data_7P8O # _entry.id 7P8O # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.395 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7P8O pdb_00007p8o 10.2210/pdb7p8o/pdb WWPDB D_1292117033 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-08-03 2 'Structure model' 1 1 2024-01-31 3 'Structure model' 2 0 2024-07-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 3 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider author _pdbx_audit_revision_details.type 'Coordinate replacement' _pdbx_audit_revision_details.description 'Atoms with unrealistic or zero occupancies' _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 3 'Structure model' Advisory 2 3 'Structure model' 'Atomic model' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Refinement description' 6 3 'Structure model' 'Source and taxonomy' 7 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' atom_site 2 3 'Structure model' entity_src_gen 3 3 'Structure model' pdbx_contact_author 4 3 'Structure model' pdbx_nonpoly_scheme 5 3 'Structure model' pdbx_struct_assembly 6 3 'Structure model' pdbx_struct_assembly_prop 7 3 'Structure model' pdbx_struct_sheet_hbond 8 3 'Structure model' pdbx_unobs_or_zero_occ_atoms 9 3 'Structure model' pdbx_unobs_or_zero_occ_residues 10 3 'Structure model' pdbx_validate_rmsd_angle 11 3 'Structure model' pdbx_validate_torsion 12 3 'Structure model' refine 13 3 'Structure model' refine_hist 14 3 'Structure model' refine_ls_restr 15 3 'Structure model' refine_ls_shell 16 3 'Structure model' reflns 17 3 'Structure model' reflns_shell 18 3 'Structure model' struct_conn 19 3 'Structure model' struct_sheet_range # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_entity_src_gen.pdbx_gene_src_scientific_name' 2 3 'Structure model' '_pdbx_nonpoly_scheme.auth_seq_num' 3 3 'Structure model' '_pdbx_struct_assembly.details' 4 3 'Structure model' '_pdbx_struct_assembly.method_details' 5 3 'Structure model' '_pdbx_struct_assembly_prop.value' 6 3 'Structure model' '_pdbx_struct_sheet_hbond.range_1_auth_comp_id' 7 3 'Structure model' '_pdbx_struct_sheet_hbond.range_1_auth_seq_id' 8 3 'Structure model' '_pdbx_struct_sheet_hbond.range_1_label_comp_id' 9 3 'Structure model' '_pdbx_struct_sheet_hbond.range_1_label_seq_id' 10 3 'Structure model' '_pdbx_struct_sheet_hbond.range_2_auth_comp_id' 11 3 'Structure model' '_pdbx_struct_sheet_hbond.range_2_auth_seq_id' 12 3 'Structure model' '_pdbx_struct_sheet_hbond.range_2_label_comp_id' 13 3 'Structure model' '_pdbx_struct_sheet_hbond.range_2_label_seq_id' 14 3 'Structure model' '_refine.B_iso_max' 15 3 'Structure model' '_refine.B_iso_mean' 16 3 'Structure model' '_refine.B_iso_min' 17 3 'Structure model' '_refine.aniso_B[1][3]' 18 3 'Structure model' '_refine.aniso_B[2][2]' 19 3 'Structure model' '_refine.correlation_coeff_Fo_to_Fc' 20 3 'Structure model' '_refine.correlation_coeff_Fo_to_Fc_free' 21 3 'Structure model' '_refine.details' 22 3 'Structure model' '_refine.ls_R_factor_R_free' 23 3 'Structure model' '_refine.ls_R_factor_R_work' 24 3 'Structure model' '_refine.ls_R_factor_obs' 25 3 'Structure model' '_refine.ls_wR_factor_R_free' 26 3 'Structure model' '_refine.ls_wR_factor_R_work' 27 3 'Structure model' '_refine.overall_FOM_work_R_set' 28 3 'Structure model' '_refine.overall_SU_B' 29 3 'Structure model' '_refine.overall_SU_ML' 30 3 'Structure model' '_refine.overall_SU_R_Cruickshank_DPI' 31 3 'Structure model' '_refine.overall_SU_R_free' 32 3 'Structure model' '_refine.pdbx_ls_sigma_F' 33 3 'Structure model' '_refine.pdbx_overall_ESU_R' 34 3 'Structure model' '_refine.pdbx_overall_ESU_R_Free' 35 3 'Structure model' '_refine_hist.cycle_id' 36 3 'Structure model' '_refine_hist.number_atoms_total' 37 3 'Structure model' '_refine_hist.pdbx_B_iso_mean_ligand' 38 3 'Structure model' '_refine_hist.pdbx_B_iso_mean_solvent' 39 3 'Structure model' '_refine_hist.pdbx_number_atoms_protein' 40 3 'Structure model' '_refine_hist.pdbx_number_residues_total' 41 3 'Structure model' '_refine_ls_shell.R_factor_R_free' 42 3 'Structure model' '_refine_ls_shell.R_factor_R_free_error' 43 3 'Structure model' '_refine_ls_shell.R_factor_R_work' 44 3 'Structure model' '_refine_ls_shell.number_reflns_all' 45 3 'Structure model' '_reflns.pdbx_chi_squared' 46 3 'Structure model' '_reflns.pdbx_scaling_rejects' 47 3 'Structure model' '_struct_conn.pdbx_dist_value' 48 3 'Structure model' '_struct_sheet_range.beg_auth_comp_id' 49 3 'Structure model' '_struct_sheet_range.beg_auth_seq_id' 50 3 'Structure model' '_struct_sheet_range.beg_label_comp_id' 51 3 'Structure model' '_struct_sheet_range.beg_label_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7P8O _pdbx_database_status.recvd_initial_deposition_date 2021-07-23 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 3 _pdbx_contact_author.email boiko_konstantin@inbi.ras.ru _pdbx_contact_author.name_first Konstantin _pdbx_contact_author.name_last Boyko _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-8229-189X # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Matyuta, I.O.' 1 0000-0002-6297-8392 'Boyko, K.M.' 2 0000-0001-8229-189X 'Bakunova, A.K.' 3 ? 