202 3   CL  CL  A . 
D 3 CL  1  203 4   CL  CL  A . 
E 4 HOH 1  301 32  HOH HOH A . 
E 4 HOH 2  302 3   HOH HOH A . 
E 4 HOH 3  303 7   HOH HOH A . 
E 4 HOH 4  304 15  HOH HOH A . 
E 4 HOH 5  305 4   HOH HOH A . 
E 4 HOH 6  306 23  HOH HOH A . 
E 4 HOH 7  307 24  HOH HOH A . 
E 4 HOH 8  308 27  HOH HOH A . 
E 4 HOH 9  309 26  HOH HOH A . 
E 4 HOH 10 310 11  HOH HOH A . 
E 4 HOH 11 311 20  HOH HOH A . 
E 4 HOH 12 312 28  HOH HOH A . 
E 4 HOH 13 313 22  HOH HOH A . 
E 4 HOH 14 314 6   HOH HOH A . 
E 4 HOH 15 315 1   HOH HOH A . 
E 4 HOH 16 316 29  HOH HOH A . 
E 4 HOH 17 317 14  HOH HOH A . 
E 4 HOH 18 318 35  HOH HOH A . 
E 4 HOH 19 319 30  HOH HOH A . 
E 4 HOH 20 320 33  HOH HOH A . 
E 4 HOH 21 321 36  HOH HOH A . 
E 4 HOH 22 322 12  HOH HOH A . 
E 4 HOH 23 323 38  HOH HOH A . 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? 1.19.2_4158 1 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27        2 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? autoPROC    ? ? ? .           3 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? autoPROC    ? ? ? .           4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? MOLREP      ? ? ? .           5 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     7P4V 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     87.296 
_cell.length_a_esd                 ? 
_cell.length_b                     87.296 
_cell.length_b_esd                 ? 
_cell.length_c                     46.010 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        6 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         7P4V 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                150 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 3 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   7P4V 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.48 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         64.69 
_exptl_crystal.description                 'transparent hexagonal rod' 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;GlnK1 crystallized at a concentration of 33 mg/ml in 25 mM TrisHCl pH 7.6, 10% glycerol, 2mM dithiothreitol and 500mM NaCl .  Drop of 0.6 ul of protein was mixed with 0.6 ul of the crystallization solution in a 96-Well MRC 2-Drop Crystallization Plates in polystyrene (SWISSCI). The reservoir contained 90 ul of the following crystallization solution: 35 % w/v Pentaerythritol propoxylate (17/8 PO/OH), 100 mM MES pH 6.5, 200 mM Ammonium sulfate.
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 2M-F' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2019-12-17 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00003 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SLS BEAMLINE X06DA' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.00003 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X06DA 
_diffrn_source.pdbx_synchrotron_site       SLS 
# 
_reflns.B_iso_Wilson_estimate                          ? 
_reflns.entry_id                                       7P4V 
_reflns.data_reduction_details                         ? 
_reflns.data_reduction_method                          ? 
_reflns.d_resolution_high                              1.94 
_reflns.d_resolution_low                               75.601 
_reflns.details                                        ? 
_reflns.limit_h_max                                    ? 
_reflns.limit_h_min                                    ? 
_reflns.limit_k_max                                    ? 
_reflns.limit_k_min                                    ? 
_reflns.limit_l_max                                    ? 
_reflns.limit_l_min                                    ? 
_reflns.number_all                                     ? 
_reflns.number_obs                                     10108 
_reflns.observed_criterion                             ? 
_reflns.observed_criterion_F_max                       ? 
_reflns.observed_criterion_F_min                       ? 
_reflns.observed_criterion_I_max                       ? 
_reflns.observed_criterion_I_min                       ? 
_reflns.observed_criterion_sigma_F                     ? 
_reflns.observed_criterion_sigma_I                     ? 
_reflns.percent_possible_obs                           89.1 
_reflns.R_free_details                                 ? 
_reflns.Rmerge_F_all                                   ? 
_reflns.Rmerge_F_obs                                   ? 
_reflns.Friedel_coverage                               ? 
_reflns.number_gt                                      ? 
_reflns.threshold_expression                           ? 
_reflns.pdbx_redundancy                                19.3 
_reflns.pdbx_Rmerge_I_obs                              0.053 
_reflns.pdbx_Rmerge_I_all                              ? 
_reflns.pdbx_Rsym_value                                ? 
_reflns.pdbx_netI_over_av_sigmaI                       ? 
_reflns.pdbx_netI_over_sigmaI                          27.3 
_reflns.pdbx_res_netI_over_av_sigmaI_2                 ? 
_reflns.pdbx_res_netI_over_sigmaI_2                    ? 
_reflns.pdbx_chi_squared                               ? 
_reflns.pdbx_scaling_rejects                           ? 
_reflns.pdbx_d_res_high_opt                            ? 
_reflns.pdbx_d_res_low_opt                             ? 
_reflns.pdbx_d_res_opt_method                          ? 
_reflns.phase_calculation_details                      ? 
_reflns.pdbx_Rrim_I_all                                0.055 
_reflns.pdbx_Rpim_I_all                                0.013 
_reflns.pdbx_d_opt                                     ? 
_reflns.pdbx_number_measured_all                       ? 
_reflns.pdbx_diffrn_id                                 1 
_reflns.pdbx_ordinal                                   1 
_reflns.pdbx_CC_half                                   0.999 
_reflns.pdbx_CC_star                                   ? 
_reflns.pdbx_R_split                                   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_1                 ? 
_reflns.pdbx_aniso_diffraction_limit_2                 ? 
_reflns.pdbx_aniso_diffraction_limit_3                 ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_1               ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_2               ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_3               ? 
_reflns.pdbx_orthogonalization_convention              ? 
_reflns.pdbx_percent_possible_ellipsoidal              ? 
_reflns.pdbx_percent_possible_spherical                ? 
_reflns.pdbx_percent_possible_ellipsoidal_anomalous    ? 
_reflns.pdbx_percent_possible_spherical_anomalous      ? 
_reflns.pdbx_redundancy_anomalous                      ? 
_reflns.pdbx_CC_half_anomalous                         ? 
_reflns.pdbx_absDiff_over_sigma_anomalous              ? 
_reflns.pdbx_percent_possible_anomalous                ? 
_reflns.pdbx_observed_signal_threshold                 ? 
_reflns.pdbx_signal_type                               ? 
_reflns.pdbx_signal_details                            ? 
_reflns.pdbx_signal_software_id                        ? 
