data_7PH8 # _entry.id 7PH8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.394 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7PH8 pdb_00007ph8 10.2210/pdb7ph8/pdb WWPDB D_1292117251 ? ? BMRB 34656 ? 10.13018/BMR34656 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-08-24 2 'Structure model' 1 1 2024-06-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 2 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7PH8 _pdbx_database_status.recvd_initial_deposition_date 2021-08-16 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details ;Structure of Insulin-like growth factor 1 receptor's transmembrane domain ; _pdbx_database_related.db_id 34656 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Bershatsky, Y.V.' 1 ? 'Nadezhdin, K.D.' 2 ? 'Bocharova, O.V.' 3 ? 'Bocharov, E.V.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Structure of Insulin-like growth factor 1 receptor's transmembrane domain ; _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bershatsky, Y.V.' 1 ? primary 'Nadezhdin, K.D.' 2 ? primary 'Bocharova, O.V.' 3 ? primary 'Bocharov, E.V.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Insulin-like growth factor 1 receptor' _entity.formula_weight 3534.460 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 2.7.10.1 _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Insulin-like growth factor I receptor,IGF-I receptor' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code NFIHLIIALPVAVLLIVGGLVIMLYVFHRKR _entity_poly.pdbx_seq_one_letter_code_can NFIHLIIALPVAVLLIVGGLVIMLYVFHRKR _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASN n 1 2 PHE n 1 3 ILE n 1 4 HIS n 1 5 LEU n 1 6 ILE n 1 7 ILE n 1 8 ALA n 1 9 LEU n 1 10 PRO n 1 11 VAL n 1 12 ALA n 1 13 VAL n 1 14 LEU n 1 15 LEU n 1 16 ILE n 1 17 VAL n 1 18 GLY n 1 19 GLY n 1 20 LEU n 1 21 VAL n 1 22 ILE n 1 23 MET n 1 24 LEU n 1 25 TYR n 1 26 VAL n 1 27 PHE n 1 28 HIS n 1 29 ARG n 1 30 LYS n 1 31 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 31 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene IGF1R _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASN 1 932 932 ASN ASN A . n A 1 2 PHE 2 933 933 PHE PHE A . n A 1 3 ILE 3 934 934 ILE ILE A . n A 1 4 HIS 4 935 935 HIS HIS A . n A 1 5 LEU 5 936 936 LEU LEU A . n A 1 6 ILE 6 937 937 ILE ILE A . n A 1 7 ILE 7 938 938 ILE ILE A . n A 1 8 ALA 8 939 939 ALA ALA A . n A 1 9 LEU 9 940 940 LEU LEU A . n A 1 10 PRO 10 941 941 PRO PRO A . n A 1 11 VAL 11 942 942 VAL VAL A . n A 1 12 ALA 12 943 943 ALA ALA A . n A 1 13 VAL 13 944 944 VAL VAL A . n A 1 14 LEU 14 945 945 LEU LEU A . n A 1 15 LEU 15 946 946 LEU LEU A . n A 1 16 ILE 16 947 947 ILE ILE A . n A 1 17 VAL 17 948 948 VAL VAL A . n A 1 18 GLY 18 949 949 GLY GLY A . n A 1 19 GLY 19 950 950 GLY GLY A . n A 1 20 LEU 20 951 951 LEU LEU A . n A 1 21 VAL 21 952 952 VAL VAL A . n A 1 22 ILE 22 953 953 ILE ILE A . n A 1 23 MET 23 954 954 MET MET A . n A 1 24 LEU 24 955 955 LEU LEU A . n A 1 25 TYR 25 956 956 TYR TYR A . n A 1 26 VAL 26 957 957 VAL VAL A . n A 1 27 PHE 27 958 958 PHE PHE A . n A 1 28 HIS 28 959 959 HIS HIS A . n A 1 29 ARG 29 960 960 ARG