'Nikolaeva, A.Y.' 4 ? 'Rakitina, T.V.' 5 ? 'Bezsudnova, E.Y.' 6 0000-0003-2443-7082 'Popov, V.O.' 7 0000-0002-0133-7962 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of D-aminoacid transaminase from Haliscomenobacter hydrossis in its apo form' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Matyuta, I.O.' 1 0000-0002-6297-8392 primary 'Boyko, K.M.' 2 0000-0001-8229-189X primary 'Bakunova, A.K.' 3 ? primary 'Nikolaeva, A.Y.' 4 ? primary 'Rakitina, T.V.' 5 ? primary 'Bezsudnova, E.Y.' 6 0000-0003-2443-7082 primary 'Popov, V.O.' 7 0000-0002-0133-7962 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Aminotransferase class IV' 32321.799 1 ? ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 3 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 4 water nat water 18.015 84 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GHMIKYYNINGQQVPVENATLHVSDLSILRGYGIFDYFLAREGHPLFLDDYLNRFYRSAAELYLEIPFDKAELRRQIYAL LQANEVREAGIRLVLTGGYSPDGYTPVNPNLLIMMYDLPASAWEFSAQGIKIITHPFQRELPEVKTINYSTGIRMLKTIK ERGATDLIYVDQGEWIRESARSNFFLVMPDNTIVTADEKILWGITRRQVIDAAREAGYAVEERRIHITELDQAREAFFTS TIKGVMAIGQIDDRVFGDGTIGKVTQELQDLFVGKVKAYLETC ; _entity_poly.pdbx_seq_one_letter_code_can ;GHMIKYYNINGQQVPVENATLHVSDLSILRGYGIFDYFLAREGHPLFLDDYLNRFYRSAAELYLEIPFDKAELRRQIYAL LQANEVREAGIRLVLTGGYSPDGYTPVNPNLLIMMYDLPASAWEFSAQGIKIITHPFQRELPEVKTINYSTGIRMLKTIK ERGATDLIYVDQGEWIRESARSNFFLVMPDNTIVTADEKILWGITRRQVIDAAREAGYAVEERRIHITELDQAREAFFTS TIKGVMAIGQIDDRVFGDGTIGKVTQELQDLFVGKVKAYLETC ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 'MAGNESIUM ION' MG 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 HIS n 1 3 MET n 1 4 ILE n 1 5 LYS n 1 6 TYR n 1 7 TYR n 1 8 ASN n 1 9 ILE n 1 10 ASN n 1 11 GLY n 1 12 GLN n 1 13 GLN n 1 14 VAL n 1 15 PRO n 1 16 VAL n 1 17 GLU n 1 18 ASN n 1 19 ALA n 1 20 THR n 1 21 LEU n 1 22 HIS n 1 23 VAL n 1 24 SER n 1 25 ASP n 1 26 LEU n 1 27 SER n 1 28 ILE n 1 29 LEU n 1 30 ARG n 1 31 GLY n 1 32 TYR n 1 33 GLY n 1 34 ILE n 1 35 PHE n 1 36 ASP n 1 37 TYR n 1 38 PHE n 1 39 LEU n 1 40 ALA n 1 41 ARG n 1 42 GLU n 1 43 GLY n 1 44 HIS n 1 45 PRO n 1 46 LEU n 1 47 PHE n 1 48 LEU n 1 49 ASP n 1 50 ASP n 1 51 TYR n 1 52 LEU n 1 53 ASN n 1 54 ARG n 1 55 PHE n 1 56 TYR n 1 57 ARG n 1 58 SER n 1 59 ALA n 1 60 ALA n 1 61 GLU n 1 62 LEU n 1 63 TYR n 1 64 LEU n 1 65 GLU n 1 66 ILE n 1 67 PRO n 1 68 PHE n 1 69 ASP n 1 70 LYS n 1 71 ALA n 1 72 GLU n 1 73 LEU n 1 74 ARG n 1 75 ARG n 1 76 GLN n 1 77 ILE n 1 78 TYR n 1 79 ALA n 1 80 LEU n 1 81 LEU n 1 82 GLN n 1 83 ALA n 1 84 ASN n 1 85 GLU n 1 86 VAL n 1 87 ARG n 1 88 GLU n 1 89 ALA n 1 90 GLY n 1 91 ILE n 1 92 ARG n 1 93 LEU n 1 94 VAL n 1 95 LEU n 1 96 THR n 1 97 GLY n 1 98 GLY n 1 99 TYR n 1 100 SER n 1 101 PRO n 1 102 ASP n 1 103 GLY n 1 104 TYR n 1 105 THR n 1 106 PRO n 1 107 VAL n 1 108 ASN n 1 109 PRO n 1 110 ASN n 1 111 LEU n 1 112 LEU n 1 113 ILE n 1 114 MET n 1 115 MET n 1 116 TYR n 1 117 ASP n 1 118 LEU n 1 119 PRO n 1 120 ALA n 1 121 SER n 1 122 ALA n 1 123 TRP n 1 124 GLU n 1 125 PHE n 1 126 SER n 1 127 ALA n 1 128 GLN n 1 129 GLY n 1 130 ILE n 1 131 LYS n 1 132 ILE n 1 133 ILE n 1 134 THR n 1 135 HIS n 1 136 PRO n 1 137 PHE n 1 138 GLN n 1 139 ARG n 1 140 GLU n 1 141 LEU n 1 142 PRO n 1 143 GLU n 1 144 VAL n 1 145 LYS n 1 146 THR n 1 147 ILE n 1 148 ASN n 1 149 TYR n 1 150 SER n 1 151 THR n 1 152 GLY n 1 153 ILE n 1 154 ARG n 1 155 MET n 1 156 LEU n 1 157 LYS n 1 158 THR n 1 159 ILE n 1 160 LYS n 1 161 GLU n 1 162 ARG n 1 163 GLY n 1 164 ALA n 1 165 THR n 1 166 ASP n 1 167 LEU n 1 168 ILE n 1 169 TYR n 1 170 VAL n 1 171 ASP n 1 172 GLN n 1 173 GLY n 1 174 GLU n 1 175 TRP n 1 176 ILE n 1 177 ARG n 1 178 GLU n 1 179 SER n 1 180 ALA n 1 181 ARG n 1 182 SER n 1 183 ASN n 1 184 PHE n 1 185 PHE n 1 186 LEU n 1 187 VAL n 1 188 MET n 1 189 PRO n 1 190 ASP n 1 191 ASN n 1 192 THR n 1 193 ILE n 1 194 VAL n 1 195 THR n 1 196 ALA n 1 197 ASP n 1 198 GLU n 1 199 LYS n 1 200 ILE n 1 201 LEU n 1 202 TRP n 1 203 GLY n 1 204 ILE n 1 205 THR n 1 206 ARG n 1 207 ARG n 1 208 GLN n 1 209 VAL n 1 210 ILE n 1 211 ASP n 1 212 ALA n 1 213 ALA n 1 214 ARG n 1 215 GLU n 1 216 ALA n 1 217 GLY n 1 218 TYR n 1 219 ALA n 1 220 VAL n 1 221 GLU n 1 222 GLU n 1 223 ARG n 1 224 ARG n 1 225 ILE n 1 226 HIS n 1 227 ILE n 1 228 THR n 1 229 GLU n 1 230 LEU n 1 231 ASP n 1 232 GLN n 1 233 ALA n 1 234 ARG n 1 235 GLU n 1 236 ALA n 1 237 PHE n 1 238 PHE n 1 239 THR n 1 240 SER n 1 241 THR n 1 242 ILE n 1 243 LYS n 1 244 GLY n 1 245 VAL n 1 246 MET n 1 247 ALA n 1 248 ILE n 1 249 GLY n 1 250 GLN n 1 251 ILE n 1 252 ASP n 1 253 ASP n 1 254 ARG n 1 255 VAL n 1 256 PHE n 1 257 GLY n 1 258 ASP n 1 259 GLY n 1 260 THR n 1 261 ILE n 1 262 GLY n 1 263 LYS n 1 264 VAL n 1 265 THR n 1 266 GLN n 1 267 GLU n 1 268 LEU n 1 269 GLN n 1 270 ASP n 1 271 LEU n 1 272 PHE n 1 273 VAL n 1 274 GLY n 1 275 LYS n 1 276 VAL n 1 277 LYS n 1 278 ALA n 1 279 TYR n 1 280 LEU n 1 281 GLU n 1 282 THR n 1 283 CYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 283 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Halhy_2446 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 27775 / DSM 1100 / LMG 10767 / O' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Haliscomenobacter hydrossis DSM 1100' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 760192 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -1 ? ? ? A . n A 1 2 HIS 2 0 0 HIS HIS A . n A 1 3 MET 3 1 1 MET MET A . n A 1 4 ILE 4 2 2 ILE ILE A . n A 1 5 LYS 5 3 3 LYS LYS A . n A 1 6 TYR 6 4 4 TYR TYR A . n A 1 7 TYR 7 5 5 TYR TYR A . n A 1 8 ASN 8 6 6 ASN ASN A . n A 1 9 ILE 9 7 7 ILE ILE A . n A 1 10 ASN 10 8 8 ASN ASN A . n A 1 11 GLY 11 9 9 GLY GLY A . n A 1 12 GLN 12 10 10 GLN GLN A . n A 1 13 GLN 13 11 11 GLN GLN A . n A 1 14 VAL 14 12 12 VAL VAL A . n A 1 15 PRO 15 13 13 PRO PRO A . n A 1 16 VAL 16 14 14 VAL VAL A . n A 1 17 GLU 17 15 15 GLU GLU A . n A 1 18 ASN 18 16 16 ASN ASN A . n A 1 19 ALA 19 17 17 ALA ALA A . n A 1 20 THR 20 18 18 THR THR A . n A 1 21 LEU 21 19 19 LEU LEU A . n A 1 22 HIS 22 20 20 HIS HIS A . n A 1 23 VAL 23 21 21 VAL VAL A . n A 1 24 SER 24 22 22 SER SER A . n A 1 25 ASP 25 23 23 ASP ASP A . n A 1 26 LEU 26 24 24 LEU LEU A . n A 1 27 SER 27 25 25 SER SER A . n A 1 28 ILE 28 26 26 ILE ILE A . n A 1 29 LEU 29 27 27 LEU LEU A . n A 1 30 ARG 30 28 28 ARG ARG A . n A 1 31 GLY 31 29 29 GLY GLY A . n A 1 32 TYR 32 30 30 TYR TYR A . n A 1 33 GLY 33 31 31 GLY GLY A . n A 1 34 ILE 34 32 32 ILE ILE A . n A 1 35 PHE 35 33 33 PHE PHE A . n A 1 36 ASP 36 34 34 ASP ASP A . n A 1 37 TYR 37 35 35 TYR TYR A . n A 1 38 PHE 38 36 36 PHE PHE A . n A 1 39 LEU 39 37 37 LEU LEU A . n A 1 40 ALA 40 38 38 ALA ALA A . n A 1 41 ARG 41 39 39 ARG ARG A . n A 1 42 GLU 42 40 40 GLU GLU A . n A 1 43 GLY 43 41 41 GLY GLY A . n A 1 44 HIS 44 42 42 HIS HIS A . n A 1 45 PRO 45 43 43 PRO PRO A . n A 1 46 LEU 46 44 44 LEU LEU A . n A 1 47 PHE 47 45 45 PHE PHE A . n A 1 48 LEU 48 46 46 LEU LEU A . n A 1 49 ASP 49 47 47 ASP ASP A . n A 1 50 ASP 50 48 48 ASP ASP A . n A 1 51 TYR 51 49 49 TYR TYR A . n A 1 52 LEU 52 50 50 LEU LEU A . n A 1 53 ASN 53 51 51 ASN ASN A . n A 1 54 ARG 54 52 52 ARG ARG A . n A 1 55 PHE 55 53 53 PHE PHE A . n A 1 56 TYR 56 54 54 TYR TYR A . n A 1 57 ARG 57 55 55 ARG ARG A . n A 1 58 SER 58 56 56 SER SER A . n A 1 59 ALA 59 57 57 ALA ALA A . n A 1 60 ALA 60 58 58 ALA ALA A . n A 1 61 GLU 61 59 59 GLU GLU A . n A 1 62 LEU 62 60 60 LEU LEU A . n A 1 63 TYR 63 61 61 TYR TYR A . n A 1 64 LEU 64 62 62 LEU LEU A . n A 1 65 GLU 65 63 63 GLU GLU A . n A 1 66 ILE 66 64 64 ILE ILE A . n A 1 67 PRO 67 65 65 PRO PRO A . n A 1 68 PHE 68 66 66 PHE PHE A . n A 1 69 ASP 69 67 67 ASP ASP A . n A 1 70 LYS 70 68 68 LYS LYS A . n A 1 71 ALA 71 69 69 ALA ALA A . n A 1 72 GLU 72 70 70 GLU GLU A . n A 1 73 LEU 73 71 71 LEU LEU A . n A 1 74 ARG 74 72 72 ARG ARG A . n A 1 75 ARG 75 73 73 ARG ARG A . n A 1 76 GLN 76 74 74 GLN GLN A . n A 1 77 ILE 77 75 75 ILE ILE A . n A 1 78 TYR 78 76 76 TYR TYR A . n A 1 79 ALA 79 77 77 ALA ALA A . n A 1 80 LEU 80 78 78 LEU LEU A . n A 1 81 LEU 81 79 79 LEU LEU A . n A 1 82 GLN 82 80 80 GLN GLN A . n A 1 83 ALA 83 81 81 ALA ALA A . n A 1 84 ASN 84 82 82 ASN ASN A . n A 1 85 GLU 85 83 83 GLU GLU A . n A 1 86 VAL 86 84 84 VAL VAL A . n A 1 87 ARG 87 85 85 ARG ARG A . n A 1 88 GLU 88 86 86 GLU GLU A . n A 1 89 ALA 89 87 87 ALA ALA A . n A 1 90 GLY 90 88 88 GLY GLY A . n A 1 91 ILE 91 89 89 ILE ILE A . n A 1 92 ARG 92 90 90 ARG ARG A . n A 1 93 LEU 93 91 91 LEU LEU A . n A 1 94 VAL 94 92 92 VAL VAL A . n A 1 95 LEU 95 93 93 LEU LEU A . n A 1 96 THR 96 94 94 THR THR A . n A 1 97 GLY 97 95 95 GLY GLY A . n A 1 98 GLY 98 96 96 GLY GLY A . n A 1 99 TYR 99 97 97 TYR TYR A . n A 1 100 SER 100 98 98 SER SER A . n A 1 101 PRO 101 99 99 PRO PRO A . n A 1 102 ASP 102 100 100 ASP ASP A . n A 1 103 GLY 103 101 101 GLY GLY A . n A 1 104 TYR 104 102 102 TYR TYR A . n A 1 105 THR 105 103 103 THR THR A . n A 1 106 PRO 106 104 104 PRO PRO A . n A 1 107 VAL 107 105 105 VAL VAL A . n A 1 108 ASN 108 106 106 ASN ASN A . n A 1 109 PRO 109 107 107 PRO PRO A . n A 1 110 ASN 110 108 108 ASN ASN A . n A 1 111 LEU 111 109 109 LEU LEU A . n A 1 112 LEU 112 110 110 LEU LEU A . n A 1 113 ILE 113 111 111 ILE ILE A . n A 1 114 MET 114 112 112 MET MET A . n A 1 115 MET 115 113 113 MET MET A . n A 1 116 TYR 116 114 114 TYR TYR A . n A 1 117 ASP 117 115 115 ASP ASP A . n A 1 118 LEU 118 116 116 LEU LEU A . n A 1 119 PRO 119 117 117 PRO PRO A . n A 1 120 ALA 120 118 118 ALA ALA A . n A 1 121 SER 121 119 119 SER SER A . n A 1 122 ALA 122 120 120 ALA ALA A . n A 1 123 TRP 123 121 121 TRP TRP A . n A 1 124 GLU 124 122 122 GLU GLU A . n A 1 125 PHE 125 123 123 PHE PHE A . n A 1 126 SER 126 124 124 SER SER A . n A 1 127 ALA 127 125 125 ALA ALA A . n A 1 128 GLN 128 126 126 GLN GLN A . n A 1 129 GLY 129 127 127 GLY GLY A . n A 1 130 ILE 130 128 128 ILE ILE A . n A 1 131 LYS 131 129 129 LYS LYS A . n A 1 132 ILE 132 130 130 ILE ILE A . n A 1 133 ILE 133 131 131 ILE ILE A . n A 1 134 THR 134 132 132 THR THR A . n A 1 135 HIS 135 133 133 HIS HIS A . n A 1 136 PRO 136 134 134 PRO PRO A . n A 1 137 PHE 137 135 135 PHE PHE A . n A 1 138 GLN 138 136 136 GLN GLN A . n A 1 139 ARG 139 137 ? ? ? A . n A 1 140 GLU 140 138 ? ? ? A . n A 1 141 LEU 141 139 139 LEU LEU A . n A 1 142 PRO 142 140 140 