data_7PDC # _entry.id 7PDC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.384 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7PDC pdb_00007pdc 10.2210/pdb7pdc/pdb WWPDB D_1292117512 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-09-08 2 'Structure model' 1 1 2021-11-03 3 'Structure model' 1 2 2024-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_depui_entry_details 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' pdbx_initial_refinement_model # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 2 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_depui_entry_details.replace_pdb_id' # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 2021-09-08 _pdbx_database_PDB_obs_spr.pdb_id 7PDC _pdbx_database_PDB_obs_spr.replace_pdb_id 5G1J _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7PDC _pdbx_database_status.recvd_initial_deposition_date 2021-08-05 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Zeth, K.' 1 0000-0002-7078-6569 'Sancho-Vaello, E.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Rep' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2045-2322 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 10 _citation.language ? _citation.page_first 17356 _citation.page_last 17356 _citation.title ;The structure of the antimicrobial human cathelicidin LL-37 shows oligomerization and channel formation in the presence of membrane mimics. ; _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41598-020-74401-5 _citation.pdbx_database_id_PubMed 33060695 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sancho-Vaello, E.' 1 ? primary 'Gil-Carton, D.' 2 ? primary 'Francois, P.' 3 0000-0002-0540-750X primary 'Bonetti, E.J.' 4 ? primary 'Kreir, M.' 5 ? primary 'Pothula, K.R.' 6 0000-0003-0073-2511 primary 'Kleinekathofer, U.' 7 0000-0002-6114-7431 primary 'Zeth, K.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Cathelicidin antimicrobial peptide' 4504.351 2 ? ? ? [LL-37, 37 aa] 2 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 3 water nat water 18.015 10 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name '18 kDa cationic antimicrobial protein,hCAP-18' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code [LL-37, 37 aa] _entity_poly.pdbx_seq_one_letter_code_can [LL-37, 37 aa] _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CHLORIDE ION' CL 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LEU n 1 2 LEU n 1 3 GLY n 1 4 ASP n 1 5 PHE n 1 6 PHE n 1 7 ARG n 1 8 LYS n 1 9 SER n 1 10 LYS n 1 11 GLU n 1 12 LYS n 1 13 ILE n 1 14 GLY n 1 15 LYS n 1 16 GLU n 1 17 PHE n 1 18 LYS n 1 19 ARG n 1 20 ILE n 1 21 VAL n 1 22 GLN n 1 23 ARG n 1 24 ILE n 1 25 LYS n 1 26 ASP n 1 27 PHE n 1 28 LEU n 1 29 ARG n 1 30 ASN n 1 31 LEU n 1 32 VAL n 1 33 PRO n 1 34 ARG n 1 35 THR n 1 36 GLU n 1 37 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 37 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CAMP, CAP18, FALL39, HSD26' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'chemical production metagenome' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 2495586 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LEU 1 1 ? ? ? A . n A 1 2 LEU 2 2 2 LEU LEU A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 PHE 5 5 5 PHE PHE A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 VAL 32 32 ? ? ? A . n A 1 33 PRO 33 33 ? ? ? A . n A 1 34 ARG 34 34 ? ? ? A . n A 1 35 THR 35 35 ? ? ? A . n A 1 36 GLU 36 36 ? ? ? A . n A 1 37 SER 37 37 ? ? ? A . n B 1 1 LEU 1 1 ? ? ? B . n B 1 2 LEU 2 2 ? ? ? B . n B 1 3 GLY 3 3 ? ? ? B . n B 1 4 ASP 4 4 ? ? ? B . n B 1 5 PHE 5 5 5 PHE PHE B . n B 1 6 PHE 6 6 6 PHE PHE B . n B 1 7 ARG 7 7 7 ARG ARG B . n B 1 8 LYS 8 8 8 LYS LYS B . n B 1 9 SER 9 9 9 SER SER B . n B 1 10 LYS 10 10 10 LYS LYS B . n B 1 11 GLU 11 11 11 GLU GLU B . n B 1 12 LYS 12 12 12 LYS LYS B . n B 1 13 ILE 13 13 13 ILE ILE B . n B 1 14 GLY 14 14 14 GLY GLY B . n B 1 15 LYS 15 15 15 LYS LYS B . n B 1 16 GLU 16 16 16 GLU GLU B . n B 1 17 PHE 17 17 17 PHE PHE B . n B 1 18 LYS 18 18 18 LYS LYS B . n B 1 19 ARG 19 19 19 ARG ARG B . n B 1 20 ILE 20 20 20 ILE ILE B . n B 1 21 VAL 21 21 21 VAL VAL B . n B 1 22 GLN 22 22 22 GLN GLN B . n B 1 23 ARG 23 23 23 ARG ARG B . n B 1 24 ILE 24 24 24 ILE ILE B . n B 1 25 LYS 25 25 25 LYS LYS B . n B 1 26 ASP 26 26 26 ASP ASP B . n B 1 27 PHE 27 27 27 PHE PHE B . n B 1 28 LEU 28 28 28 LEU LEU B . n B 1 29 ARG 29 29 29 ARG ARG B . n B 1 30 ASN 30 30 30 ASN ASN B . n B 1 31 LEU 31 31 31 LEU LEU B . n B 1 32 VAL 32 32 ? ? ? B . n B 1 33 PRO 33 33 ? ? ? B . n B 1 34 ARG 34 34 ? ? ? B . n B 1 35 THR 35 35 ? ? ? B . n B 1 36 GLU 36 36 ? ? ? B . n B 1 37 SER 37 37 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 CL 1 101 1 CL CL B . D 3 HOH 1 101 12 HOH HOH A . D 3 HOH 2 102 13 HOH HOH A . E 3 HOH 1 201 4 HOH HOH B . E 3 HOH 2 202 2 HOH HOH B . E 3 HOH 3 203 11 HOH HOH B . E 3 HOH 4 204 8 HOH HOH B . E 3 HOH 5 205 3 HOH HOH B . E 3 HOH 6 206 10 HOH HOH B . E 3 HOH 7 207 14 HOH HOH B . E 3 HOH 8 208 6 HOH HOH B . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 B PHE 5 ? CG ? B PHE 5 CG 2 1 Y 1 B PHE 5 ? CD1 ? B PHE 5 CD1 3 1 Y 1 B PHE 5 ? CD2 ? B PHE 5 CD2 4 1 Y 1 B PHE 5 ? CE1 ? B PHE 5 CE1 5 1 Y 1 B PHE 5 ? CE2 ? B PHE 5 CE2 6 1 Y 1 B PHE 5 ? CZ ? B PHE 5 CZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.10.0 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 106.36 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 7PDC _cell.details ? _cell.formula_units_Z ? _cell.length_a 53.100 _cell.length_a_esd ? _cell.length_b 51.420 _cell.length_b_esd ? _cell.length_c 26.220 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7PDC _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7PDC _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.91 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 35.48 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '20% PEG 20K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-08-15 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9795 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALBA BEAMLINE XALOC' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9795 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline XALOC _diffrn_source.pdbx_synchrotron_site ALBA # _reflns.B_iso_Wilson_estimate 41.96 _reflns.entry_id 7PDC _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.83 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 5827 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.2 _reflns.pdbx_Rmerge_I_obs 0.11 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 5.38 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.99 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.83 _reflns_shell.d_res_low 1.94 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 0.84 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 500 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.29 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.19 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 1.6985 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 1.6594 _refine.aniso_B[2][2] -7.0235 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 5.3250 _refine.B_iso_max ? _refine.B_iso_mean 54.05 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.9309 _refine.correlation_coeff_Fo_to_Fc_free 0.9117 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7PDC _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.83 _refine.ls_d_res_low 36.19 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 5827 _refine.ls_number_reflns_R_free 562 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.60 _refine.ls_percent_reflns_R_free 9.64 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2566 _refine.ls_R_factor_R_free 0.3023 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2518 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5NNM _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.167 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.161 _refine.pdbx_overall_SU_R_Blow_DPI 0.166 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI 0.173 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 7PDC _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.268 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 498 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 10 _refine_hist.number_atoms_total 509 _refine_hist.d_res_high 1.83 _refine_hist.d_res_low 36.19 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 ? 516 ? t_bond_d 2.00 HARMONIC 'X-RAY DIFFRACTION' ? 0.96 ? 676 ? t_angle_deg 2.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 221 ? t_dihedral_angle_d 2.00 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? ? ? t_incorr_chiral_ct ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_pseud_angle ? ? 'X-RAY DIFFRACTION' ? ? ? 11 ? t_trig_c_planes 2.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 75 ? t_gen_planes 5.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 516 ? t_it 20.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_nbd ? ? 'X-RAY DIFFRACTION' ? 2.12 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 18.33 ? ? ? t_other_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_improper_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 62 ? t_chiral_improper_torsion 5.00 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_sum_occupancies ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_distance ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 568 ? t_ideal_dist_contact 4.00 SEMIHARMONIC # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.83 _refine_ls_shell.d_res_low 2.05 _refine_ls_shell.number_reflns_all 1562 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 145 _refine_ls_shell.number_reflns_R_work 1417 _refine_ls_shell.percent_reflns_obs 96.60 _refine_ls_shell.percent_reflns_R_free 9.28 _refine_ls_shell.R_factor_all 0.2257 _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2405 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.2242 