# 
_reflns_shell.d_res_high                                    1.94 
_reflns_shell.d_res_low                                     2.148 
_reflns_shell.meanI_over_sigI_all                           ? 
_reflns_shell.meanI_over_sigI_obs                           1.8 
_reflns_shell.number_measured_all                           ? 
_reflns_shell.number_measured_obs                           ? 
_reflns_shell.number_possible                               ? 
_reflns_shell.number_unique_all                             ? 
_reflns_shell.number_unique_obs                             502 
_reflns_shell.percent_possible_all                          60.2 
_reflns_shell.percent_possible_obs                          ? 
_reflns_shell.Rmerge_F_all                                  ? 
_reflns_shell.Rmerge_F_obs                                  ? 
_reflns_shell.Rmerge_I_all                                  ? 
_reflns_shell.Rmerge_I_obs                                  1.711 
_reflns_shell.meanI_over_sigI_gt                            ? 
_reflns_shell.meanI_over_uI_all                             ? 
_reflns_shell.meanI_over_uI_gt                              ? 
_reflns_shell.number_measured_gt                            ? 
_reflns_shell.number_unique_gt                              ? 
_reflns_shell.percent_possible_gt                           ? 
_reflns_shell.Rmerge_F_gt                                   ? 
_reflns_shell.Rmerge_I_gt                                   ? 
_reflns_shell.pdbx_redundancy                               18.6 
_reflns_shell.pdbx_Rsym_value                               ? 
_reflns_shell.pdbx_chi_squared                              ? 
_reflns_shell.pdbx_netI_over_sigmaI_all                     ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs                     ? 
_reflns_shell.pdbx_Rrim_I_all                               1.759 
_reflns_shell.pdbx_Rpim_I_all                               0.403 
_reflns_shell.pdbx_rejects                                  ? 
_reflns_shell.pdbx_ordinal                                  1 
_reflns_shell.pdbx_diffrn_id                                1 
_reflns_shell.pdbx_CC_half                                  0.773 
_reflns_shell.pdbx_CC_star                                  ? 
_reflns_shell.pdbx_R_split                                  ? 
_reflns_shell.pdbx_percent_possible_ellipsoidal             ? 
_reflns_shell.pdbx_percent_possible_spherical               ? 
_reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous   ? 
_reflns_shell.pdbx_percent_possible_spherical_anomalous     ? 
_reflns_shell.pdbx_redundancy_anomalous                     ? 
_reflns_shell.pdbx_CC_half_anomalous                        ? 
_reflns_shell.pdbx_absDiff_over_sigma_anomalous             ? 
_reflns_shell.pdbx_percent_possible_anomalous               ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                130.320 
_refine.B_iso_mean                               62.7293 
_refine.B_iso_min                                32.230 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  'The last refinement cycle was performed with hydrogens in riding position' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 7P4V 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.9400 
_refine.ls_d_res_low                             39.3000 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     9995 
_refine.ls_number_reflns_R_free                  492 
_refine.ls_number_reflns_R_work                  9503 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    65.5400 
_refine.ls_percent_reflns_R_free                 4.9200 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1980 
_refine.ls_R_factor_R_free                       0.2257 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1966 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.340 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      2J9D 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 36.7900 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.1900 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         final 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       1.9400 
_refine_hist.d_res_low                        39.3000 
_refine_hist.number_atoms_solvent             23 
_refine_hist.number_atoms_total               933 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       113 
_refine_hist.pdbx_B_iso_mean_ligand           52.82 
_refine_hist.pdbx_B_iso_mean_solvent          55.07 
_refine_hist.pdbx_number_atoms_protein        882 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         28 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_R_complete 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.9400 2.1300  438  . 27  411  12.0000 . . . 0.4037 0.0000 0.3979 . . . . . . . 4 . . . 
'X-RAY DIFFRACTION' 2.1400 2.4400  2183 . 127 2056 58.0000 . . . 0.3194 0.0000 0.3033 . . . . . . . 4 . . . 
'X-RAY DIFFRACTION' 2.4400 3.0800  3656 . 163 3493 96.0000 . . . 0.2989 0.0000 0.2646 . . . . . . . 4 . . . 
'X-RAY DIFFRACTION' 3.0800 39.3000 3718 . 175 3543 95.0000 . . . 0.1973 0.0000 0.1669 . . . . . . . 4 . . . 
# 
_struct.entry_id                     7P4V 
_struct.title                        'GlnK1 from Methanothermococcus thermolithotrophicus with dADP at a resolution of 1.94 A' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        7P4V 
_struct_keywords.text            
;PII-family, Methanococcales, methanogenic archaea, hydrogenotrophs, protein regulation, inhibitor, T-loop, conformational change, dADP, 2-oxoglutarate, nitrogen metabolism, SIGNALING PROTEIN
;
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    PDB 
_struct_ref.db_code                    7P4V 
_struct_ref.pdbx_db_accession          7P4V 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           1 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              7P4V 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 132 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             7P4V 
_struct_ref_seq.db_align_beg                  -19 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  112 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       -19 
_struct_ref_seq.pdbx_auth_seq_align_end       112 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 9440  ? 
1 MORE         -36   ? 
1 'SSA (A^2)'  15470 ? 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000  0.0000000000  0.0000000000 0.0000000000  0.0000000000  1.0000000000 
0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_545 -y,x-y-1,z  -0.5000000000 -0.8660254038 0.0000000000 43.6480000000 0.8660254038  
-0.5000000000 0.0000000000 -75.6005536488 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
3 'crystal symmetry operation' 3_655 -x+y+1,-x,z -0.5000000000 0.8660254038  0.0000000000 87.2960000000 -0.8660254038 
-0.5000000000 0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 ARG A 29  ? GLU A 31  ? ARG A 9   GLU A 11  5 ? 3  
HELX_P HELX_P2 AA2 ARG A 32  ? ALA A 43  ? ARG A 12  ALA A 23  1 ? 12 
HELX_P HELX_P3 AA3 ASP A 89  ? LYS A 102 ? ASP A 69  LYS A 82  1 ? 14 
HELX_P HELX_P4 AA4 ARG A 127 ? ALA A 131 ? ARG A 107 ALA A 111 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 THR A 49  ? GLY A 55  ? THR A 29 GLY A 35 
AA1 2 LEU A 76  ? ASN A 86  ? LEU A 56 ASN A 66 
AA1 3 MET A 21  ? ILE A 28  ? MET A 1  ILE A 8  
AA1 4 LYS A 110 ? ILE A 116 ? LYS A 90 ILE A 96 
AA2 1 ILE A 62  ? TYR A 66  ? ILE A 42 TYR A 46 
AA2 2 ARG A 69  ? VAL A 73  ? ARG A 49 VAL A 53 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N THR A 49 ? N THR A 29 O GLU A 82  ? O GLU A 62 
AA1 2 3 O VAL A 85 ? O VAL A 65 N LYS A 22  ? N LYS A 2  
AA1 3 4 N LYS A 23 ? N LYS A 3  O ILE A 114 ? O ILE A 94 
AA2 1 2 N ILE A 62 ? N ILE A 42 O VAL A 73  ? O VAL A 53 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A CL  202 ? C CL  . 