PRO PRO A . n A 1 143 GLU 143 141 141 GLU GLU A . n A 1 144 VAL 144 142 142 VAL VAL A . n A 1 145 LYS 145 143 143 LYS LYS A . n A 1 146 THR 146 144 144 THR THR A . n A 1 147 ILE 147 145 145 ILE ILE A . n A 1 148 ASN 148 146 146 ASN ASN A . n A 1 149 TYR 149 147 147 TYR TYR A . n A 1 150 SER 150 148 ? ? ? A . n A 1 151 THR 151 149 ? ? ? A . n A 1 152 GLY 152 150 ? ? ? A . n A 1 153 ILE 153 151 ? ? ? A . n A 1 154 ARG 154 152 ? ? ? A . n A 1 155 MET 155 153 153 MET MET A . n A 1 156 LEU 156 154 154 LEU LEU A . n A 1 157 LYS 157 155 155 LYS LYS A . n A 1 158 THR 158 156 156 THR THR A . n A 1 159 ILE 159 157 157 ILE ILE A . n A 1 160 LYS 160 158 158 LYS LYS A . n A 1 161 GLU 161 159 159 GLU GLU A . n A 1 162 ARG 162 160 160 ARG ARG A . n A 1 163 GLY 163 161 161 GLY GLY A . n A 1 164 ALA 164 162 162 ALA ALA A . n A 1 165 THR 165 163 163 THR THR A . n A 1 166 ASP 166 164 164 ASP ASP A . n A 1 167 LEU 167 165 165 LEU LEU A . n A 1 168 ILE 168 166 166 ILE ILE A . n A 1 169 TYR 169 167 167 TYR TYR A . n A 1 170 VAL 170 168 168 VAL VAL A . n A 1 171 ASP 171 169 169 ASP ASP A . n A 1 172 GLN 172 170 170 GLN GLN A . n A 1 173 GLY 173 171 171 GLY GLY A . n A 1 174 GLU 174 172 172 GLU GLU A . n A 1 175 TRP 175 173 173 TRP TRP A . n A 1 176 ILE 176 174 174 ILE ILE A . n A 1 177 ARG 177 175 175 ARG ARG A . n A 1 178 GLU 178 176 176 GLU GLU A . n A 1 179 SER 179 177 177 SER SER A . n A 1 180 ALA 180 178 178 ALA ALA A . n A 1 181 ARG 181 179 179 ARG ARG A . n A 1 182 SER 182 180 180 SER SER A . n A 1 183 ASN 183 181 181 ASN ASN A . n A 1 184 PHE 184 182 182 PHE PHE A . n A 1 185 PHE 185 183 183 PHE PHE A . n A 1 186 LEU 186 184 184 LEU LEU A . n A 1 187 VAL 187 185 185 VAL VAL A . n A 1 188 MET 188 186 186 MET MET A . n A 1 189 PRO 189 187 187 PRO PRO A . n A 1 190 ASP 190 188 188 ASP ASP A . n A 1 191 ASN 191 189 189 ASN ASN A . n A 1 192 THR 192 190 190 THR THR A . n A 1 193 ILE 193 191 191 ILE ILE A . n A 1 194 VAL 194 192 192 VAL VAL A . n A 1 195 THR 195 193 193 THR THR A . n A 1 196 ALA 196 194 194 ALA ALA A . n A 1 197 ASP 197 195 195 ASP ASP A . n A 1 198 GLU 198 196 196 GLU GLU A . n A 1 199 LYS 199 197 197 LYS LYS A . n A 1 200 ILE 200 198 198 ILE ILE A . n A 1 201 LEU 201 199 199 LEU LEU A . n A 1 202 TRP 202 200 200 TRP TRP A . n A 1 203 GLY 203 201 201 GLY GLY A . n A 1 204 ILE 204 202 202 ILE ILE A . n A 1 205 THR 205 203 203 THR THR A . n A 1 206 ARG 206 204 204 ARG ARG A . n A 1 207 ARG 207 205 205 ARG ARG A . n A 1 208 GLN 208 206 206 GLN GLN A . n A 1 209 VAL 209 207 207 VAL VAL A . n A 1 210 ILE 210 208 208 ILE ILE A . n A 1 211 ASP 211 209 209 ASP ASP A . n A 1 212 ALA 212 210 210 ALA ALA A . n A 1 213 ALA 213 211 211 ALA ALA A . n A 1 214 ARG 214 212 212 ARG ARG A . n A 1 215 GLU 215 213 213 GLU GLU A . n A 1 216 ALA 216 214 214 ALA ALA A . n A 1 217 GLY 217 215 215 GLY GLY A . n A 1 218 TYR 218 216 216 TYR TYR A . n A 1 219 ALA 219 217 217 ALA ALA A . n A 1 220 VAL 220 218 218 VAL VAL A . n A 1 221 GLU 221 219 219 GLU GLU A . n A 1 222 GLU 222 220 220 GLU GLU A . n A 1 223 ARG 223 221 221 ARG ARG A . n A 1 224 ARG 224 222 222 ARG ARG A . n A 1 225 ILE 225 223 223 ILE ILE A . n A 1 226 HIS 226 224 224 HIS HIS A . n A 1 227 ILE 227 225 225 ILE ILE A . n A 1 228 THR 228 226 226 THR THR A . n A 1 229 GLU 229 227 227 GLU GLU A . n A 1 230 LEU 230 228 228 LEU LEU A . n A 1 231 ASP 231 229 229 ASP ASP A . n A 1 232 GLN 232 230 230 GLN GLN A . n A 1 233 ALA 233 231 231 ALA ALA A . n A 1 234 ARG 234 232 232 ARG ARG A . n A 1 235 GLU 235 233 233 GLU GLU A . n A 1 236 ALA 236 234 234 ALA ALA A . n A 1 237 PHE 237 235 235 PHE PHE A . n A 1 238 PHE 238 236 236 PHE PHE A . n A 1 239 THR 239 237 237 THR THR A . n A 1 240 SER 240 238 238 SER SER A . n A 1 241 THR 241 239 239 THR THR A . n A 1 242 ILE 242 240 240 ILE ILE A . n A 1 243 LYS 243 241 241 LYS LYS A . n A 1 244 GLY 244 242 242 GLY GLY A . n A 1 245 VAL 245 243 243 VAL VAL A . n A 1 246 MET 246 244 244 MET MET A . n A 1 247 ALA 247 245 245 ALA ALA A . n A 1 248 ILE 248 246 246 ILE ILE A . n A 1 249 GLY 249 247 247 GLY GLY A . n A 1 250 GLN 250 248 248 GLN GLN A . n A 1 251 ILE 251 249 249 ILE ILE A . n A 1 252 ASP 252 250 250 ASP ASP A . n A 1 253 ASP 253 251 251 ASP ASP A . n A 1 254 ARG 254 252 252 ARG ARG A . n A 1 255 VAL 255 253 253 VAL VAL A . n A 1 256 PHE 256 254 254 PHE PHE A . n A 1 257 GLY 257 255 255 GLY GLY A . n A 1 258 ASP 258 256 256 ASP ASP A . n A 1 259 GLY 259 257 257 GLY GLY A . n A 1 260 THR 260 258 258 THR THR A . n A 1 261 ILE 261 259 259 ILE ILE A . n A 1 262 GLY 262 260 260 GLY GLY A . n A 1 263 LYS 263 261 261 LYS LYS A . n A 1 264 VAL 264 262 262 VAL VAL A . n A 1 265 THR 265 263 263 THR THR A . n A 1 266 GLN 266 264 264 GLN GLN A . n A 1 267 GLU 267 265 265 GLU GLU A . n A 1 268 LEU 268 266 266 LEU LEU A . n A 1 269 GLN 269 267 267 GLN GLN A . n A 1 270 ASP 270 268 268 ASP ASP A . n A 1 271 LEU 271 269 269 LEU LEU A . n A 1 272 PHE 272 270 270 PHE PHE A . n A 1 273 VAL 273 271 271 VAL VAL A . n A 1 274 GLY 274 272 272 GLY GLY A . n A 1 275 LYS 275 273 273 LYS LYS A . n A 1 276 VAL 276 274 274 VAL VAL A . n A 1 277 LYS 277 275 275 LYS LYS