ARG A . n A 1 30 LYS 30 961 961 LYS LYS A . n A 1 31 ARG 31 962 962 ARG ARG A . n # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 7PH8 _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.000 _cell.length_a_esd ? _cell.length_b 1.000 _cell.length_b_esd ? _cell.length_c 1.000 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7PH8 _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7PH8 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _database_PDB_matrix.entry_id 7PH8 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 7PH8 _struct.title ;Structure of Insulin-like growth factor 1 receptor's transmembrane domain ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7PH8 _struct_keywords.text 'PROTEIN, TRANSMEMBRANE DOMAIN, Insulin-like growth factor 1 receptor, RECEPTOR, IGF1R, Transferase' _struct_keywords.pdbx_keywords TRANSFERASE # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code IGF1R_HUMAN _struct_ref.pdbx_db_accession P08069 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code NFIHLIIALPVAVLLIVGGLVIMLYVFHRKR _struct_ref.pdbx_align_begin 932 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7PH8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 31 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P08069 _struct_ref_seq.db_align_beg 932 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 962 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 932 _struct_ref_seq.pdbx_auth_seq_align_end 962 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 3490 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id ASN _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 1 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LYS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 30 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASN _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 932 _struct_conf.end_auth_comp_id LYS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 961 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 30 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _pdbx_nmr_ensemble.entry_id 7PH8 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7PH8 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'target function' # _pdbx_nmr_sample_details.solution_id 3 _pdbx_nmr_sample_details.contents '0.5 mM [U-100% 13C; U-100% 15N] IGF1Rtm, 100 mM [U-99% 2H] DPC, 0.3 mM sodium azide, 30 mM KH2PO4, 20 mM K2HPO4, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' _pdbx_nmr_sample_details.label '13C 15N' _pdbx_nmr_sample_details.type micelle _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 3 IGF1Rtm 0.5 ? mM '[U-100% 13C; U-100% 15N]' 3 DPC 100 ? mM '[U-99% 2H]' 3 'sodium azide' 0.3 ? mM 'natural abundance' 3 KH2PO4 30 ? mM 'natural abundance' 3 K2HPO4 20 ? mM 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 313 _pdbx_nmr_exptl_sample_conditions.pressure_units Pa _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 6.7 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.1 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units M _pdbx_nmr_exptl_sample_conditions.label conditions _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 3 '2D 1H-15N HSQC' 1 isotropic 2 1 3 '2D 1H-15N TROSY' 1 isotropic 3 1 3 '2D 1H-13C CT HSQC' 1 isotropic 4 1 3 '2D 1H-13C HSQC' 1 isotropic 5 1 3 '3D CBCA(CO)NH' 1 isotropic 6 1 3 '3D HNCO' 1 isotropic 7 1 3 '3D HNCA' 1 isotropic 8 1 3 '3D HN(CO)CA' 1 isotropic 9 1 3 '3D HCCH-TOCSY' 1 isotropic 10 1 3 '3D 1H-15N NOESY' 1 isotropic 11 1 3 '2D 1H-13C HSQC aromatic' 1 isotropic 12 1 3 '3D 1H-13C NOESY aromatic' 1 isotropic # _pdbx_nmr_refine.entry_id 7PH8 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CYANA ? 'Guntert, Mumenthaler and Wuthrich' 2 'peak picking' CARA ? 'Keller and Wuthrich' 3 collection TopSpin ? 'Bruker Biospin' 4 'chemical shift assignment' CARA ? 'Keller and Wuthrich' 5 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 6 processing TALOS ? 'Cornilescu, Delaglio and Bax' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 GLY N N N N 58 GLY CA C N N 59 GLY C C N N 60 GLY O O N N 61 GLY OXT O N N 62 GLY H H N N 63 GLY H2 H N N 64 GLY HA2 H N N 65 GLY HA3 H N N 66 GLY HXT H N N 67 HIS N N N N 68 HIS CA C N S 69 HIS C C N N 70 HIS O O N N 71 HIS CB C N N 72 HIS CG C Y N 73 HIS ND1 N Y N 74 HIS CD2 C Y N 75 HIS CE1 C Y N 76 HIS NE2 N Y N 77 HIS OXT O N N 78 HIS H H N N 79 HIS H2 H N N 80 HIS HA H N N 81 HIS HB2 H N N 82 HIS HB3 H N N 83 HIS HD1 H N N 84 HIS HD2 H N N 85 HIS HE1 H N N 86 HIS HE2 H N N 87 HIS HXT H N N 88 ILE N N N N 89 ILE CA C N S 90 ILE C C N N 91 ILE O O N N 92 ILE CB C N S 93 ILE CG1 C N N 94 ILE CG2 C N N 95 ILE CD1 C N N 96 ILE OXT O N N 97 ILE H H N N 98 ILE H2 H N N 99 ILE HA H N N 100 ILE HB H N N 101 ILE HG12 H N N 102 ILE HG13 H N N 103 ILE HG21 H N N 104 ILE HG22 H N N 105 ILE HG23 H N N 106 ILE HD11 H N N 107 ILE HD12 H N N 108 ILE HD13 H N N 109 ILE HXT H N N 110 LEU N N N N 111 LEU CA C N S 112 LEU C C N N 113 LEU O O N N 114 LEU CB C N N 115 LEU CG C N N 116 LEU CD1 C N N 117 LEU CD2 C N N 118 LEU OXT O N N 119 LEU H H N N 120 LEU H2 H N N 121 LEU HA H N N 122 LEU HB2 H N N 123 LEU HB3 H N N 124 LEU HG H N N 125 LEU HD11 H N N 126 LEU HD12 H N N 127 LEU HD13 H N N 128 LEU HD21 H N N 129 LEU HD22 H N N 130 LEU HD23 H N N 131 LEU HXT H N N 132 LYS N N N N 133 LYS CA C N S 134 LYS C C N N 135 LYS O O N N 136 LYS CB C N N 137 LYS CG C N N 138 LYS CD C N N 139 LYS CE C N N 140 LYS NZ N N N 141 LYS OXT O N N 142 LYS H H N N 143 LYS H2 H N N 144 LYS HA H N N 145 LYS HB2 H N N 146 LYS HB3 H N N 147 LYS HG2 H N N 148 LYS HG3 H N N 149 LYS HD2 H N N 150 LYS HD3 H N N 151 LYS HE2 H N N 152 LYS HE3 H N N 153 LYS HZ1 H N N 154 LYS HZ2 H N N 155 LYS HZ3 H N N 156 LYS HXT H N N 157 MET N N N N 158 MET CA C N S 159 MET C C N N 160 MET O O N N 161 MET CB C N N 162 MET CG C N N 163 MET SD S N N 164 MET CE C N N 165 MET OXT O N N 166 MET H H N N 167 MET H2 H N N 168 MET HA H N N 169 MET HB2 H N N 170 MET HB3 H N N 171 MET HG2 H N N 172 MET HG3 H N N 173 MET HE1 H N N 174 MET HE2 H N N 175 MET HE3 H N N 176 MET HXT H N N 177 PHE N N N N 178 PHE CA C N S 179 PHE C C N N 180 PHE O O N N 181 PHE CB C N N 182 PHE CG C Y N 183 PHE CD1 C Y N 184 PHE CD2 C Y N 185 PHE