2 1 A CL  203 ? D CL  . 
3 1 A HOH 323 ? E HOH . 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[1][1]_esd 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][2]_esd 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[1][3]_esd 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[2][2]_esd 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.T[2][3]_esd 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[3][3]_esd 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[1][1]_esd 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][2]_esd 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[1][3]_esd 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[2][2]_esd 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.L[2][3]_esd 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[3][3]_esd 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][1]_esd 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][2]_esd 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[1][3]_esd 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][1]_esd 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][2]_esd 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][3]_esd 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][1]_esd 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][2]_esd 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[3][3]_esd 
1 'X-RAY DIFFRACTION' ? refined 29.2800 -24.8368 8.7805  0.2848 ? 0.0084  ? -0.0243 ? 0.5897 ? -0.0187 ? 0.4214 ? 3.1926 ? 0.7091 
? 0.6236  ? 2.9775 ? 0.2974  ? 4.7612 ? -0.0467 ? 0.0109  ? -0.2138 ? -0.0249 ? -0.1215 ? 0.4778  ? 0.0630  ? -1.0058 ? 0.1030  ? 
2 'X-RAY DIFFRACTION' ? refined 34.8314 -20.9052 11.8148 0.3470 ? 0.0191  ? -0.0135 ? 0.3785 ? 0.0199  ? 0.3117 ? 3.0178 ? 0.5858 
? 0.3300  ? 3.6936 ? 0.2074  ? 4.1599 ? -0.0364 ? 0.1537  ? 0.0799  ? 0.0230  ? -0.0210 ? 0.4285  ? -0.4579 ? -0.6575 ? 0.0593  ? 
3 'X-RAY DIFFRACTION' ? refined 41.4729 -4.8646  29.1679 1.2938 ? 0.1075  ? 0.0591  ? 0.4784 ? 0.0058  ? 0.6113 ? 5.5545 ? 0.0750 
? 5.4829  ? 1.6667 ? -0.3094 ? 5.5014 ? -0.1983 ? -0.1853 ? -0.1059 ? 0.6613  ? -0.0907 ? -0.2137 ? -0.4938 ? -0.0019 ? -0.1513 ? 
4 'X-RAY DIFFRACTION' ? refined 44.7021 -3.7543  26.6157 1.1722 ? 0.0122  ? 0.0406  ? 0.3465 ? -0.0145 ? 0.6009 ? 1.2526 ? 0.9319 
? -0.0622 ? 2.2869 ? 1.8057  ? 6.8426 ? -0.1704 ? -0.3288 ? -0.2717 ? 0.4401  ? 0.0970  ? -0.5268 ? -1.1022 ? 0.2446  ? -0.0249 ? 
5 'X-RAY DIFFRACTION' ? refined 30.4010 -21.1848 4.5921  0.3626 ? 0.0601  ? -0.0944 ? 0.5567 ? -0.0137 ? 0.4129 ? 2.5419 ? 0.2702 
? 0.0259  ? 2.1201 ? -0.7022 ? 4.1582 ? -0.1015 ? 0.2206  ? 0.1473  ? -0.2826 ? 0.0012  ? 0.6813  ? -0.3574 ? -1.1504 ? 0.0892  ? 
6 'X-RAY DIFFRACTION' ? refined 38.2314 -41.5493 -0.5484 0.9255 ? -0.2018 ? -0.0100 ? 0.5556 ? -0.1681 ? 0.5456 ? 3.3919 ? 1.0019 
? -0.1542 ? 6.2308 ? -2.1690 ? 3.2020 ? 0.1177  ? 0.6905  ? -0.4321 ? -0.6240 ? 0.3644  ? 0.4339  ? 1.5184  ? -0.4249 ? 0.0154  ? 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_PDB_ins_code 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_PDB_ins_code 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
1 'X-RAY DIFFRACTION' 1 ? ? A 0  ? ? ? A 22  ? ? 
;chain 'A' and (resid 0 through 22 )
;
2 'X-RAY DIFFRACTION' 2 ? ? A 23 ? ? ? A 41  ? ? 
;chain 'A' and (resid 23 through 41 )
;
3 'X-RAY DIFFRACTION' 3 ? ? A 42 ? ? ? A 46  ? ? 
;chain 'A' and (resid 42 through 46 )
;
4 'X-RAY DIFFRACTION' 4 ? ? A 47 ? ? ? A 55  ? ? 
;chain 'A' and (resid 47 through 55 )
;
5 'X-RAY DIFFRACTION' 5 ? ? A 56 ? ? ? A 96  ? ? 
;chain 'A' and (resid 56 through 96 )
;
6 'X-RAY DIFFRACTION' 6 ? ? A 97 ? ? ? A 112 ? ? 
;chain 'A' and (resid 97 through 112 )
;
# 
_pdbx_entry_details.entry_id                 7P4V 
_pdbx_entry_details.has_ligand_of_interest   Y 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET -19 ? A MET 1  
2  1 Y 1 A GLY -18 ? A GLY 2  
3  1 Y 1 A SER -17 ? A SER 3  
4  1 Y 1 A SER -16 ? A SER 4  
5  1 Y 1 A HIS -15 ? A HIS 5  
6  1 Y 1 A HIS -14 ? A HIS 6  
7  1 Y 1 A HIS -13 ? A HIS 7  
8  1 Y 1 A HIS -12 ? A HIS 8  
9  1 Y 1 A HIS -11 ? A HIS 9  
10 1 Y 1 A HIS -10 ? A HIS 10 
11 1 Y 1 A SER -9  ? A SER 11 
12 1 Y 1 A SER -8  ? A SER 12 
13 1 Y 1 A GLY -7  ? A GLY 13 
14 1 Y 1 A LEU -6  ? A LEU 14 
15 1 Y 1 A VAL -5  ? A VAL 15 
16 1 Y 1 A PRO -4  ? A PRO 16 
17 1 Y 1 A ARG -3  ? A ARG 17 
18 1 Y 1 A GLY -2  ? A GLY 18 
19 1 Y 1 A SER -1  ? A SER 19 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N      N  N N 1   
ALA CA     C  N S 2   
ALA C      C  N N 3   
ALA O      O  N N 4   
ALA CB     C  N N 5   
ALA OXT    O  N N 6   
ALA H      H  N N 7   
ALA H2     H  N N 8   
ALA HA     H  N N 9   
ALA HB1    H  N N 10  
ALA HB2    H  N N 11  
ALA HB3    H  N N 12  
ALA HXT    H  N N 13  
ARG N      N  N N 14  
ARG CA     C  N S 15  
ARG C      C  N N 16  
ARG O      O  N N 17  
ARG CB     C  N N 18  
ARG CG     C  N N 19  
ARG CD     C  N N 20  
ARG NE     N  N N 21  
ARG CZ     C  N N 22  
ARG NH1    N  N N 23  
ARG NH2    N  N N 24  
ARG OXT    O  N N 25  
ARG H      H  N N 26  
ARG H2     H  N N 27  
ARG HA     H  N N 28  
ARG HB2    H  N N 29  
ARG HB3    H  N N 30  
ARG HG2    H  N N 31  
ARG HG3    H  N N 32  
ARG HD2    H  N N 33  
ARG HD3    H  N N 34  
ARG HE     H  N N 35  
ARG HH11   H  N N 36  
ARG HH12   H  N N 37  
ARG HH21   H  N N 38  
ARG HH22   H  N N 39  
ARG HXT    H  N N 40  
ASN N      N  N N 41  
ASN CA     C  N S 42  
ASN C      C  N N 43  
ASN O      O  N N 44  
ASN CB     C  N N 45  
ASN CG     C  N N 46  
ASN OD1    O  N N 47  
ASN ND2    N  N N 48  
ASN OXT    O  N N 49  
ASN H      H  N N 50  
ASN H2     H  N N 51  
ASN HA     H  N N 52  
ASN HB2    H  N N 53  
ASN HB3    H  N N 54  
ASN HD21   H  N N 55  
ASN HD22   H  N N 56  
ASN HXT    H  N N 57  
ASP N      N  N N 58  
ASP CA     C  N S 59  
ASP C      C  N N 60  
ASP O      O  N N 61  
ASP CB     C  N N 62  
ASP CG     C  N N 63  
ASP OD1    O  N N 64  
ASP OD2    O  N N 65  
ASP OXT    O  N N 66  
ASP H      H  N N 67  
ASP H2     H  N N 68  
ASP HA     H  N N 69  
ASP HB2    H  N N 70  
ASP HB3    H  N N 71  
ASP HD2    H  N N 72  
ASP HXT    H  N N 73  
CL  CL     CL N N 74  
CYS N      N  N N 75  
CYS CA     C  N R 76  
CYS C      C  N N 77  
CYS O      O  N N 78  
CYS CB     C  N N 79  
CYS SG     S  N N 80  
CYS OXT    O  N N 81  
CYS H      H  N N 82  
CYS H2     H  N N 83  
CYS HA     H  N N 84  
CYS HB2    H  N N 85  
CYS HB3    H  N N 86  
CYS HG     H  N N 87  
CYS HXT    H  N N 88  
DAT PB     P  N N 89  
DAT O1B    O  N N 90  
DAT O2B    O  N N 91  
DAT O3B    O  N N 92  
DAT PA     P  N S 93  
DAT O1A    O  N N 94  
DAT O2A    O  N N 95  
DAT O3A    O  N N 96  
DAT "O5'"  O  N N 97  
DAT "C5'"  C  N N 98  
DAT "C4'"  C  N R 99  
DAT "O4'"  O  N N 100 
DAT "C3'"  C  N S 101 
DAT "O3'"  O  N N 102 
DAT "C2'"  C  N N 103 
DAT "C1'"  C  N R 104 
DAT N9     N  Y N 105 
DAT C8     C  Y N 106 
DAT N7     N  Y N 107 
DAT C5     C  Y N 108 
DAT C6     C  Y N 109 
DAT N6     N  N N 110 
DAT N1     N  Y N 111 
DAT C2     C  Y N 112 
DAT N3     N  Y N 113 
DAT C4     C  Y N 114 
DAT HOB2   H  N N 115 
DAT HOB3   H  N N 116 
DAT HOA2   H  N N 117 
DAT "H5'1" H  N N 118 
DAT "H5'2" H  N N 119 
DAT "H4'"  H  N N 120 
DAT "H3'"  H  N N 121 
DAT "HO3'" H  N N 122 
DAT "H2'1" H  N N 123 
DAT "H2'2" H  N N 124 
DAT "H1'"  H  N N 125 
DAT H8     H  N N 126 
DAT HN61   H  N N 127 
DAT HN62   H  N N 128 
DAT H2     H  N N 129 
GLN N      N  N N 130 
GLN CA     C  N S 131 
GLN C      C  N N 132 
GLN O      O  N N 133 
GLN CB     C  N N 134 
GLN CG     C  N N 135 
GLN CD     C  N N 136 
GLN OE1    O  N N 137 
GLN NE2    N  N N 138 
GLN OXT    O  N N 139 
GLN H      H  N N 140 
GLN H2     H  N N 141 
GLN HA     H  N N 142 
GLN HB2    H  N N 143 
GLN HB3    H  N N 144 
GLN HG2    H  N N 145 
GLN HG3    H  N N 146 
GLN HE21   H  N N 147 
GLN HE22   H  N N 148 
GLN HXT    H  N N 149 
GLU N      N  N N 150 
GLU CA     C  N S 151 
GLU C      C  N N 152 
GLU O      O  N N 153 
GLU CB     C  N N 154 
GLU CG     C  N N 155 
GLU CD     C  N N 156 
GLU OE1    O  N N 157 
GLU OE2    O  N N 158 
GLU OXT    O  N N 159 
GLU H      H  N N 160 
GLU H2     H  N N 161 
GLU HA     H  N N 162 
GLU HB2    H  N N 163 
GLU HB3    H  N N 164 
GLU HG2    H  N N 165 
GLU HG3    H  N N 166 
GLU HE2    H  N N 167 
GLU HXT    H  N N 168 
GLY N      N  N N 169 