A . n A 1 278 ALA 278 276 276 ALA ALA A . n A 1 279 TYR 279 277 277 TYR TYR A . n A 1 280 LEU 280 278 278 LEU LEU A . n A 1 281 GLU 281 279 279 GLU GLU A . n A 1 282 THR 282 280 280 THR THR A . n A 1 283 CYS 283 281 281 CYS CYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 301 383 SO4 SO4 A . C 3 MG 1 302 1 MG MG A . D 4 HOH 1 401 93 HOH HOH A . D 4 HOH 2 402 51 HOH HOH A . D 4 HOH 3 403 84 HOH HOH A . D 4 HOH 4 404 73 HOH HOH A . D 4 HOH 5 405 50 HOH HOH A . D 4 HOH 6 406 39 HOH HOH A . D 4 HOH 7 407 86 HOH HOH A . D 4 HOH 8 408 2 HOH HOH A . D 4 HOH 9 409 54 HOH HOH A . D 4 HOH 10 410 71 HOH HOH A . D 4 HOH 11 411 66 HOH HOH A . D 4 HOH 12 412 34 HOH HOH A . D 4 HOH 13 413 65 HOH HOH A . D 4 HOH 14 414 22 HOH HOH A . D 4 HOH 15 415 89 HOH HOH A . D 4 HOH 16 416 32 HOH HOH A . D 4 HOH 17 417 60 HOH HOH A . D 4 HOH 18 418 44 HOH HOH A . D 4 HOH 19 419 53 HOH HOH A . D 4 HOH 20 420 62 HOH HOH A . D 4 HOH 21 421 6 HOH HOH A . D 4 HOH 22 422 38 HOH HOH A . D 4 HOH 23 423 57 HOH HOH A . D 4 HOH 24 424 59 HOH HOH A . D 4 HOH 25 425 10 HOH HOH A . D 4 HOH 26 426 16 HOH HOH A . D 4 HOH 27 427 17 HOH HOH A . D 4 HOH 28 428 9 HOH HOH A . D 4 HOH 29 429 69 HOH HOH A . D 4 HOH 30 430 75 HOH HOH A . D 4 HOH 31 431 88 HOH HOH A . D 4 HOH 32 432 43 HOH HOH A . D 4 HOH 33 433 90 HOH HOH A . D 4 HOH 34 434 74 HOH HOH A . D 4 HOH 35 435 4 HOH HOH A . D 4 HOH 36 436 61 HOH HOH A . D 4 HOH 37 437 11 HOH HOH A . D 4 HOH 38 438 1 HOH HOH A . D 4 HOH 39 439 41 HOH HOH A . D 4 HOH 40 440 18 HOH HOH A . D 4 HOH 41 441 47 HOH HOH A . D 4 HOH 42 442 28 HOH HOH A . D 4 HOH 43 443 25 HOH HOH A . D 4 HOH 44 444 5 HOH HOH A . D 4 HOH 45 445 14 HOH HOH A . D 4 HOH 46 446 20 HOH HOH A . D 4 HOH 47 447 83 HOH HOH A . D 4 HOH 48 448 3 HOH HOH A . D 4 HOH 49 449 7 HOH HOH A . D 4 HOH 50 450 58 HOH HOH A . D 4 HOH 51 451 67 HOH HOH A . D 4 HOH 52 452 24 HOH HOH A . D 4 HOH 53 453 31 HOH HOH A . D 4 HOH 54 454 48 HOH HOH A . D 4 HOH 55 455 35 HOH HOH A . D 4 HOH 56 456 80 HOH HOH A . D 4 HOH 57 457 78 HOH HOH A . D 4 HOH 58 458 13 HOH HOH A . D 4 HOH 59 459 64 HOH HOH A . D 4 HOH 60 460 85 HOH HOH A . D 4 HOH 61 461 37 HOH HOH A . D 4 HOH 62 462 15 HOH HOH A . D 4 HOH 63 463 42 HOH HOH A . D 4 HOH 64 464 70 HOH HOH A . D 4 HOH 65 465 30 HOH HOH A . D 4 HOH 66 466 8 HOH HOH A . D 4 HOH 67 467 19 HOH HOH A . D 4 HOH 68 468 23 HOH HOH A . D 4 HOH 69 469 56 HOH HOH A . D 4 HOH 70 470 63 HOH HOH A . D 4 HOH 71 471 12 HOH HOH A . D 4 HOH 72 472 77 HOH HOH A . D 4 HOH 73 473 46 HOH HOH A . D 4 HOH 74 474 21 HOH HOH A . D 4 HOH 75 475 87 HOH HOH A . D 4 HOH 76 476 81 HOH HOH A . D 4 HOH 77 477 68 HOH HOH A . D 4 HOH 78 478 79 HOH HOH A . D 4 HOH 79 479 27 HOH HOH A . D 4 HOH 80 480 72 HOH HOH A . D 4 HOH 81 481 52 HOH HOH A . D 4 HOH 82 482 92 HOH HOH A . D 4 HOH 83 483 91 HOH HOH A . D 4 HOH 84 484 76 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 55 ? CG ? A ARG 57 CG 2 1 Y 1 A ARG 55 ? CD ? A ARG 57 CD 3 1 Y 1 A ARG 55 ? NE ? A ARG 57 NE 4 1 Y 1 A ARG 55 ? CZ ? A ARG 57 CZ 5 1 Y 1 A ARG 55 ? NH1 ? A ARG 57 NH1 6 1 Y 1 A ARG 55 ? NH2 ? A ARG 57 NH2 7 1 Y 1 A GLN 136 ? CG ? A GLN 138 CG 8 1 Y 1 A GLN 136 ? CD ? A GLN 138 CD 9 1 Y 1 A GLN 136 ? OE1 ? A GLN 138 OE1 10 1 Y 1 A GLN 136 ? NE2 ? A GLN 138 NE2 11 1 Y 1 A LEU 139 ? CG ? A LEU 141 CG 12 1 Y 1 A LEU 139 ? CD1 ? A LEU 141 CD1 13 1 Y 1 A LEU 139 ? CD2 ? A LEU 141 CD2 14 1 Y 1 A GLU 141 ? CG ? A GLU 143 CG 15 1 Y 1 A GLU 141 ? CD ? A GLU 143 CD 16 1 Y 1 A GLU 141 ? OE1 ? A GLU 143 OE1 17 1 Y 1 A GLU 141 ? OE2 ? A GLU 143 OE2 18 1 Y 1 A TYR 147 ? CG ? A TYR 149 CG 19 1 Y 1 A TYR 147 ? CD1 ? A TYR 149 CD1 20 1 Y 1 A TYR 147 ? CD2 ? A TYR 149 CD2 21 1 Y 1 A TYR 147 ? CE1 ? A TYR 149 CE1 22 1 Y 1 A TYR 147 ? CE2 ? A TYR 149 CE2 23 1 Y 1 A TYR 147 ? CZ ? A TYR 149 CZ 24 1 Y 1 A TYR 147 ? OH ? A TYR 149 OH 25 1 Y 1 A MET 153 ? CG ? A MET 155 CG 26 1 Y 1 A MET 153 ? SD ? A MET 155 SD 27 1 Y 1 A MET 153 ? CE ? A MET 155 CE 28 1 Y 1 A LEU 154 ? CG ? A LEU 156 CG 29 1 Y 1 A LEU 154 ? CD1 ? A LEU 156 CD1 30 1 Y 1 A LEU 154 ? CD2 ? A LEU 156 CD2 31 1 Y 1 A LYS 155 ? CG ? A LYS 157 CG 32 1 Y 1 A LYS 155 ? CD ? A LYS 157 CD 33 1 Y 1 A LYS 155 ? CE ? A LYS 157 CE 34 1 Y 1 A LYS 155 ? NZ ? A LYS 157 NZ 35 1 Y 1 A THR 156 ? OG1 ? A THR 158 OG1 36 1 Y 1 A THR 156 ? CG2 ? A THR 158 CG2 37 1 Y 1 A ILE 157 ? CG1 ? A ILE 159 CG1 38 1 Y 1 A ILE 157 ? CG2 ? A ILE 159 CG2 39 1 Y 1 A ILE 157 ? CD1 ? A ILE 159 CD1 40 1 Y 1 A LYS 158 ? CG ? A LYS 160 CG 41 1 Y 1 A LYS 158 ? CD ? A LYS 160 CD 42 1 Y 1 A LYS 158 ? CE ? A LYS 160 CE 43 1 Y 1 A LYS 158 ? NZ ? A LYS 160 NZ 44 1 Y 1 A GLU 159 ? CG ? A GLU 161 CG 45 1 Y 1 A GLU 159 ? CD ? A GLU 161 CD 46 1 Y 1 A GLU 159 ? OE1 ? A GLU 161 OE1 47 1 Y 1 A GLU 159 ? OE2 ? A GLU 161 OE2 48 1 Y 1 A ARG 160 ? CG ? A ARG 162 CG 49 1 Y 1 A ARG 160 ? CD ? A ARG 162 CD 50 1 Y 1 A ARG 160 ? NE ? A ARG 162 NE 51 1 Y 1 A ARG 160 ? CZ ? A ARG 162 CZ 52 1 Y 1 A ARG 160 ? NH1 ? A ARG 162 NH1 53 1 Y 1 A ARG 160 ? NH2 ? A ARG 162 NH2 54 1 Y 1 A GLU 196 ? CG ? A GLU 198 CG 55 1 Y 1 A GLU 196 ? CD ? A GLU 198 CD 56 1 Y 1 A GLU 196 ? OE1 ? A GLU 198 OE1 57 1 Y 1 A GLU 196 ? OE2 ? A GLU 198 OE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.7.4 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? . 