CE1 C Y N 186 PHE CE2 C Y N 187 PHE CZ C Y N 188 PHE OXT O N N 189 PHE H H N N 190 PHE H2 H N N 191 PHE HA H N N 192 PHE HB2 H N N 193 PHE HB3 H N N 194 PHE HD1 H N N 195 PHE HD2 H N N 196 PHE HE1 H N N 197 PHE HE2 H N N 198 PHE HZ H N N 199 PHE HXT H N N 200 PRO N N N N 201 PRO CA C N S 202 PRO C C N N 203 PRO O O N N 204 PRO CB C N N 205 PRO CG C N N 206 PRO CD C N N 207 PRO OXT O N N 208 PRO H H N N 209 PRO HA H N N 210 PRO HB2 H N N 211 PRO HB3 H N N 212 PRO HG2 H N N 213 PRO HG3 H N N 214 PRO HD2 H N N 215 PRO HD3 H N N 216 PRO HXT H N N 217 TYR N N N N 218 TYR CA C N S 219 TYR C C N N 220 TYR O O N N 221 TYR CB C N N 222 TYR CG C Y N 223 TYR CD1 C Y N 224 TYR CD2 C Y N 225 TYR CE1 C Y N 226 TYR CE2 C Y N 227 TYR CZ C Y N 228 TYR OH O N N 229 TYR OXT O N N 230 TYR H H N N 231 TYR H2 H N N 232 TYR HA H N N 233 TYR HB2 H N N 234 TYR HB3 H N N 235 TYR HD1 H N N 236 TYR HD2 H N N 237 TYR HE1 H N N 238 TYR HE2 H N N 239 TYR HH H N N 240 TYR HXT H N N 241 VAL N N N N 242 VAL CA C N S 243 VAL C C N N 244 VAL O O N N 245 VAL CB C N N 246 VAL CG1 C N N 247 VAL CG2 C N N 248 VAL OXT O N N 249 VAL H H N N 250 VAL H2 H N N 251 VAL HA H N N 252 VAL HB H N N 253 VAL HG11 H N N 254 VAL HG12 H N N 255 VAL HG13 H N N 256 VAL HG21 H N N 257 VAL HG22 H N N 258 VAL HG23 H N N 259 VAL HXT H N N 260 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 GLY N CA sing N N 55 GLY N H sing N N 56 GLY N H2 sing N N 57 GLY CA C sing N N 58 GLY CA HA2 sing N N 59 GLY CA HA3 sing N N 60 GLY C O doub N N 61 GLY C OXT sing N N 62 GLY OXT HXT sing N N 63 HIS N CA sing N N 64 HIS N H sing N N 65 HIS N H2 sing N N 66 HIS CA C sing N N 67 HIS CA CB sing N N 68 HIS CA HA sing N N 69 HIS C O doub N N 70 HIS C OXT sing N N 71 HIS CB CG sing N N 72 HIS CB HB2 sing N N 73 HIS CB HB3 sing N N 74 HIS CG ND1 sing Y N 75 HIS CG CD2 doub Y N 76 HIS ND1 CE1 doub Y N 77 HIS ND1 HD1 sing N N 78 HIS CD2 NE2 sing Y N 79 HIS CD2 HD2 sing N N 80 HIS CE1 NE2 sing Y N 81 HIS CE1 HE1 sing N N 82 HIS NE2 HE2 sing N N 83 HIS OXT HXT sing N N 84 ILE N CA sing N N 85 ILE N H sing N N 86 ILE N H2 sing N N 87 ILE CA C sing N N 88 ILE CA CB sing N N 89 ILE CA HA sing N N 90 ILE C O doub N N 91 ILE C OXT sing N N 92 ILE CB CG1 sing N N 93 ILE CB CG2 sing N N 94 ILE CB HB sing N N 95 ILE CG1 CD1 sing N N 96 ILE CG1 HG12 sing N N 97 ILE CG1 HG13 sing N N 98 ILE CG2 HG21 sing N N 99 ILE CG2 HG22 sing N N 100 ILE CG2 HG23 sing N N 101 ILE CD1 HD11 sing N N 102 ILE CD1 HD12 sing N N 103 ILE CD1 HD13 sing N N 104 ILE OXT HXT sing N N 105 LEU N CA sing N N 106 LEU N H sing N N 107 LEU N H2 sing N N 108 LEU CA C sing N N 109 LEU CA CB sing N N 110 LEU CA HA sing N N 111 LEU C O doub N N 112 LEU C OXT sing N N 113 LEU CB CG sing N N 114 LEU CB HB2 sing N N 115 LEU CB HB3 sing N N 116 LEU CG CD1 sing N N 117 LEU CG CD2 sing N N 118 LEU CG HG sing N N 119 LEU CD1 HD11 sing N N 120 LEU CD1 HD12 sing N N 121 LEU CD1 HD13 sing N N 122 LEU CD2 HD21 sing N N 123 LEU CD2 HD22 sing N N 124 LEU CD2 HD23 sing N N 125 LEU OXT HXT sing N N 126 LYS N CA sing N N 127 LYS N H sing N N 128 LYS N H2 sing N N 129 LYS CA C sing N N 130 LYS CA