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 5 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7PDC _struct.title 'The structure of the human tetrameric LL-37 peptide in a channel conformation' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7PDC _struct_keywords.text 'Antimicrobial peptide, LL-37, channel, ANTIMICROBIAL PROTEIN' _struct_keywords.pdbx_keywords 'ANTIMICROBIAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 3 ? E N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CAMP_HUMAN _struct_ref.pdbx_db_accession P49913 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code [LL-37, 37 aa] _struct_ref.pdbx_align_begin 134 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7PDC A 1 ? 37 ? P49913 134 ? 170 ? 1 37 2 1 7PDC B 1 ? 37 ? P49913 134 ? 170 ? 1 37 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3890 ? 1 MORE -18 ? 1 'SSA (A^2)' 9480 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 3 ? LEU A 31 ? GLY A 3 LEU A 31 1 ? 29 HELX_P HELX_P2 AA2 PHE B 6 ? LEU B 31 ? PHE B 6 LEU B 31 1 ? 26 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id PHE _pdbx_validate_torsion.auth_asym_id B _pdbx_validate_torsion.auth_seq_id 6 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -59.80 _pdbx_validate_torsion.psi -108.45 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id B _pdbx_struct_special_symmetry.auth_comp_id CL _pdbx_struct_special_symmetry.auth_seq_id 101 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id CL _pdbx_struct_special_symmetry.label_seq_id . # _pdbx_entry_details.entry_id 7PDC _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LEU 1 ? A LEU 1 2 1 Y 1 A VAL 32 ? A VAL 32 3 1 Y 1 A PRO 33 ? A PRO 33 4 1 Y 1 A ARG 34 ? A ARG 34 5 1 Y 1 A THR 35 ? A THR 35 6 1 Y 1 A GLU 36 ? A GLU 36 7 1 Y 1 A SER 37 ? A SER 37 8 1 Y 1 B LEU 1 ? B LEU 1 9 1 Y 1 B LEU 2 ? B LEU 2 10 1 Y 1 B GLY 3 ? B GLY 3 11 1 Y 1 B ASP 4 ? B ASP 4 12 1 Y 1 B VAL 32 ? B VAL 32 13 1 Y 1 B PRO 33 ? B PRO 33 14 1 Y 1 B ARG 34 ? B ARG 34 15 1 Y 1 B THR 35 ? B THR 35 16 1 Y 1 B GLU 36 ? B GLU 36 17 1 Y 1 B SER 37 ? B SER 37 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ARG N N N N 1 ARG CA C N S 2 ARG C C N N 3 ARG O O N N 4 ARG CB C N N 5 ARG CG C N N 6 ARG CD C N N 7 ARG NE N N N 8 ARG CZ C N N 9 ARG NH1 N N N 10 ARG NH2 N N N 11 ARG OXT O N N 12 ARG H H N N 13 ARG H2 H N N 14 ARG HA H N N 15 ARG HB2 H N N 16 ARG HB3 H N N 17 ARG HG2 H N N 18 ARG HG3 H N N 19 ARG HD2 H N N 20 ARG HD3 H N N 21 ARG HE H N N 22 ARG HH11 H N N 23 ARG HH12 H N N 24 ARG HH21 H N N 25 ARG HH22 H N N 26 ARG HXT H N N 27 ASN N N N N 28 ASN CA C N S 29 ASN C C N N 30 ASN O O N N 31 ASN CB C N N 32 ASN CG C N N 33 ASN OD1 O N N 34 ASN ND2 N N N 35 ASN OXT O N N 36 ASN H H N N 37 ASN H2 H N N 38 ASN HA H N N 39 ASN HB2 H N N 40 ASN HB3 H N N 41 ASN HD21 H N N 42 ASN HD22 H N N 43 ASN HXT H N N 44 ASP N N N N 45 ASP CA C N S 46 ASP C C N N 47 ASP O O N N 48 ASP CB C N N 49 ASP CG C N N 50 ASP OD1 O N N 51 ASP OD2 O N N 52 ASP OXT O N N 53 ASP H H N N 54 ASP H2 H N N 55 ASP HA H N N 56 ASP HB2 H N N 57 ASP HB3 H N N 58 ASP HD2 H N N 59 ASP HXT H N N 60 CL CL CL N N 61 GLN N N N N 62 GLN CA C N S 63 GLN C C N N 64 GLN O O N N 65 GLN CB C N N 66 GLN CG C N N 67 GLN CD C N N 68 GLN OE1 O N N 69 GLN NE2 N N N 70 GLN OXT O N N 71 GLN H H N N 72 GLN H2 H N N 73 GLN HA H N N 74 GLN HB2 H N N 75 GLN HB3 H N N 76 GLN HG2 H N N 77 GLN HG3 H N N 78 GLN HE21 H N N 79 GLN HE22 H N N 80 GLN HXT H N N 81 GLU N N N N 82 GLU CA C N S 83 GLU C C N N 84 GLU O O N N 85 GLU CB C N N 86 GLU CG C N N 87 GLU CD C N N 88 GLU OE1 O N N 89 GLU OE2 O N N 90 GLU OXT O N N 91 GLU H H N N 92 GLU H2 H N N 93 GLU HA H N N 94 GLU HB2 H N N 95 GLU HB3 H N N 96 GLU HG2 H N N 97 GLU HG3 H N N 98 GLU HE2 H N N 99 GLU HXT H N N 100 GLY N N N N 101 GLY CA C N N 102 GLY C C N N 103 GLY O O N N 104 GLY OXT O N N 105 GLY H H N N 106 GLY H2 H N N 107 GLY HA2 H N N 108 GLY HA3 H N N 109 GLY HXT H N N 110 HOH O O N N 111 HOH H1 H N N 112 HOH H2 H N N 113 ILE N N N N 114 ILE CA C N S 115 ILE C C N N 116 ILE O O N N 117 ILE CB C N S 118 ILE CG1 C N N 119 ILE CG2 C N N 120 ILE CD1 C N N 121 ILE OXT O N N 122 ILE H H N N 123 ILE H2 H N N 124 ILE HA H N N 125 ILE HB H N N 126 ILE HG12 H N N 127 ILE HG13 H N N 128 ILE HG21 H N N 129 ILE HG22 H N N 130 ILE HG23 H N N 131 ILE HD11 H N N 132 ILE HD12 H N N 133 ILE HD13 H N N 134 ILE HXT H N N 135 LEU N N N N 136 LEU CA C N S 137 LEU C C N N 138 LEU O O N N 139 LEU CB C N N 140 LEU CG C N N 141 LEU CD1 C N N 142 LEU CD2 C N N 143 LEU OXT O N N 144 LEU H H N N 145 LEU H2 H N N 146 LEU HA H N N 147 LEU HB2 H N N 148 LEU HB3 H N N 149 LEU HG H N N 150 LEU HD11 H N N 151 LEU HD12 H N N 152 LEU HD13 H N N 153 LEU HD21 H N N 154 LEU HD22 H N N 155 LEU HD23 H N N 156 LEU HXT H N N 157 LYS N N N N 158 LYS CA C N S 159 LYS C C N N 160 LYS O O N N 161 LYS CB C N N 162 LYS CG C N N 163 LYS CD C N N 164 LYS CE C N N 165 LYS NZ N N N 166 LYS OXT O N N 167 LYS H H N N 168 LYS H2 H N N 169 LYS HA H N N 170 LYS HB2 H N N 171 LYS HB3 H N N 172 LYS HG2 H N N 173 LYS HG3 H N N 174 LYS HD2 H N N 175 LYS HD3 H N N 176 LYS HE2 H N N 177 LYS HE3 H N N 178 LYS HZ1 H N N 179 LYS HZ2 H N N 180 LYS HZ3 H N N 181 LYS HXT H N N 182 PHE N N N N 183 PHE CA C N S 184 PHE C C N N 185 PHE O O N N 186 PHE CB C N N 187 PHE CG C Y N 188 PHE CD1 C Y N 189 PHE CD2 C Y N 190 PHE CE1 C Y N 191 PHE CE2 C Y N 192 PHE CZ C Y N 193 PHE OXT O N N 194 PHE H H N N 195 PHE H2 H N N 196 PHE HA H N N 197 PHE HB2 H N N 198 PHE HB3 H N N 199 PHE HD1 H N N 200 PHE HD2 H N N 201 PHE HE1 H N N 202 PHE HE2 H N N 203 PHE HZ H N N 204 PHE HXT H N N 205 PRO N N N N 206 PRO CA C N S 207 PRO C C N N 208 PRO O O N N 209 PRO CB C N N 210 PRO CG C N N 211 PRO CD C N N 212 PRO OXT O N N 213 PRO H H N N 214 PRO HA H N N 215 PRO HB2 H N N 216 PRO HB3 H N N 217 PRO HG2 H N N 218 PRO HG3 H N N 219 PRO HD2 H N N 220 PRO HD3 H N N 221 PRO HXT H N N 222 SER N N N N 223 SER CA C N S 224 SER C C N N 225 SER O O N N 226 SER CB C N N 227 SER OG O N N 228 SER OXT O N N 229 SER H H N N 230 SER H2 H N N 231 SER HA H N N 232 SER HB2 H N N 233 SER HB3 H N N 234 SER HG H N N 235 SER HXT H N N 236 THR N N N N 237 THR CA C N S 238 THR C C N N 239 THR O O N N 240 THR CB C N R 241 THR OG1 O N N 242 THR CG2 C N N 243 THR OXT O N N 244 THR H H N N 245 THR H2 H N N 246 THR HA H N N 247 THR HB H N N 248 THR HG1 H N N 249 THR HG21 H N N 250 THR HG22 H N N 251 THR HG23 H N N 252 THR HXT H N N 253 VAL N N N N 254 VAL CA C N S 255 VAL C C N N 256 VAL O O N N 257 VAL CB C N N 258 VAL CG1 C N N 259 VAL CG2 C N N 260 VAL OXT O N N 261 VAL H H N N 262 VAL H2 H N N 263 VAL HA H N N 264 VAL HB H N N 265 VAL HG11 H N N 266 VAL HG12 H N N 267 VAL HG13 H N N 268 VAL HG21 H N N 269 VAL HG22 H N N 270 VAL HG23 H N N 271 VAL HXT H N N 272 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ARG N CA sing N N 1 ARG N H sing N N 2 ARG N H2 sing N N 3 ARG CA C sing N N 4 ARG CA CB sing N N 5 ARG CA HA sing N N 6 ARG C O doub N N 7 ARG C OXT sing N N 8 ARG CB CG sing N N 9 ARG CB HB2 sing N N 10 ARG CB HB3 sing N N 11 ARG CG CD sing N N 12 ARG CG HG2 sing N N 13 ARG CG HG3 sing N N 14 ARG CD NE sing N N 15 ARG CD HD2 sing N N 16 ARG CD HD3 sing N N 17 ARG NE CZ sing N N 18 ARG NE HE sing N N 19 ARG CZ NH1 sing N N 20 ARG CZ NH2 doub N N 21 ARG NH1 HH11 sing N N 22 ARG NH1 HH12 sing N N 23 ARG NH2 HH21 sing N N 24 ARG NH2 HH22 sing N N 25 ARG OXT HXT sing N N 26 ASN N CA sing N N 27 ASN N H sing N N 28 ASN N H2 sing N N 29 ASN CA C sing N N 30 ASN CA CB sing N N 31 ASN CA HA sing N N 32 ASN C O doub N N 33 ASN C OXT sing N N 34 ASN CB CG sing N N 35 ASN CB HB2 sing N N 36 ASN CB HB3 sing N N 37 ASN CG OD1 doub N N 38 ASN CG ND2 sing N N 39 ASN ND2 HD21 sing N N 40 ASN ND2 HD22 sing N N 41 ASN OXT HXT sing N N 42 ASP N CA sing N N 43 ASP N H sing N N 44 ASP N H2 sing N N 45 ASP CA C sing N N 46 ASP CA CB sing N N 47 ASP CA HA sing N N 48 ASP C O doub N N 49 ASP C OXT sing N N 50 ASP CB CG sing N N 51 ASP CB HB2 sing N N 52 ASP CB HB3 sing N N 53 ASP CG OD1 doub N N 54 ASP CG OD2 sing N N 55 ASP OD2 HD2 sing N N 56 ASP OXT HXT sing N N 57 GLN N CA sing N N 58 GLN N H sing N N 59 GLN N H2 sing N N 60 GLN CA C sing N N 61 GLN CA CB sing N N 62 GLN CA HA sing N N 63 GLN C O doub N N 64 GLN C OXT sing N N 65 GLN CB CG sing N N 66 GLN CB HB2 sing N N 67 GLN CB HB3 sing N N 68 GLN CG CD sing N N 69 GLN CG HG2 sing N N 70 GLN CG HG3 sing N N 71 GLN CD OE1 doub N N 72 GLN CD NE2 sing N N 73 GLN NE2 HE21 sing N N 74 GLN NE2 HE22 sing N N 75 GLN OXT HXT sing N N 76 GLU N CA sing N N 77 GLU N H sing N N 78 GLU N H2 sing N N 79 GLU CA C sing N N 80 GLU CA CB sing N N 81 GLU CA HA sing N N 82 GLU C O doub N N 83 GLU C OXT sing N N 84 GLU CB CG sing N N 85 GLU CB HB2 sing N N 86 GLU CB HB3 sing N N 87 GLU CG CD sing N N 88 GLU CG HG2 sing N N 89 GLU CG HG3 sing N N 90 GLU CD OE1 doub N N 91 GLU CD OE2 sing N N 92 GLU OE2 HE2 sing N N 93 GLU OXT HXT sing N N 94 GLY N CA sing N N 95 GLY N H sing N N 96 GLY N H2 sing N N 97 GLY CA C sing N N 98 GLY CA HA2 sing N N 99 GLY CA HA3 sing N N 100 GLY C O doub N N 101 GLY C OXT sing N N 102 GLY OXT HXT sing N N 103 HOH O H1 sing N N 104 HOH O H2 sing N N 105 ILE N CA sing N N 106 ILE N H sing N N 107 ILE N H2 sing N N 108 ILE CA C sing N N 109 ILE CA CB sing N N 110 ILE CA HA sing N N 111 ILE C O doub N N 112 ILE C OXT sing N N 113 ILE CB CG1 sing N N 114 ILE CB CG2 sing N N 115 ILE CB HB sing N N 116 ILE CG1 CD1 sing N N 117 ILE CG1 HG12 sing N N 118 ILE CG1 HG13 sing N N 119 ILE CG2 HG21 sing N N 120 ILE CG2 HG22 sing N N 121 ILE CG2 HG23 sing N N 122 ILE CD1 HD11 sing N N 123 ILE CD1 HD12 sing N N 124 ILE CD1 HD13 sing N N 125 ILE OXT HXT sing N N 126 LEU N CA sing N N 127 LEU N H sing N N 128 LEU N H2 sing N N 129 LEU CA C sing N N 130 LEU CA CB sing N N 131 LEU CA HA sing N N 132 LEU C O doub N N 133 LEU C OXT sing N N 134 LEU CB CG sing N N 135 LEU CB HB2 sing N N 136 LEU CB HB3 sing N N 137 LEU CG CD1 sing N N 138 LEU CG CD2 sing N N 139 LEU CG HG sing N N 140 