data_7PHT # _entry.id 7PHT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.394 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7PHT pdb_00007pht 10.2210/pdb7pht/pdb WWPDB D_1292117697 ? ? BMRB 34657 ? 10.13018/BMR34657 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-09-07 2 'Structure model' 1 1 2024-06-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 2 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7PHT _pdbx_database_status.recvd_initial_deposition_date 2021-08-18 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details ;Structure of Insulin-like growth factor 1 receptor's transmembrane domain ; _pdbx_database_related.db_id 34657 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Bershatsky, Y.V.' 1 ? 'Nadezhdin, K.D.' 2 ? 'Bocharova, O.V.' 3 ? 'Bocharov, E.V.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Structure of Insulin receptor's transmembrane domain ; _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bershatsky, Y.V.' 1 ? primary 'Nadezhdin, K.D.' 2 ? primary 'Bocharova, O.V.' 3 ? primary 'Bocharov, E.V.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Isoform Long of Insulin receptor' _entity.formula_weight 3455.314 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 2.7.10.1 _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name IR # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code NIAKIIIGPLIFVFLFSVVIGSIYLFLRKR _entity_poly.pdbx_seq_one_letter_code_can NIAKIIIGPLIFVFLFSVVIGSIYLFLRKR _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASN n 1 2 ILE n 1 3 ALA n 1 4 LYS n 1 5 ILE n 1 6 ILE n 1 7 ILE n 1 8 GLY n 1 9 PRO n 1 10 LEU n 1 11 ILE n 1 12 PHE n 1 13 VAL n 1 14 PHE n 1 15 LEU n 1 16 PHE n 1 17 SER n 1 18 VAL n 1 19 VAL n 1 20 ILE n 1 21 GLY n 1 22 SER n 1 23 ILE n 1 24 TYR n 1 25 LEU n 1 26 PHE n 1 27 LEU n 1 28 ARG n 1 29 LYS n 1 30 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 30 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene INSR _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASN 1 953 953 ASN ASN A . n A 1 2 ILE 2 954 954 ILE ILE A . n A 1 3 ALA 3 955 955 ALA ALA A . n A 1 4 LYS 4 956 956 LYS LYS A . n A 1 5 ILE 5 957 957 ILE ILE A . n A 1 6 ILE 6 958 958 ILE ILE A . n A 1 7 ILE 7 959 959 ILE ILE A . n A 1 8 GLY 8 960 960 GLY GLY A . n A 1 9 PRO 9 961 961 PRO PRO A . n A 1 10 LEU 10 962 962 LEU LEU A . n A 1 11 ILE 11 963 963 ILE ILE A . n A 1 12 PHE 12 964 964 PHE PHE A . n A 1 13 VAL 13 965 965 VAL VAL A . n A 1 14 PHE 14 966 966 PHE PHE A . n A 1 15 LEU 15 967 967 LEU LEU A . n A 1 16 PHE 16 968 968 PHE PHE A . n A 1 17 SER 17 969 969 SER SER A . n A 1 18 VAL 18 970 970 VAL VAL A . n A 1 19 VAL 19 971 971 VAL VAL A . n A 1 20 ILE 20 972 972 ILE ILE A . n A 1 21 GLY 21 973 973 GLY GLY A . n A 1 22 SER 22 974 974 SER SER A . n A 1 23 ILE 23 975 975 ILE ILE A . n A 1 24 TYR 24 976 976 TYR TYR A . n A 1 25 LEU 25 977 977 LEU LEU A . n A 1 26 PHE 26 978 978 PHE PHE A . n A 1 27 LEU 27 979 979 LEU LEU A . n A 1 28 ARG 28 980 980 ARG ARG A . n A 1 29 LYS 29 981 981 LYS LYS A . n A 1 30 ARG 30 982 982 ARG ARG A . n # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 7PHT _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.000 _cell.length_a_esd ? _cell.length_b 1.000 _cell.length_b_esd ? _cell.length_c 1.000 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7PHT _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7PHT _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _database_PDB_matrix.entry_id 7PHT _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 7PHT _struct.title ;Structure of Insulin receptor's transmembrane domain ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7PHT _struct_keywords.text 'PROTEIN, TRANSMEMBRANE DOMAIN, Insulin receptor, RECEPTOR, InsR, SIGNALING PROTEIN, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code INSR-1_HUMAN _struct_ref.pdbx_db_accession P06213-1 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code NIAKIIIGPLIFVFLFSVVIGSIYLFLRKR _struct_ref.pdbx_align_begin 953 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7PHT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 30 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P06213-1 _struct_ref_seq.db_align_beg 953 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 982 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 953 _struct_ref_seq.pdbx_auth_seq_align_end 982 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 3420 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id ILE _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 2 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LYS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 29 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ILE _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 954 _struct_conf.end_auth_comp_id LYS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 981 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 28 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 6 _pdbx_validate_torsion.auth_comp_id LYS _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 981 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -65.97 _pdbx_validate_torsion.psi 99.57 # _pdbx_nmr_ensemble.entry_id 7PHT _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7PHT _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'target function' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.5 mM [U-100% 13C; U-100% 15N] InsRtm, 100 mM [U-99% 2H] DPC, 0.3 mM sodium azide, 30 mM KH2PO4, 20 mM K2HPO4, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' _pdbx_nmr_sample_details.label '13C 15N' _pdbx_nmr_sample_details.type micelle _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 InsRtm 0.5 ? mM '[U-100% 13C; U-100% 15N]' 1 DPC 100 ? mM '[U-99% 2H]' 1 'sodium azide' 0.3 ? mM 'natural abundance' 1 KH2PO4 30 ? mM 'natural abundance' 1 K2HPO4 20 ? mM 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 313 _pdbx_nmr_exptl_sample_conditions.pressure_units Pa _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 6.7 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.1 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units M _pdbx_nmr_exptl_sample_conditions.label conditions _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '2D 1H-1H TROSY' 1 isotropic 3 1 1 '2D 1H-13C CT HSQC' 1 isotropic 4 1 1 '2D 1H-13C HSQC' 1 isotropic 5 1 1 '3D HNCA' 1 isotropic 11 1 1 '3D HNCO' 1 anisotropic 10 1 1 '3D HN(CO)CA' 1 anisotropic 9 1 1 '3D CBCA(CO)NH' 1 anisotropic 8 1 1 '3D HCCH-TOCSY' 1 anisotropic 7 1 1 '2D 1H-13C HSQC aromatic' 1 anisotropic 6 1 1 '3D 1H-15N NOESY' 1 anisotropic 12 1 1 '3D 1H-13C NOESY aromatic' 1 anisotropic # _pdbx_nmr_refine.entry_id 7PHT _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CYANA ? 'Guntert, Mumenthaler and Wuthrich' 2 'peak picking' CARA ? 'Keller and Wuthrich' 3 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 4 'chemical shift assignment' CARA ? 'Keller and Wuthrich' 5 collection TopSpin ? 'Bruker Biospin' 6 processing TALOS ? 'Cornilescu, Delaglio and Bax' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 GLY N N N N 58 GLY CA C N N 59 GLY C C N N 60 GLY O O N N 61 GLY OXT O N N 62 GLY H H N N 63 GLY H2 H N N 64 GLY HA2 H N N 65 GLY HA3 H N N 66 GLY HXT H N N 67 ILE N N N N 68 ILE CA C N S 69 ILE C C N N 70 ILE O O N N 71 ILE CB C N S 72 ILE CG1 C N N 73 ILE CG2 C N N 74 ILE CD1 C N N 75 ILE OXT O N N 76 ILE H H N N 77 ILE H2 H N N 78 ILE HA H N N 79 ILE HB H N N 80 ILE HG12 H N N 81 ILE HG13 H N N 82 ILE HG21 H N N 83 ILE HG22 H N N 84 ILE HG23 H N N 85 ILE HD11 H N N 86 ILE HD12 H N N 87 ILE HD13 H N N 88 ILE HXT H N N 89 LEU N N N N 90 LEU CA C N S 91 LEU C C N N 92 LEU O O N N 93 LEU CB C N N 94 LEU CG C N N 95 LEU CD1 C N N 96 LEU CD2 C N N 97 LEU OXT O N N 98 LEU H H N N 99 LEU H2 H N N 100 LEU HA H N N 101 LEU HB2 H N N 102 LEU HB3 H N N 103 LEU HG H N N 104 LEU HD11 H N N 105 LEU HD12 H N N 106 LEU HD13 H N N 107 LEU HD21 H N N 108 LEU HD22 H N N 109 LEU HD23 H N N 110 LEU HXT H N N 111 LYS N N N N 112 LYS CA C N S 113 LYS C C N N 114 LYS O O N N 115 LYS CB C N N 116 LYS CG C N N 117 LYS CD C N N 118 LYS CE C N N 119 LYS NZ N N N 120 LYS OXT O N N 121 LYS H H N N 122 LYS H2 H N N 123 LYS HA H N N 124 LYS HB2 H N N 125 LYS HB3 H N N 126 LYS HG2 H N N 127 LYS HG3 H N N 128 LYS HD2 H N N 129 LYS HD3 H N N 130 LYS HE2 H N N 131 LYS HE3 H N N 132 LYS HZ1 H N N 133 LYS HZ2 H N N 134 LYS HZ3 H N N 135 LYS HXT H N N 136 PHE N N N N 137 PHE CA C N S 138 PHE C C N N 139 PHE O O N N 140 PHE CB C N N 141 PHE CG C Y N 142 PHE CD1 C Y N 143 PHE CD2 C Y N 144 PHE CE1 C Y N 145 PHE CE2 C Y N 146 PHE CZ C Y N 147 PHE OXT O N N 148 PHE H H N N 149 PHE H2 H N N 150 PHE HA H N N 151 PHE HB2 H N N 152 PHE HB3 H N N 153 PHE HD1 H N N 154 PHE HD2 H N N 155 PHE HE1 H N N 156 PHE HE2 H N N 157 PHE HZ H N N 158 PHE HXT H N N 159 PRO N N N N 160 PRO CA C N S 161 PRO C C N N 162 PRO O O N N 163 PRO CB C N N 164 PRO CG C N N 165 PRO CD C N N 166 PRO OXT O N N 167 PRO H H N N 168 PRO HA H N N 169 PRO HB2 H N N 170 PRO HB3 H N N 171 PRO HG2 H N N 172 PRO HG3 H N N 173 PRO HD2 H N N 174 PRO HD3 H N N 175 PRO HXT H N N 176 SER N N N N 177 SER CA C N S 178 SER C C N N 179 SER O O N N 180 SER CB C N N 181 SER OG O N N 182 SER OXT O N N 183 SER H H N N 184 SER H2 H N N 185 SER HA H N N 186 SER HB2 H N N 187 SER HB3 H N N 188 SER HG H N N 189 SER HXT H N N 190 TYR N N N N 191 TYR CA C N S 192 TYR C C N N 193 TYR O O N N 194 TYR CB C N N 195 TYR CG C Y N 196 TYR CD1 C Y N 197 TYR CD2 C Y N 198 TYR CE1 C Y N 199 TYR CE2 C Y N 200 TYR CZ C Y N 201 TYR OH O N N 202 TYR OXT O N N 203 TYR H H N N 204 TYR H2 H N N 205 TYR HA H N N 206 TYR HB2 H N N 207 TYR HB3 H N N 208 TYR HD1 H N N 209 TYR HD2 H N N 210 TYR HE1 H N N 211 TYR HE2 H N N 212 TYR HH H N N 213 TYR HXT H N N 214 VAL N N N N 215 VAL CA C N S 216 VAL C C N N 217 VAL O O N N 218 VAL CB C N N 219 VAL CG1 C N N 220 VAL CG2 C N N 221 VAL OXT O N N 222 VAL H H N N 223 VAL H2 H N N 224 VAL HA H N N 225 VAL HB H N N 226 VAL HG11 H N N 227 VAL HG12 H N N 228 VAL HG13 H N N 229 VAL HG21 H N N 230 VAL HG22 H N N 231 VAL HG23 H N N 232 VAL HXT H N N 233 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 GLY N CA sing N N 55 GLY N H sing N N 56 GLY N H2 sing N N 57 GLY CA C sing N N 58 GLY CA HA2 sing N N 59 GLY CA HA3 sing N N 60 GLY C O doub N N 61 GLY C OXT sing N N 62 GLY OXT HXT sing N N 63 ILE N CA sing N N 64 ILE N H sing N N 65 ILE N H2 sing N N 66 ILE CA C sing N N 67 ILE CA CB sing N N 68 ILE CA HA sing N N 69 ILE C O doub N N 70 ILE C OXT sing N N 71 ILE CB CG1 sing N N 72 ILE CB CG2 sing N N 73 ILE CB HB sing N N 74 ILE CG1 CD1 sing N N 75 ILE CG1 HG12 sing N N 76 ILE CG1 HG13 sing N N 77 ILE CG2 HG21 sing N N 78 ILE CG2 HG22 sing N N 79 ILE CG2 HG23 sing N N 80 ILE CD1 HD11 sing N N 81 ILE CD1 HD12 sing N N 82 ILE CD1 HD13 sing N N 83 ILE OXT HXT sing N N 84 LEU N CA sing N N 85 LEU N H sing N N 86 LEU N H2 sing N N 87 LEU CA C sing N N 88 LEU CA CB sing N N 89 LEU CA HA sing N N 90 LEU C O doub N N 91 LEU C OXT sing N N 92 LEU CB CG sing N N 93 LEU CB HB2 sing N N 94 LEU CB HB3 sing N N 95 LEU CG CD1 sing N N 96 LEU CG CD2 sing N N 97 LEU CG HG sing N N 98 LEU CD1 HD11 sing N N 99 LEU CD1 HD12 sing N N 100 LEU CD1 HD13 sing N N 101 LEU CD2 HD21 sing N N 102 LEU CD2 HD22 sing N N 103 LEU CD2 HD23 sing N N 104 LEU OXT HXT sing N N 105 LYS N CA sing N N 106 LYS N H sing N N 107 LYS N H2 sing N N 108 LYS CA C sing N N 109 LYS CA CB sing N N 110 LYS CA HA sing N N 111 LYS C O doub N N 112 LYS C OXT sing N N 113 LYS CB CG sing N N 114 LYS CB HB2 sing N N 115 LYS CB HB3 sing N N 116 LYS CG CD sing N N 117 LYS CG HG2 sing N N 118 LYS CG HG3 sing N N 119 LYS CD CE sing N N 120 LYS CD HD2 sing N N 121 LYS CD HD3 sing N N 122 LYS CE NZ sing N N 123 LYS CE HE2 sing N N 124 LYS CE HE3 sing N N 125 LYS NZ HZ1 sing N N 126 LYS NZ HZ2 sing N N 127 LYS NZ HZ3 sing N N 128 LYS OXT HXT sing N N 129 PHE N CA sing N N 130 PHE N H sing N N 131 PHE N H2 sing N N 132 PHE CA C sing N N 133 PHE CA CB sing N N 134 PHE CA HA sing N N 135 PHE C O doub N N 136 PHE C OXT sing N N 137 PHE CB CG sing N N 138 PHE CB HB2 sing N N 139 PHE CB HB3 sing N N 140 PHE CG CD1 doub Y N 141 PHE CG CD2 sing Y N 142 PHE CD1 CE1 sing Y N 143 PHE CD1 HD1 sing N N 144 PHE CD2 CE2 doub Y N 145 PHE CD2 HD2 sing N N 146 PHE CE1 CZ doub Y N 147 PHE CE1 HE1 sing N N 148 PHE CE2 CZ sing Y N 149 PHE CE2 HE2 sing N N 150 PHE CZ HZ sing N N 151 PHE OXT HXT sing N N 152 PRO N CA sing N N 153 PRO N CD sing N N 154 PRO N H sing N N 155 PRO CA C sing N N 156 PRO CA CB sing N N 157 PRO CA HA sing N N 158 PRO C O doub N N 159 PRO C OXT sing N N 160 PRO CB CG sing N N 161 PRO CB HB2 sing N N 162 PRO CB HB3 sing N N 163 PRO CG CD sing N N 164 PRO CG HG2 sing N N 165 PRO CG HG3 sing N N 166 PRO CD HD2 sing N N 167 PRO CD HD3 sing N N 168 PRO OXT HXT sing N N 169 SER N CA sing N N 170 SER N H sing N N 171 SER N H2 sing N N 172 SER CA C sing N N 173 SER CA CB sing N N 174 SER CA HA sing N N 175 SER C O doub N N 176 SER C OXT sing N N 177 SER CB OG sing N N 178 SER CB HB2 sing N N 179 SER CB HB3 sing N N 180 SER OG HG sing N N 181 SER OXT HXT sing N N 182 TYR N CA sing N N 183 TYR N H sing N N 184 TYR N H2 sing N N 185 TYR CA C sing N N 186 TYR CA CB sing N N 187 TYR CA HA sing N N 188 TYR C O doub N N 189 TYR C OXT sing N N 190 TYR CB CG sing N N 191 TYR CB HB2 sing N N 192 TYR CB HB3 sing N N 193 TYR CG CD1 doub Y N 194 TYR CG CD2 sing Y N 195 TYR CD1 CE1 sing Y N 196 TYR CD1 HD1 sing N N 197 TYR CD2 CE2 doub Y N 198 TYR CD2 HD2 sing N N 199 TYR CE1 CZ doub Y N 200 TYR CE1 HE1 sing N N 201 TYR CE2 CZ sing Y N 202 TYR CE2 HE2 sing N N 203 TYR CZ OH sing N N 204 TYR OH HH sing N N 205 TYR OXT HXT sing N N 206 VAL N CA sing N N 207 VAL N H sing N N 208 VAL N H2 sing N N 209 VAL CA C sing N N 210 VAL CA CB sing N N 211 VAL CA HA sing N N 212 VAL C O doub N N 213 VAL C OXT sing N N 214 VAL CB CG1 sing N N 215 VAL CB CG2 sing N N 216 VAL CB HB sing N N 217 VAL CG1 HG11 sing N N 218 VAL CG1 HG12 sing N N 219 VAL CG1 HG13 sing N N 220 VAL CG2 HG21 sing N N 221 VAL CG2 HG22 sing N N 222 VAL CG2 HG23 sing N N 223 VAL OXT HXT sing N N 224 # _pdbx_audit_support.funding_organization 'Russian Science Foundation' _pdbx_audit_support.country 'Russian Federation' _pdbx_audit_support.grant_number 18-14-00375 _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 7PHT _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O # loop_