5 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 100.05 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 7P8O _cell.details ? _cell.formula_units_Z ? _cell.length_a 87.636 _cell.length_a_esd ? _cell.length_b 72.374 _cell.length_b_esd ? _cell.length_c 51.822 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 7P8O _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7P8O _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.50 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 50.86 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'MES 0.1 M pH 6.5; MgSO4; 1.8 M NaCl.' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 288 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-05-05 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE MASSIF-3' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MASSIF-3 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7P8O _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.95 _reflns.d_resolution_low 51.03 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 22696 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.5 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 2.9 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.89 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.059 _reflns.pdbx_Rpim_I_all 0.033 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 65244 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.048 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.95 _reflns_shell.d_res_low 2.00 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all 4556 _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1541 _reflns_shell.percent_possible_obs 95.6 _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 3.0 _reflns_shell.pdbx_chi_squared 0.88 _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs 2.3 _reflns_shell.pdbx_Rrim_I_all 0.476 _reflns_shell.pdbx_Rpim_I_all 0.265 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.885 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.394 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 0.53 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] -2.25 _refine.aniso_B[2][2] -0.24 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] 0.48 _refine.B_iso_max ? _refine.B_iso_mean 32.572 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.959 _refine.correlation_coeff_Fo_to_Fc_free 0.945 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7P8O _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.95 _refine.ls_d_res_low 39.87 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 21576 _refine.ls_number_reflns_R_free 1105 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.35 _refine.ls_percent_reflns_R_free 4.9 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.19323 _refine.ls_R_factor_R_free 0.23153 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.19115 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5CM0 _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.160 _refine.pdbx_overall_ESU_R_Free 0.149 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 4.071 _refine.overall_SU_ML 0.115 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.details ? _refine_hist.d_res_high 1.95 _refine_hist.d_res_low 39.87 _refine_hist.number_atoms_solvent 84 _refine_hist.number_atoms_total 2253 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2163 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 6 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 0.012 2181 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.533 1.636 2961 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.788 5.000 266 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 30.849 21.694 124 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 15.055 15.000 358 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 21.435 15.000 17 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.114 0.200 288 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.008 0.020 1676 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 3.064 3.154 1067 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 4.172 4.698 1329 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 3.982 3.566 1114 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 7.510 42.897 3201 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.950 _refine_ls_shell.d_res_low 2.001 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 78 _refine_ls_shell.number_reflns_R_work 1556 _refine_ls_shell.percent_reflns_obs 96.69 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.274 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.286 # _struct.entry_id 7P8O _struct.title 'Crystal structure of D-aminoacid transaminase from Haliscomenobacter hydrossis in its intermediate form' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7P8O _struct_keywords.text 'Transaminase, DATA, aminotransferase, apo, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code F4KWH0_HALH1 _struct_ref.pdbx_db_accession F4KWH0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MIKYYNINGQQVPVENATLHVSDLSILRGYGIFDYFLAREGHPLFLDDYLNRFYRSAAELYLEIPFDKAELRRQIYALLQ ANEVREAGIRLVLTGGYSPDGYTPVNPNLLIMMYDLPASAWEFSAQGIKIITHPFQRELPEVKTINYSTGIRMLKTIKER GATDLIYVDQGEWIRESARSNFFLVMPDNTIVTADEKILWGITRRQVIDAAREAGYAVEERRIHITELDQAREAFFTSTI KGVMAIGQIDDRVFGDGTIGKVTQELQDLFVGKVKAYLETC ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7P8O _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 283 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession F4KWH0 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 281 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 281 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7P8O GLY A 1 ? UNP F4KWH0 ? ? 