GLY CA     C  N N 170 
GLY C      C  N N 171 
GLY O      O  N N 172 
GLY OXT    O  N N 173 
GLY H      H  N N 174 
GLY H2     H  N N 175 
GLY HA2    H  N N 176 
GLY HA3    H  N N 177 
GLY HXT    H  N N 178 
HIS N      N  N N 179 
HIS CA     C  N S 180 
HIS C      C  N N 181 
HIS O      O  N N 182 
HIS CB     C  N N 183 
HIS CG     C  Y N 184 
HIS ND1    N  Y N 185 
HIS CD2    C  Y N 186 
HIS CE1    C  Y N 187 
HIS NE2    N  Y N 188 
HIS OXT    O  N N 189 
HIS H      H  N N 190 
HIS H2     H  N N 191 
HIS HA     H  N N 192 
HIS HB2    H  N N 193 
HIS HB3    H  N N 194 
HIS HD1    H  N N 195 
HIS HD2    H  N N 196 
HIS HE1    H  N N 197 
HIS HE2    H  N N 198 
HIS HXT    H  N N 199 
HOH O      O  N N 200 
HOH H1     H  N N 201 
HOH H2     H  N N 202 
ILE N      N  N N 203 
ILE CA     C  N S 204 
ILE C      C  N N 205 
ILE O      O  N N 206 
ILE CB     C  N S 207 
ILE CG1    C  N N 208 
ILE CG2    C  N N 209 
ILE CD1    C  N N 210 
ILE OXT    O  N N 211 
ILE H      H  N N 212 
ILE H2     H  N N 213 
ILE HA     H  N N 214 
ILE HB     H  N N 215 
ILE HG12   H  N N 216 
ILE HG13   H  N N 217 
ILE HG21   H  N N 218 
ILE HG22   H  N N 219 
ILE HG23   H  N N 220 
ILE HD11   H  N N 221 
ILE HD12   H  N N 222 
ILE HD13   H  N N 223 
ILE HXT    H  N N 224 
LEU N      N  N N 225 
LEU CA     C  N S 226 
LEU C      C  N N 227 
LEU O      O  N N 228 
LEU CB     C  N N 229 
LEU CG     C  N N 230 
LEU CD1    C  N N 231 
LEU CD2    C  N N 232 
LEU OXT    O  N N 233 
LEU H      H  N N 234 
LEU H2     H  N N 235 
LEU HA     H  N N 236 
LEU HB2    H  N N 237 
LEU HB3    H  N N 238 
LEU HG     H  N N 239 
LEU HD11   H  N N 240 
LEU HD12   H  N N 241 
LEU HD13   H  N N 242 
LEU HD21   H  N N 243 
LEU HD22   H  N N 244 
LEU HD23   H  N N 245 
LEU HXT    H  N N 246 
LYS N      N  N N 247 
LYS CA     C  N S 248 
LYS C      C  N N 249 
LYS O      O  N N 250 
LYS CB     C  N N 251 
LYS CG     C  N N 252 
LYS CD     C  N N 253 
LYS CE     C  N N 254 
LYS NZ     N  N N 255 
LYS OXT    O  N N 256 
LYS H      H  N N 257 
LYS H2     H  N N 258 
LYS HA     H  N N 259 
LYS HB2    H  N N 260 
LYS HB3    H  N N 261 
LYS HG2    H  N N 262 
LYS HG3    H  N N 263 
LYS HD2    H  N N 264 
LYS HD3    H  N N 265 
LYS HE2    H  N N 266 
LYS HE3    H  N N 267 
LYS HZ1    H  N N 268 
LYS HZ2    H  N N 269 
LYS HZ3    H  N N 270 
LYS HXT    H  N N 271 
MET N      N  N N 272 
MET CA     C  N S 273 
MET C      C  N N 274 
MET O      O  N N 275 
MET CB     C  N N 276 
MET CG     C  N N 277 
MET SD     S  N N 278 
MET CE     C  N N 279 
MET OXT    O  N N 280 
MET H      H  N N 281 
MET H2     H  N N 282 
MET HA     H  N N 283 
MET HB2    H  N N 284 
MET HB3    H  N N 285 
MET HG2    H  N N 286 
MET HG3    H  N N 287 
MET HE1    H  N N 288 
MET HE2    H  N N 289 
MET HE3    H  N N 290 
MET HXT    H  N N 291 
PHE N      N  N N 292 
PHE CA     C  N S 293 
PHE C      C  N N 294 
PHE O      O  N N 295 
PHE CB     C  N N 296 
PHE CG     C  Y N 297 
PHE CD1    C  Y N 298 
PHE CD2    C  Y N 299 
PHE CE1    C  Y N 300 
PHE CE2    C  Y N 301 
PHE CZ     C  Y N 302 
PHE OXT    O  N N 303 
PHE H      H  N N 304 
PHE H2     H  N N 305 
PHE HA     H  N N 306 
PHE HB2    H  N N 307 
PHE HB3    H  N N 308 
PHE HD1    H  N N 309 
PHE HD2    H  N N 310 
PHE HE1    H  N N 311 
PHE HE2    H  N N 312 
PHE HZ     H  N N 313 
PHE HXT    H  N N 314 
PRO N      N  N N 315 
PRO CA     C  N S 316 
PRO C      C  N N 317 
PRO O      O  N N 318 
PRO CB     C  N N 319 
PRO CG     C  N N 320 
PRO CD     C  N N 321 
PRO OXT    O  N N 322 
PRO H      H  N N 323 
PRO HA     H  N N 324 
PRO HB2    H  N N 325 
PRO HB3    H  N N 326 
PRO HG2    H  N N 327 
PRO HG3    H  N N 328 
PRO HD2    H  N N 329 
PRO HD3    H  N N 330 
PRO HXT    H  N N 331 
SER N      N  N N 332 
SER CA     C  N S 333 
SER C      C  N N 334 
SER O      O  N N 335 
SER CB     C  N N 336 
SER OG     O  N N 337 
SER OXT    O  N N 338 
SER H      H  N N 339 
SER H2     H  N N 340 
SER HA     H  N N 341 
SER HB2    H  N N 342 
SER HB3    H  N N 343 
SER HG     H  N N 344 
SER HXT    H  N N 345 
THR N      N  N N 346 
THR CA     C  N S 347 
THR C      C  N N 348 
THR O      O  N N 349 
THR CB     C  N R 350 
THR OG1    O  N N 351 
THR CG2    C  N N 352 
THR OXT    O  N N 353 
THR H      H  N N 354 
THR H2     H  N N 355 
THR HA     H  N N 356 
THR HB     H  N N 357 
THR HG1    H  N N 358 
THR HG21   H  N N 359 
THR HG22   H  N N 360 
THR HG23   H  N N 361 
THR HXT    H  N N 362 
TYR N      N  N N 363 
TYR CA     C  N S 364 
TYR C      C  N N 365 
TYR O      O  N N 366 
TYR CB     C  N N 367 
TYR CG     C  Y N 368 
TYR CD1    C  Y N 369 
TYR CD2    C  Y N 370 
TYR CE1    C  Y N 371 
TYR CE2    C  Y N 372 
TYR CZ     C  Y N 373 
TYR OH     O  N N 374 
TYR OXT    O  N N 375 
TYR H      H  N N 376 
TYR H2     H  N N 377 
TYR HA     H  N N 378 
TYR HB2    H  N N 379 
TYR HB3    H  N N 380 
TYR HD1    H  N N 381 
TYR HD2    H  N N 382 
TYR HE1    H  N N 383 
TYR HE2    H  N N 384 
TYR HH     H  N N 385 
TYR HXT    H  N N 386 
VAL N      N  N N 387 
VAL CA     C  N S 388 
VAL C      C  N N 389 
VAL O      O  N N 390 
VAL CB     C  N N 391 
VAL CG1    C  N N 392 
VAL CG2    C  N N 393 
VAL OXT    O  N N 394 
VAL H      H  N N 395 
VAL H2     H  N N 396 
VAL HA     H  N N 397 
VAL HB     H  N N 398 
VAL HG11   H  N N 399 
VAL HG12   H  N N 400 
VAL HG13   H  N N 401 
VAL HG21   H  N N 402 
VAL HG22   H  N N 403 
VAL HG23   H  N N 404 
VAL HXT    H  N N 405 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N     CA     sing N N 1   
ALA N     H      sing N N 2   
ALA N     H2     sing N N 3   
ALA CA    C      sing N N 4   
ALA CA    CB     sing N N 5   
ALA CA    HA     sing N N 6   
ALA C     O      doub N N 7   
ALA C     OXT    sing N N 8   
ALA CB    HB1    sing N N 9   
ALA CB    HB2    sing N N 10  
ALA CB    HB3    sing N N 11  
ALA OXT   HXT    sing N N 12  
ARG N     CA     sing N N 13  
ARG N     H      sing N N 14  
ARG N     H2     sing N N 15  
ARG CA    C      sing N N 16  
ARG CA    CB     sing N N 17  
ARG CA    HA     sing N N 18  
ARG C     O      doub N N 19  
ARG C     OXT    sing N N 20  
ARG CB    CG     sing N N 21  
ARG CB    HB2    sing N N 22  
ARG CB    HB3    sing N N 23  
ARG CG    CD     sing N N 24  
ARG CG    HG2    sing N N 25  
ARG CG    HG3    sing N N 26  
ARG CD    NE     sing N N 27  
ARG CD    HD2    sing N N 28  
ARG CD    HD3    sing N N 29  
ARG NE    CZ     sing N N 30  
ARG NE    HE     sing N N 31  
ARG CZ    NH1    sing N N 32  
ARG CZ    NH2    doub N N 33  
ARG NH1   HH11   sing N N 34  
ARG NH1   HH12   sing N N 35  
ARG NH2   HH21   sing N N 36  
ARG NH2   HH22   sing N N 37  
ARG OXT   HXT    sing N N 38  
ASN N     CA     sing N N 39  
ASN N     H      sing N N 40  
ASN N     H2     sing N N 41  
ASN CA    C      sing N N 42  
ASN CA    CB     sing N N 43  
ASN CA    HA     sing N N 44  
ASN C     O      doub N N 45  
ASN C     OXT    sing N N 46  
ASN CB    CG     sing N N 47  
ASN CB    HB2    sing N N 48  
ASN CB    HB3    sing N N 49  
ASN CG    OD1    doub N N 50  
ASN CG    ND2    sing N N 51  
ASN ND2   HD21   sing N N 52  
ASN ND2   HD22   sing N N 53  
ASN OXT   HXT    sing N N 54  
ASP N     CA     sing N N 55  
ASP N     H      sing N N 56  
ASP N     H2     sing N N 57  
ASP CA    C      sing N N 58  
ASP CA    CB     sing N N 59  
ASP CA    HA     sing N N 60  
ASP C     O      doub N N 61  
ASP C     OXT    sing N N 62  
ASP CB    CG     sing N N 63  
ASP CB    HB2    sing N N 64  
ASP CB    HB3    sing N N 65  
ASP CG    OD1    doub N N 66  
ASP CG    OD2    sing N N 67  
ASP OD2   HD2    sing N N 68  
ASP OXT   HXT    sing N N 69  
CYS N     CA     sing N N 70  
CYS N     H      sing N N 71  
CYS N     H2     sing N N 72  
CYS CA    C      sing N N 73  
CYS CA    CB     sing N N 74  
CYS CA    HA     sing N N 75  
CYS C     O      doub N N 76  
CYS C     OXT    sing N N 77  
CYS CB    SG     sing N N 78  
CYS CB    HB2    sing N N 79  
CYS CB    HB3    sing N N 80  
CYS SG    HG     sing N N 81  
CYS OXT   HXT    sing N N 82  
DAT PB    O1B    doub N N 83  
DAT PB    O2B    sing N N 84  
DAT PB    O3B    sing N N 85  
DAT PB    O3A    sing N N 86  
DAT O2B   HOB2   sing N N 87  
DAT O3B   HOB3   sing N N 88  
DAT PA    O1A    doub N N 89  
DAT PA    O2A    sing N N 90  
DAT PA    O3A    sing N N 91  
DAT PA    "O5'"  sing N N 92  
DAT O2A   HOA2   sing N N 93  
DAT "O5'" "C5'"  sing N N 94  
DAT "C5'" "C4'"  sing N N 95  
DAT "C5'" "H5'1" sing N N 96  
DAT "C5'" "H5'2" sing N N 97  
DAT "C4'" "O4'"  sing N N 98  
DAT "C4'" "C3'"  sing N N 99  
DAT "C4'" "H4'"  sing N N 100 
DAT "O4'" "C1'"  sing N N 101 
DAT "C3'" "O3'"  sing N N 102 
DAT "C3'" "C2'"  sing N N 103 
DAT "C3'" "H3'"  sing N N 104 
DAT "O3'" "HO3'" sing N N 105 
DAT "C2'" "C1'"  sing N N 106 
DAT "C2'" "H2'1" sing N N 107 
DAT "C2'" "H2'2" sing N N 108 
DAT "C1'" N9     sing N N 109 
DAT "C1'" "H1'"  sing N N 110 
DAT N9    C8     sing Y N 111 
DAT N9    C4     sing Y N 112 
DAT C8    N7     doub Y N 113 
DAT C8    H8     sing N N 114 
DAT N7    C5     sing Y N 115 
DAT C5    C6     sing Y N 116 
DAT C5    C4     doub Y N 117 
DAT C6    N6     sing N N 118 
DAT C6    N1     doub Y N 119 
DAT N6    HN61   sing N N 120 
DAT N6    HN62   sing N N 121 
DAT N1    C2     sing Y N 122 
DAT C2    N3     doub Y N 123 
DAT C2    H2     sing N N 124 
DAT N3    C4     sing Y N 125 
GLN N     CA     sing N N 126 
GLN N     H      sing N N 127 