CB sing N N 131 LYS CA HA sing N N 132 LYS C O doub N N 133 LYS C OXT sing N N 134 LYS CB CG sing N N 135 LYS CB HB2 sing N N 136 LYS CB HB3 sing N N 137 LYS CG CD sing N N 138 LYS CG HG2 sing N N 139 LYS CG HG3 sing N N 140 LYS CD CE sing N N 141 LYS CD HD2 sing N N 142 LYS CD HD3 sing N N 143 LYS CE NZ sing N N 144 LYS CE HE2 sing N N 145 LYS CE HE3 sing N N 146 LYS NZ HZ1 sing N N 147 LYS NZ HZ2 sing N N 148 LYS NZ HZ3 sing N N 149 LYS OXT HXT sing N N 150 MET N CA sing N N 151 MET N H sing N N 152 MET N H2 sing N N 153 MET CA C sing N N 154 MET CA CB sing N N 155 MET CA HA sing N N 156 MET C O doub N N 157 MET C OXT sing N N 158 MET CB CG sing N N 159 MET CB HB2 sing N N 160 MET CB HB3 sing N N 161 MET CG SD sing N N 162 MET CG HG2 sing N N 163 MET CG HG3 sing N N 164 MET SD CE sing N N 165 MET CE HE1 sing N N 166 MET CE HE2 sing N N 167 MET CE HE3 sing N N 168 MET OXT HXT sing N N 169 PHE N CA sing N N 170 PHE N H sing N N 171 PHE N H2 sing N N 172 PHE CA C sing N N 173 PHE CA CB sing N N 174 PHE CA HA sing N N 175 PHE C O doub N N 176 PHE C OXT sing N N 177 PHE CB CG sing N N 178 PHE CB HB2 sing N N 179 PHE CB HB3 sing N N 180 PHE CG CD1 doub Y N 181 PHE CG CD2 sing Y N 182 PHE CD1 CE1 sing Y N 183 PHE CD1 HD1 sing N N 184 PHE CD2 CE2 doub Y N 185 PHE CD2 HD2 sing N N 186 PHE CE1 CZ doub Y N 187 PHE CE1 HE1 sing N N 188 PHE CE2 CZ sing Y N 189 PHE CE2 HE2 sing N N 190 PHE CZ HZ sing N N 191 PHE OXT HXT sing N N 192 PRO N CA sing N N 193 PRO N CD sing N N 194 PRO N H sing N N 195 PRO CA C sing N N 196 PRO CA CB sing N N 197 PRO CA HA sing N N 198 PRO C O doub N N 199 PRO C OXT sing N N 200 PRO CB CG sing N N 201 PRO CB HB2 sing N N 202 PRO CB HB3 sing N N 203 PRO CG CD sing N N 204 PRO CG HG2 sing N N 205 PRO CG HG3 sing N N 206 PRO CD HD2 sing N N 207 PRO CD HD3 sing N N 208 PRO OXT HXT sing N N 209 TYR N CA sing N N 210 TYR N H sing N N 211 TYR N H2 sing N N 212 TYR CA C sing N N 213 TYR CA CB sing N N 214 TYR CA HA sing N N 215 TYR C O doub N N 216 TYR C OXT sing N N 217 TYR CB CG sing N N 218 TYR CB HB2 sing N N 219 TYR CB HB3 sing N N 220 TYR CG CD1 doub Y N 221 TYR CG CD2 sing Y N 222 TYR CD1 CE1 sing Y N 223 TYR CD1 HD1 sing N N 224 TYR CD2 CE2 doub Y N 225 TYR CD2 HD2 sing N N 226 TYR CE1 CZ doub Y N 227 TYR CE1 HE1 sing N N 228 TYR CE2 CZ sing Y N 229 TYR CE2 HE2 sing N N 230 TYR CZ OH sing N N 231 TYR OH HH sing N N 232 TYR OXT HXT sing N N 233 VAL N CA sing N N 234 VAL N H sing N N 235 VAL N H2 sing N N 236 VAL CA C sing N N 237 VAL CA CB sing N N 238 VAL CA HA sing N N 239 VAL C O doub N N 240 VAL C OXT sing N N 241 VAL CB CG1 sing N N 242 VAL CB CG2 sing N N 243 VAL CB HB sing N N 244 VAL CG1 HG11 sing N N 245 VAL CG1 HG12 sing N N 246 VAL CG1 HG13 sing N N 247 VAL CG2 HG21 sing N N 248 VAL CG2 HG22 sing N N 249 VAL CG2 HG23 sing N N 250 VAL OXT HXT sing N N 251 # _pdbx_audit_support.funding_organization 'Russian Science Foundation' _pdbx_audit_support.country 'Russian Federation' _pdbx_audit_support.grant_number 18-14-00375 _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 7PH8 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #