data_7PMP # _entry.id 7PMP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.394 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7PMP pdb_00007pmp 10.2210/pdb7pmp/pdb WWPDB D_1292117967 ? ? BMRB 34663 ? 10.13018/BMR34663 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-09-14 2 'Structure model' 1 1 2024-06-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 2 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7PMP _pdbx_database_status.recvd_initial_deposition_date 2021-09-02 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution structure of Legionella pneumophila LspD' _pdbx_database_related.db_id 34663 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Portlock, T.J.' 1 0000-0001-5971-3847 'Garnett, J.A.' 2 0000-0001-7621-8223 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Solution structure of Legionella pneumophila LspD N0' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Portlock, T.J.' 1 0000-0001-5971-3847 primary 'Garnett, J.A.' 2 0000-0001-7621-8223 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Type II protein secretion LspD' _entity.formula_weight 12295.090 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAHHHHHHVDDDDKMGSKLWNLRNADIRAVIAEVSRITGKNFVIDPRVQGKVSIVSSTPLSSRELYQVFLSVLQVSGYAA IPNGEIIKIIPNIDAKTQSPDLLSGMKSPPR ; _entity_poly.pdbx_seq_one_letter_code_can ;MAHHHHHHVDDDDKMGSKLWNLRNADIRAVIAEVSRITGKNFVIDPRVQGKVSIVSSTPLSSRELYQVFLSVLQVSGYAA IPNGEIIKIIPNIDAKTQSPDLLSGMKSPPR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 VAL n 1 10 ASP n 1 11 ASP n 1 12 ASP n 1 13 ASP n 1 14 LYS n 1 15 MET n 1 16 GLY n 1 17 SER n 1 18 LYS n 1 19 LEU n 1 20 TRP n 1 21 ASN n 1 22 LEU n 1 23 ARG n 1 24 ASN n 1 25 ALA n 1 26 ASP n 1 27 ILE n 1 28 ARG n 1 29 ALA n 1 30 VAL n 1 31 ILE n 1 32 ALA n 1 33 GLU n 1 34 VAL n 1 35 SER n 1 36 ARG n 1 37 ILE n 1 38 THR n 1 39 GLY n 1 40 LYS n 1 41 ASN n 1 42 PHE n 1 43 VAL n 1 44 ILE n 1 45 ASP n 1 46 PRO n 1 47 ARG n 1 48 VAL n 1 49 GLN n 1 50 GLY n 1 51 LYS n 1 52 VAL n 1 53 SER n 1 54 ILE n 1 55 VAL n 1 56 SER n 1 57 SER n 1 58 THR n 1 59 PRO n 1 60 LEU n 1 61 SER n 1 62 SER n 1 63 ARG n 1 64 GLU n 1 65 LEU n 1 66 TYR n 1 67 GLN n 1 68 VAL n 1 69 PHE n 1 70 LEU n 1 71 SER n 1 72 VAL n 1 73 LEU n 1 74 GLN n 1 75 VAL n 1 76 SER n 1 77 GLY n 1 78 TYR n 1 79 ALA n 1 80 ALA n 1 81 ILE n 1 82 PRO n 1 83 ASN n 1 84 GLY n 1 85 GLU n 1 86 ILE n 1 87 ILE n 1 88 LYS n 1 89 ILE n 1 90 ILE n 1 91 PRO n 1 92 ASN n 1 93 ILE n 1 94 ASP n 1 95 ALA n 1 96 LYS n 1 97 THR n 1 98 GLN n 1 99 SER n 1 100 PRO n 1 101 ASP n 1 102 LEU n 1 103 LEU n 1 104 SER n 1 105 GLY n 1 106 MET n 1 107 LYS n 1 108 SER n 1 109 PRO n 1 110 PRO n 1 111 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 111 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene lspD _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Legionella pneumophila' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 446 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 116 116 MET MET A . n A 1 2 ALA 2 117 117 ALA ALA A . n A 1 3 HIS 3 118 118 HIS HIS A . n A 1 4 HIS 4 119 119 HIS HIS A . n A 1 5 HIS 5 120 120 HIS HIS A . n A 1 6 HIS 6 121 121 HIS HIS A . n A 1 7 HIS 7 122 122 HIS HIS A . n A 1 8 HIS 8 123 123 HIS HIS A . n A 1 9 VAL 9 124 124 VAL VAL A . n A 1 10 ASP 10 125 125 ASP ASP A . n A 1 11 ASP 11 126 126 ASP ASP A . n A 1 12 ASP 12 127 127 ASP ASP A . n A 1 13 ASP 13 128 128 ASP ASP A . n A 1 14 LYS 14 129 129 LYS LYS A . n A 1 15 MET 15 130 130 MET MET A . n A 1 16 GLY 16 131 131 GLY GLY A . n A 1 17 SER 17 132 132 SER SER A . n A 1 18 LYS 18 133 133 LYS LYS A . n A 1 19 LEU 19 134 134 LEU LEU A . n A 1 20 TRP 20 135 135 TRP TRP A . n A 1 21 ASN 21 136 136 ASN ASN A . n A 1 22 LEU 22 137 137 LEU LEU A . n A 1 23 ARG 23 138 138 ARG ARG A . n A 1 24 ASN 24 139 139 ASN ASN A . n A 1 25 ALA 25 140 140 ALA ALA A . n A 1 26 ASP 26 141 141 ASP ASP A . n A 1 27 ILE 27 142 142 ILE ILE A . n A 1 28 ARG 28 143 143 ARG ARG A . n A 1 29 ALA 29 144 144 ALA ALA A . n A 1 30 VAL 30 145 145 VAL VAL A . n A 1 31 ILE 31 146 146 ILE ILE A . n A 1 32 ALA 32 147 147 ALA ALA A . n A 1 33 GLU 33 148 148 GLU GLU A . n A 1 34 VAL 34 149 149 VAL VAL A . n A 1 35 SER 35 150 150 SER SER A . n A 1 36 ARG 36 151 151 ARG ARG A . n A 1 37 ILE 37 152 152 ILE ILE A . n A 1 38 THR 38 153 153 THR THR A . n A 1 39 GLY 39 154 154 GLY GLY A . n A 1 40 LYS 40 155 155 LYS LYS A . n A 1 41 ASN 41 156 156 ASN ASN A . n A 1 42 PHE 42 157 157 PHE PHE A . n A 1 43 VAL 43 158 158 VAL VAL A . n A 1 44 ILE 44 159 159 ILE ILE A . n A 1 45 ASP 45 160 160 ASP ASP A . n A 1 46 PRO 46 161 161 PRO PRO A . n A 1 47 ARG 47 162 162 ARG ARG A . n A 1 48 VAL 48 163 163 VAL VAL A . n A 1 49 GLN 49 164 164 GLN GLN A . n A 1 50 GLY 50 165 165 GLY GLY A . n A 1 51 LYS 51 166 166 LYS LYS A . n A 1 52 VAL 52 167 167 VAL VAL A . n A 1 53 SER 53 168 168 SER SER A . n A 1 54 ILE 54 169 169 ILE ILE A . n A 1 55 VAL 55 170 170 VAL VAL A . n A 1 56 SER 56 171 171 SER SER A . n A 1 57 SER 57 172 172 SER SER A . n A 1 58 THR 58 173 173 THR THR A . n A 1 59 PRO 59 174 174 PRO PRO A . n A 1 60 LEU 60 175 175 LEU LEU A . n A 1 61 SER 61 176 176 SER SER A . n A 1 62 SER 62 177 177 SER SER A . n A 1 63 ARG 63 178 178 ARG ARG A . n A 1 64 GLU 64 179 179 GLU GLU A . n A 1 65 LEU 65 180 180 LEU LEU A . n A 1 66 TYR 66 181 181 TYR TYR A . n A 1 67 GLN 67 182 182 GLN GLN A . n A 1 68 VAL 68 183 183 VAL VAL A . n A 1 69 PHE 69 184 184 PHE PHE A . n A 1 70 LEU 70 185 185 LEU LEU A . n A 1 71 SER 71 186 186 SER SER A . n A 1 72 VAL 72 187 187 VAL VAL A . n A 1 73 LEU 73 188 188 LEU LEU A . n A 1 74 GLN 74 189 