'expression tag' -1 1 1 7P8O HIS A 2 ? UNP F4KWH0 ? ? 'expression tag' 0 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5490 ? 1 MORE -85 ? 1 'SSA (A^2)' 23620 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_656 -x+1,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 78.5926713853 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 51.0268350142 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 17 ? ALA A 19 ? GLU A 15 ALA A 17 5 ? 3 HELX_P HELX_P2 AA2 ASP A 25 ? GLY A 31 ? ASP A 23 GLY A 29 1 ? 7 HELX_P HELX_P3 AA3 PHE A 47 ? LEU A 62 ? PHE A 45 LEU A 60 1 ? 16 HELX_P HELX_P4 AA4 ASP A 69 ? ASN A 84 ? ASP A 67 ASN A 82 1 ? 16 HELX_P HELX_P5 AA5 GLY A 203 ? ALA A 216 ? GLY A 201 ALA A 214 1 ? 14 HELX_P HELX_P6 AA6 HIS A 226 ? GLN A 232 ? HIS A 224 GLN A 230 5 ? 7 HELX_P HELX_P7 AA7 GLY A 262 ? THR A 282 ? GLY A 260 THR A 280 1 ? 21 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id metalc1 _struct_conn.conn_type_id metalc _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id ILE _struct_conn.ptnr1_label_seq_id 28 _struct_conn.ptnr1_label_atom_id O _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id C _struct_conn.ptnr2_label_comp_id MG _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id MG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id ILE _struct_conn.ptnr1_auth_seq_id 26 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id MG _struct_conn.ptnr2_auth_seq_id 302 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.741 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 8 ? AA3 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? parallel AA2 3 4 ? parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA2 6 7 ? anti-parallel AA2 7 8 ? parallel AA3 1 2 ? anti-parallel AA3 2 3 ? parallel AA3 3 4 ? parallel AA3 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLN A 12 ? PRO A 15 ? GLN A 10 PRO A 13 AA1 2 TYR A 6 ? ILE A 9 ? TYR A 4 ILE A 7 AA1 3 ASN A 110 ? TYR A 116 ? ASN A 108 TYR A 114 AA1 4 ALA A 89 ? THR A 96 ? ALA A 87 THR A 94 AA1 5 GLY A 33 ? ARG A 41 ? GLY A 31 ARG A 39 AA1 6 HIS A 44 ? PRO A 45 ? HIS A 42 PRO A 43 AA2 1 TRP A 175 ? ARG A 177 ? TRP A 173 ARG A 175 AA2 2 ASP A 166 ? ASP A 171 ? ASP A 164 ASP A 169 AA2 3 ILE A 130 ? PRO A 136 ? ILE A 128 PRO A 134 AA2 4 GLY A 244 ? ILE A 251 ? GLY A 242 ILE A 249 AA2 5 GLU A 235 ? SER A 240 ? GLU A 233 SER A 238 AA2 6 ASN A 183 ? VAL A 187 ? ASN A 181 VAL A 185 AA2 7 ILE A 193 ? THR A 195 ? ILE A 191 THR A 193 AA2 8 VAL A 220 ? GLU A 222 ? VAL A 218 GLU A 220 AA3 1 TRP A 175 ? ARG A 177 ? TRP A 173 ARG A 175 AA3 2 ASP A 166 ? ASP A 171 ? ASP A 164 ASP A 169 AA3 3 ILE A 130 ? PRO A 136 ? ILE A 128 PRO A 134 AA3 4 GLY A 244 ? ILE A 251 ? GLY A 242 ILE A 249 AA3 5 ARG A 254 ? VAL A 255 ? ARG A 252 VAL A 253 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O VAL A 14 ? O VAL A 12 N TYR A 7 ? N TYR A 5 AA1 2 3 N ASN A 8 ? N ASN A 6 O ILE A 113 ? O ILE A 111 AA1 3 4 O MET A 114 ? O MET A 112 N ARG A 92 ? N ARG A 90 AA1 4 5 O ILE A 91 ? O ILE A 89 N PHE A 38 ? N PHE A 36 AA1 5 6 N ARG A 41 ? N ARG A 39 O HIS A 44 ? O HIS A 42 AA2 1 2 O ARG A 177 ? O ARG A 175 N TYR A 169 ? N TYR A 167 AA2 2 3 O VAL A 170 ? O VAL A 168 N HIS A 135 ? N HIS A 133 AA2 3 4 N ILE A 132 ? N ILE A 130 O GLN A 250 ? O GLN A 248 AA2 4 5 O MET A 246 ? O MET A 244 N PHE A 238 ? N PHE A 236 AA2 5 6 O GLU A 235 ? O GLU A 233 N VAL A 187 ? N VAL A 185 AA2 6 7 N LEU A 186 ? N LEU A 184 O VAL A 194 ? O VAL A 192 AA2 7 8 N ILE A 193 ? N ILE A 191 O GLU A 221 ? O GLU A 219 AA3 1 2 O ARG A 177 ? O ARG A 175 N TYR A 169 ? N TYR A 167 AA3 2 3 O VAL A 170 ? O VAL A 168 N HIS A 135 ? N HIS A 133 AA3 3 4 N ILE A 132 ? N ILE A 130 O GLN A 250 ? O GLN A 248 AA3 4 5 N ILE A 251 ? N ILE A 249 O ARG A 254 ? O ARG A 252 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 C A ARG 160 ? ? N A GLY 161 ? ? CA A GLY 161 ? ? 136.97 122.30 14.67 2.10 Y 2 1 CG A ARG 205 ? ? CD A ARG 205 ? ? NE A ARG 205 ? ? 126.17 111.80 14.37 2.10 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 102 ? ? -152.22 -35.40 2 1 ASN A 106 ? ? 172.08 93.20 3 1 PRO A 140 ? ? -99.53 33.94 4 1 GLU A 141 ? ? 92.41 69.74 5 1 LEU A 154 ? ? 57.47 -57.99 6 1 LYS A 155 ? ? 30.79 64.74 7 1 THR A 156 ? ? -166.88 66.21 8 1 LYS A 158 ? ? 82.29 32.42 9 1 GLU A 159 ? ? 55.58 -85.02 10 1 ARG A 160 ? ? 71.69 77.95 11 1 ASP A 250 ? ? 