GLN N     H2     sing N N 128 
GLN CA    C      sing N N 129 
GLN CA    CB     sing N N 130 
GLN CA    HA     sing N N 131 
GLN C     O      doub N N 132 
GLN C     OXT    sing N N 133 
GLN CB    CG     sing N N 134 
GLN CB    HB2    sing N N 135 
GLN CB    HB3    sing N N 136 
GLN CG    CD     sing N N 137 
GLN CG    HG2    sing N N 138 
GLN CG    HG3    sing N N 139 
GLN CD    OE1    doub N N 140 
GLN CD    NE2    sing N N 141 
GLN NE2   HE21   sing N N 142 
GLN NE2   HE22   sing N N 143 
GLN OXT   HXT    sing N N 144 
GLU N     CA     sing N N 145 
GLU N     H      sing N N 146 
GLU N     H2     sing N N 147 
GLU CA    C      sing N N 148 
GLU CA    CB     sing N N 149 
GLU CA    HA     sing N N 150 
GLU C     O      doub N N 151 
GLU C     OXT    sing N N 152 
GLU CB    CG     sing N N 153 
GLU CB    HB2    sing N N 154 
GLU CB    HB3    sing N N 155 
GLU CG    CD     sing N N 156 
GLU CG    HG2    sing N N 157 
GLU CG    HG3    sing N N 158 
GLU CD    OE1    doub N N 159 
GLU CD    OE2    sing N N 160 
GLU OE2   HE2    sing N N 161 
GLU OXT   HXT    sing N N 162 
GLY N     CA     sing N N 163 
GLY N     H      sing N N 164 
GLY N     H2     sing N N 165 
GLY CA    C      sing N N 166 
GLY CA    HA2    sing N N 167 
GLY CA    HA3    sing N N 168 
GLY C     O      doub N N 169 
GLY C     OXT    sing N N 170 
GLY OXT   HXT    sing N N 171 
HIS N     CA     sing N N 172 
HIS N     H      sing N N 173 
HIS N     H2     sing N N 174 
HIS CA    C      sing N N 175 
HIS CA    CB     sing N N 176 
HIS CA    HA     sing N N 177 
HIS C     O      doub N N 178 
HIS C     OXT    sing N N 179 
HIS CB    CG     sing N N 180 
HIS CB    HB2    sing N N 181 
HIS CB    HB3    sing N N 182 
HIS CG    ND1    sing Y N 183 
HIS CG    CD2    doub Y N 184 
HIS ND1   CE1    doub Y N 185 
HIS ND1   HD1    sing N N 186 
HIS CD2   NE2    sing Y N 187 
HIS CD2   HD2    sing N N 188 
HIS CE1   NE2    sing Y N 189 
HIS CE1   HE1    sing N N 190 
HIS NE2   HE2    sing N N 191 
HIS OXT   HXT    sing N N 192 
HOH O     H1     sing N N 193 
HOH O     H2     sing N N 194 
ILE N     CA     sing N N 195 
ILE N     H      sing N N 196 
ILE N     H2     sing N N 197 
ILE CA    C      sing N N 198 
ILE CA    CB     sing N N 199 
ILE CA    HA     sing N N 200 
ILE C     O      doub N N 201 
ILE C     OXT    sing N N 202 
ILE CB    CG1    sing N N 203 
ILE CB    CG2    sing N N 204 
ILE CB    HB     sing N N 205 
ILE CG1   CD1    sing N N 206 
ILE CG1   HG12   sing N N 207 
ILE CG1   HG13   sing N N 208 
ILE CG2   HG21   sing N N 209 
ILE CG2   HG22   sing N N 210 
ILE CG2   HG23   sing N N 211 
ILE CD1   HD11   sing N N 212 
ILE CD1   HD12   sing N N 213 
ILE CD1   HD13   sing N N 214 
ILE OXT   HXT    sing N N 215 
LEU N     CA     sing N N 216 
LEU N     H      sing N N 217 
LEU N     H2     sing N N 218 
LEU CA    C      sing N N 219 
LEU CA    CB     sing N N 220 
LEU CA    HA     sing N N 221 
LEU C     O      doub N N 222 
LEU C     OXT    sing N N 223 
LEU CB    CG     sing N N 224 
LEU CB    HB2    sing N N 225 
LEU CB    HB3    sing N N 226 
LEU CG    CD1    sing N N 227 
LEU CG    CD2    sing N N 228 
LEU CG    HG     sing N N 229 
LEU CD1   HD11   sing N N 230 
LEU CD1   HD12   sing N N 231 
LEU CD1   HD13   sing N N 232 
LEU CD2   HD21   sing N N 233 
LEU CD2   HD22   sing N N 234 
LEU CD2   HD23   sing N N 235 
LEU OXT   HXT    sing N N 236 
LYS N     CA     sing N N 237 
LYS N     H      sing N N 238 
LYS N     H2     sing N N 239 
LYS CA    C      sing N N 240 
LYS CA    CB     sing N N 241 
LYS CA    HA     sing N N 242 
LYS C     O      doub N N 243 
LYS C     OXT    sing N N 244 
LYS CB    CG     sing N N 245 
LYS CB    HB2    sing N N 246 
LYS CB    HB3    sing N N 247 
LYS CG    CD     sing N N 248 
LYS CG    HG2    sing N N 249 
LYS CG    HG3    sing N N 250 
LYS CD    CE     sing N N 251 
LYS CD    HD2    sing N N 252 
LYS CD    HD3    sing N N 253 
LYS CE    NZ     sing N N 254 
LYS CE    HE2    sing N N 255 
LYS CE    HE3    sing N N 256 
LYS NZ    HZ1    sing N N 257 
LYS NZ    HZ2    sing N N 258 
LYS NZ    HZ3    sing N N 259 
LYS OXT   HXT    sing N N 260 
MET N     CA     sing N N 261 
MET N     H      sing N N 262 
MET N     H2     sing N N 263 
MET CA    C      sing N N 264 
MET CA    CB     sing N N 265 
MET CA    HA     sing N N 266 
MET C     O      doub N N 267 
MET C     OXT    sing N N 268 
MET CB    CG     sing N N 269 
MET CB    HB2    sing N N 270 
MET CB    HB3    sing N N 271 
MET CG    SD     sing N N 272 
MET CG    HG2    sing N N 273 
MET CG    HG3    sing N N 274 
MET SD    CE     sing N N 275 
MET CE    HE1    sing N N 276 
MET CE    HE2    sing N N 277 
MET CE    HE3    sing N N 278 
MET OXT   HXT    sing N N 279 
PHE N     CA     sing N N 280 
PHE N     H      sing N N 281 
PHE N     H2     sing N N 282 
PHE CA    C      sing N N 283 
PHE CA    CB     sing N N 284 
PHE CA    HA     sing N N 285 
PHE C     O      doub N N 286 
PHE C     OXT    sing N N 287 
PHE CB    CG     sing N N 288 
PHE CB    HB2    sing N N 289 
PHE CB    HB3    sing N N 290 
PHE CG    CD1    doub Y N 291 
PHE CG    CD2    sing Y N 292 
PHE CD1   CE1    sing Y N 293 
PHE CD1   HD1    sing N N 294 
PHE CD2   CE2    doub Y N 295 
PHE CD2   HD2    sing N N 296 
PHE CE1   CZ     doub Y N 297 
PHE CE1   HE1    sing N N 298 
PHE CE2   CZ     sing Y N 299 
PHE CE2   HE2    sing N N 300 
PHE CZ    HZ     sing N N 301 
PHE OXT   HXT    sing N N 302 
PRO N     CA     sing N N 303 
PRO N     CD     sing N N 304 
PRO N     H      sing N N 305 
PRO CA    C      sing N N 306 
PRO CA    CB     sing N N 307 
PRO CA    HA     sing N N 308 
PRO C     O      doub N N 309 
PRO C     OXT    sing N N 310 
PRO CB    CG     sing N N 311 
PRO CB    HB2    sing N N 312 
PRO CB    HB3    sing N N 313 
PRO CG    CD     sing N N 314 
PRO CG    HG2    sing N N 315 
PRO CG    HG3    sing N N 316 
PRO CD    HD2    sing N N 317 
PRO CD    HD3    sing N N 318 
PRO OXT   HXT    sing N N 319 
SER N     CA     sing N N 320 
SER N     H      sing N N 321 
SER N     H2     sing N N 322 
SER CA    C      sing N N 323 
SER CA    CB     sing N N 324 
SER CA    HA     sing N N 325 
SER C     O      doub N N 326 
SER C     OXT    sing N N 327 
SER CB    OG     sing N N 328 
SER CB    HB2    sing N N 329 
SER CB    HB3    sing N N 330 
SER OG    HG     sing N N 331 
SER OXT   HXT    sing N N 332 
THR N     CA     sing N N 333 
THR N     H      sing N N 334 
THR N     H2     sing N N 335 
THR CA    C      sing N N 336 
THR CA    CB     sing N N 337 
THR CA    HA     sing N N 338 
THR C     O      doub N N 339 
THR C     OXT    sing N N 340 
THR CB    OG1    sing N N 341 
THR CB    CG2    sing N N 342 
THR CB    HB     sing N N 343 
THR OG1   HG1    sing N N 344 
THR CG2   HG21   sing N N 345 
THR CG2   HG22   sing N N 346 
THR CG2   HG23   sing N N 347 
THR OXT   HXT    sing N N 348 
TYR N     CA     sing N N 349 
TYR N     H      sing N N 350 
TYR N     H2     sing N N 351 
TYR CA    C      sing N N 352 
TYR CA    CB     sing N N 353 
TYR CA    HA     sing N N 354 
TYR C     O      doub N N 355 
TYR C     OXT    sing N N 356 
TYR CB    CG     sing N N 357 
TYR CB    HB2    sing N N 358 
TYR CB    HB3    sing N N 359 
TYR CG    CD1    doub Y N 360 
TYR CG    CD2    sing Y N 361 
TYR CD1   CE1    sing Y N 362 
TYR CD1   HD1    sing N N 363 
TYR CD2   CE2    doub Y N 364 
TYR CD2   HD2    sing N N 365 
TYR CE1   CZ     doub Y N 366 
TYR CE1   HE1    sing N N 367 
TYR CE2   CZ     sing Y N 368 
TYR CE2   HE2    sing N N 369 
TYR CZ    OH     sing N N 370 
TYR OH    HH     sing N N 371 
TYR OXT   HXT    sing N N 372 
VAL N     CA     sing N N 373 
VAL N     H      sing N N 374 
VAL N     H2     sing N N 375 
VAL CA    C      sing N N 376 
VAL CA    CB     sing N N 377 
VAL CA    HA     sing N N 378 
VAL C     O      doub N N 379 
VAL C     OXT    sing N N 380 
VAL CB    CG1    sing N N 381 
VAL CB    CG2    sing N N 382 
VAL CB    HB     sing N N 383 
VAL CG1   HG11   sing N N 384 
VAL CG1   HG12   sing N N 385 
VAL CG1   HG13   sing N N 386 
VAL CG2   HG21   sing N N 387 
VAL CG2   HG22   sing N N 388 
VAL CG2   HG23   sing N N 389 
VAL OXT   HXT    sing N N 390 
# 
_pdbx_audit_support.funding_organization   'Max Planck Society' 
_pdbx_audit_support.country                Germany 
_pdbx_audit_support.grant_number           ? 
_pdbx_audit_support.ordinal                1 
# 
_pdbx_entity_instance_feature.ordinal        1 
_pdbx_entity_instance_feature.comp_id        DAT 
_pdbx_entity_instance_feature.asym_id        ? 
_pdbx_entity_instance_feature.seq_num        ? 
_pdbx_entity_instance_feature.auth_comp_id   DAT 
_pdbx_entity_instance_feature.auth_asym_id   ? 
_pdbx_entity_instance_feature.auth_seq_num   ? 
_pdbx_entity_instance_feature.feature_type   'SUBJECT OF INVESTIGATION' 
_pdbx_entity_instance_feature.details        ? 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'experimental model' 
_pdbx_initial_refinement_model.source_name      PDB 
_pdbx_initial_refinement_model.accession_code   2J9D 
_pdbx_initial_refinement_model.details          ? 
# 
_atom_sites.entry_id                    7P4V 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.011455 
_atom_sites.fract_transf_matrix[1][2]   0.006614 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013227 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.021734 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
P  
S  
# 
loop_