LEU CD1 HD11 sing N N 141 LEU CD1 HD12 sing N N 142 LEU CD1 HD13 sing N N 143 LEU CD2 HD21 sing N N 144 LEU CD2 HD22 sing N N 145 LEU CD2 HD23 sing N N 146 LEU OXT HXT sing N N 147 LYS N CA sing N N 148 LYS N H sing N N 149 LYS N H2 sing N N 150 LYS CA C sing N N 151 LYS CA CB sing N N 152 LYS CA HA sing N N 153 LYS C O doub N N 154 LYS C OXT sing N N 155 LYS CB CG sing N N 156 LYS CB HB2 sing N N 157 LYS CB HB3 sing N N 158 LYS CG CD sing N N 159 LYS CG HG2 sing N N 160 LYS CG HG3 sing N N 161 LYS CD CE sing N N 162 LYS CD HD2 sing N N 163 LYS CD HD3 sing N N 164 LYS CE NZ sing N N 165 LYS CE HE2 sing N N 166 LYS CE HE3 sing N N 167 LYS NZ HZ1 sing N N 168 LYS NZ HZ2 sing N N 169 LYS NZ HZ3 sing N N 170 LYS OXT HXT sing N N 171 PHE N CA sing N N 172 PHE N H sing N N 173 PHE N H2 sing N N 174 PHE CA C sing N N 175 PHE CA CB sing N N 176 PHE CA HA sing N N 177 PHE C O doub N N 178 PHE C OXT sing N N 179 PHE CB CG sing N N 180 PHE CB HB2 sing N N 181 PHE CB HB3 sing N N 182 PHE CG CD1 doub Y N 183 PHE CG CD2 sing Y N 184 PHE CD1 CE1 sing Y N 185 PHE CD1 HD1 sing N N 186 PHE CD2 CE2 doub Y N 187 PHE CD2 HD2 sing N N 188 PHE CE1 CZ doub Y N 189 PHE CE1 HE1 sing N N 190 PHE CE2 CZ sing Y N 191 PHE CE2 HE2 sing N N 192 PHE CZ HZ sing N N 193 PHE OXT HXT sing N N 194 PRO N CA sing N N 195 PRO N CD sing N N 196 PRO N H sing N N 197 PRO CA C sing N N 198 PRO CA CB sing N N 199 PRO CA HA sing N N 200 PRO C O doub N N 201 PRO C OXT sing N N 202 PRO CB CG sing N N 203 PRO CB HB2 sing N N 204 PRO CB HB3 sing N N 205 PRO CG CD sing N N 206 PRO CG HG2 sing N N 207 PRO CG HG3 sing N N 208 PRO CD HD2 sing N N 209 PRO CD HD3 sing N N 210 PRO OXT HXT sing N N 211 SER N CA sing N N 212 SER N H sing N N 213 SER N H2 sing N N 214 SER CA C sing N N 215 SER CA CB sing N N 216 SER CA HA sing N N 217 SER C O doub N N 218 SER C OXT sing N N 219 SER CB OG sing N N 220 SER CB HB2 sing N N 221 SER CB HB3 sing N N 222 SER OG HG sing N N 223 SER OXT HXT sing N N 224 THR N CA sing N N 225 THR N H sing N N 226 THR N H2 sing N N 227 THR CA C sing N N 228 THR CA CB sing N N 229 THR CA HA sing N N 230 THR C O doub N N 231 THR C OXT sing N N 232 THR CB OG1 sing N N 233 THR CB CG2 sing N N 234 THR CB HB sing N N 235 THR OG1 HG1 sing N N 236 THR CG2 HG21 sing N N 237 THR CG2 HG22 sing N N 238 THR CG2 HG23 sing N N 239 THR OXT HXT sing N N 240 VAL N CA sing N N 241 VAL N H sing N N 242 VAL N H2 sing N N 243 VAL CA C sing N N 244 VAL CA CB sing N N 245 VAL CA HA sing N N 246 VAL C O doub N N 247 VAL C OXT sing N N 248 VAL CB CG1 sing N N 249 VAL CB CG2 sing N N 250 VAL CB HB sing N N 251 VAL CG1 HG11 sing N N 252 VAL CG1 HG12 sing N N 253 VAL CG1 HG13 sing N N 254 VAL CG2 HG21 sing N N 255 VAL CG2 HG22 sing N N 256 VAL CG2 HG23 sing N N 257 VAL OXT HXT sing N N 258 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id CL _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id CL _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5NNM _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7PDC _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.018832 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.005528 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019448 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.039748 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CL N O # loop_