57.17 -111.12 # _phasing.method MR # _pdbx_entry_details.entry_id 7P8O _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.has_protein_modification ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -1 ? A GLY 1 2 1 Y 1 A ARG 137 ? A ARG 139 3 1 Y 1 A GLU 138 ? A GLU 140 4 1 Y 1 A SER 148 ? A SER 150 5 1 Y 1 A THR 149 ? A THR 151 6 1 Y 1 A GLY 150 ? A GLY 152 7 1 Y 1 A ILE 151 ? A ILE 153 8 1 Y 1 A ARG 152 ? A ARG 154 9 1 Y 0 A MET 153 ? A MET 155 10 1 Y 0 A LEU 154 ? A LEU 156 11 1 Y 0 A LYS 155 ? A LYS 157 12 1 Y 0 A THR 156 ? A THR 158 13 1 Y 0 A ILE 157 ? A ILE 159 14 1 Y 0 A LYS 158 ? A LYS 160 15 1 Y 0 A GLU 159 ? A GLU 161 16 1 Y 0 A ARG 160 ? A ARG 162 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 MG MG MG N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 SO4 S S N N 305 SO4 O1 O N N 306 SO4 O2 O N N 307 SO4 O3 O N N 308 SO4 O4 O N N 309 THR N N N N 310 THR CA C N S 311 THR C C N N 312 THR O O N N 313 THR CB C N R 314 THR OG1 O N N 315 THR CG2 C N N 316 THR OXT O N N 317 THR H H N N 318 THR H2 H N N 319 THR HA H N N 320 THR HB H N N 321 THR HG1 H N N 322 THR HG21 H N N 323 THR HG22 H N N 324 THR HG23 H N N 325 THR HXT H N N 326 TRP N N N N 327 TRP CA C N S 328 TRP C C N N 329 TRP O O N N 330 TRP CB C N N 331 TRP CG C Y N 332 TRP CD1 C Y N 333 TRP CD2 C Y N 334 TRP NE1 N Y N 335 TRP CE2 C Y N 336 TRP CE3 C Y N 337 TRP CZ2 C Y N 338 TRP CZ3 C Y N 339 TRP CH2 C Y N 340 TRP OXT O N N 341 TRP H H N N 342 TRP H2 H N N 343 TRP HA H N N 344 TRP HB2 H N N 345 TRP HB3 H N N 346 TRP HD1 H N N 347 TRP HE1 H N N 348 TRP HE3 H N N 349 TRP HZ2 H N N 350 TRP HZ3 H N N 351 TRP HH2 H N N 352 TRP HXT H N N 353 TYR N N N N 354 TYR CA C N S 355 TYR C C N N 356 TYR O O N N 357 TYR CB C N N 358 TYR CG C Y N 359 TYR CD1 C Y N 360 TYR CD2 C Y N 361 TYR CE1 C Y N 362 TYR CE2 C Y N 363 TYR CZ C Y N 364 TYR OH O N N 365 TYR OXT O N N 366 TYR H H N N 367 TYR H2 H N N 368 TYR HA H N N 369 TYR HB2 H N N 370 TYR HB3 H N N 371 TYR HD1 H N N 372 TYR HD2 H N N 373 TYR HE1 H N N 374 TYR HE2 H N N 375 TYR HH H N N 376 TYR HXT H N N 377 VAL N N N N 378 VAL CA C N S 379 VAL C C N N 380 VAL O O N N 381 VAL CB C N N 382 VAL CG1 C N N 383 VAL CG2 C N N 384 VAL OXT O N N 385 VAL H H N N 386 VAL H2 H N N 387 VAL HA H N N 388 VAL HB H N N 389 VAL HG11 H N N 390 VAL HG12 H N N 391 VAL HG13 H N N 392 VAL HG21 H N N 393 VAL HG22 H N N 394 VAL HG23 H N N 395 VAL HXT H N N 396 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 SO4 S O1 doub N N 290 SO4 S O2 doub N N 291 SO4 S O3 sing N N 292 SO4 S O4 sing N N 293 THR N CA sing N N 294 THR N H sing N N 295 THR N H2 sing N N 296 THR CA C sing N N 297 THR CA CB sing N N 298 THR CA HA sing N N 299 THR C O doub N N 300 THR C OXT sing N N 301 THR CB OG1 sing N N 302 THR CB CG2 sing N N 303 THR CB HB sing N N 304 THR OG1 HG1 sing N N 305 THR CG2 HG21 sing N N 306 THR CG2 HG22 sing N N 307 THR CG2 HG23 sing N N 308 THR OXT HXT sing N N 309 TRP N CA sing N N 310 TRP N H sing N N 311 TRP N H2 sing N N 312 TRP CA C sing N N 313 TRP CA CB sing N N 314 TRP CA HA sing N N 315 TRP C O doub N N 316 TRP C OXT sing N N 317 TRP CB CG sing N N 318 TRP CB HB2 sing N N 319 TRP CB HB3 sing N N 320 TRP CG CD1 doub Y N 321 TRP CG CD2 sing Y N 322 TRP CD1 NE1 sing Y N 323 TRP CD1 HD1 sing N N 324 TRP CD2 CE2 doub Y N 325 TRP CD2 CE3 sing Y N 326 TRP NE1 CE2 sing Y N 327 TRP NE1 HE1 sing N N 328 TRP CE2 CZ2 sing Y N 329 TRP CE3 CZ3 doub Y N 330 TRP CE3 HE3 sing N N 331 TRP CZ2 CH2 doub Y N 332 TRP CZ2 HZ2 sing N N 333 TRP CZ3 CH2 sing Y N 334 TRP CZ3 HZ3 sing N N 335 TRP CH2 HH2 sing N N 336 TRP OXT HXT sing N N 337 TYR N CA sing N N 338 TYR N H sing N N 339 TYR N H2 sing N N 340 TYR CA C sing N N 341 TYR CA CB sing N N 342 TYR CA HA sing N N 343 TYR C O doub N N 344 TYR C OXT sing N N 345 TYR CB CG sing N N 346 TYR CB HB2 sing N N 347 TYR CB HB3 sing N N 348 TYR CG CD1 doub Y N 349 TYR CG CD2 sing Y N 350 TYR CD1 CE1 sing Y N 351 TYR CD1 HD1 sing N N 352 TYR CD2 CE2 doub Y N 353 TYR CD2 HD2 sing N N 354 TYR CE1 CZ doub Y N 355 TYR CE1 HE1 sing N N 356 TYR CE2 CZ sing Y N 357 TYR CE2 HE2 sing N N 358 TYR CZ OH sing N N 359 TYR OH HH sing N N 360 TYR OXT HXT sing N N 361 VAL N CA sing N N 362 VAL N H sing N N 363 VAL N H2 sing N N 364 VAL CA C sing N N 365 VAL CA CB sing N N 366 VAL CA HA sing N N 367 VAL C O doub N N 368 VAL C OXT sing N N 369 VAL CB CG1 sing N N 370 VAL CB CG2 sing N N 371 VAL CB HB sing N N 372 VAL CG1 HG11 sing N N 373 VAL CG1 HG12 sing N N 374 VAL CG1 HG13 sing N N 375 VAL CG2 HG21 sing N N 376 VAL CG2 HG22 sing N N 377 VAL CG2 HG23 sing N N 378 VAL OXT HXT sing N N 379 # _pdbx_audit_support.funding_organization 'Russian Science Foundation' _pdbx_audit_support.country 'Russian Federation' _pdbx_audit_support.grant_number 19-14-00164 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5CM0 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7P8O _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.011411 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.002021 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013817 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019597 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C MG N O S # loop_