189 GLN GLN A . n A 1 75 VAL 75 190 190 VAL VAL A . n A 1 76 SER 76 191 191 SER SER A . n A 1 77 GLY 77 192 192 GLY GLY A . n A 1 78 TYR 78 193 193 TYR TYR A . n A 1 79 ALA 79 194 194 ALA ALA A . n A 1 80 ALA 80 195 195 ALA ALA A . n A 1 81 ILE 81 196 196 ILE ILE A . n A 1 82 PRO 82 197 197 PRO PRO A . n A 1 83 ASN 83 198 198 ASN ASN A . n A 1 84 GLY 84 199 199 GLY GLY A . n A 1 85 GLU 85 200 200 GLU GLU A . n A 1 86 ILE 86 201 201 ILE ILE A . n A 1 87 ILE 87 202 202 ILE ILE A . n A 1 88 LYS 88 203 203 LYS LYS A . n A 1 89 ILE 89 204 204 ILE ILE A . n A 1 90 ILE 90 205 205 ILE ILE A . n A 1 91 PRO 91 206 206 PRO PRO A . n A 1 92 ASN 92 207 207 ASN ASN A . n A 1 93 ILE 93 208 208 ILE ILE A . n A 1 94 ASP 94 209 209 ASP ASP A . n A 1 95 ALA 95 210 210 ALA ALA A . n A 1 96 LYS 96 211 211 LYS LYS A . n A 1 97 THR 97 212 212 THR THR A . n A 1 98 GLN 98 213 213 GLN GLN A . n A 1 99 SER 99 214 214 SER SER A . n A 1 100 PRO 100 215 215 PRO PRO A . n A 1 101 ASP 101 216 216 ASP ASP A . n A 1 102 LEU 102 217 217 LEU LEU A . n A 1 103 LEU 103 218 218 LEU LEU A . n A 1 104 SER 104 219 219 SER SER A . n A 1 105 GLY 105 220 220 GLY GLY A . n A 1 106 MET 106 221 221 MET MET A . n A 1 107 LYS 107 222 222 LYS LYS A . n A 1 108 SER 108 223 223 SER SER A . n A 1 109 PRO 109 224 224 PRO PRO A . n A 1 110 PRO 110 225 225 PRO PRO A . n A 1 111 ARG 111 226 226 ARG ARG A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7PMP _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7PMP _struct.title 'Solution structure of Legionella pneumophila LspD' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7PMP _struct_keywords.text 'Legionella pneumophila, Type II Secretion System, GspD, Recognition, PROTEIN TRANSPORT' _struct_keywords.pdbx_keywords 'PROTEIN TRANSPORT' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code I7I3K3_LEGPN _struct_ref.pdbx_db_accession I7I3K3 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GSKLWNLRNADIRAVIAEVSRITGKNFVIDPRVQGKVSIVSSTPLSSRELYQVFLSVLQVSGYAAIPNGEIIKIIPNIDA KTQSPDLLSGMKSPPR ; _struct_ref.pdbx_align_begin 115 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7PMP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 16 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 111 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession I7I3K3 _struct_ref_seq.db_align_beg 115 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 210 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 131 _struct_ref_seq.pdbx_auth_seq_align_end 226 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7PMP MET A 1 ? UNP I7I3K3 ? ? 'initiating methionine' 116 1 1 7PMP ALA A 2 ? UNP I7I3K3 ? ? 'expression tag' 117 2 1 7PMP HIS A 3 ? UNP I7I3K3 ? ? 'expression tag' 118 3 1 7PMP HIS A 4 ? UNP I7I3K3 ? ? 'expression tag' 119 4 1 7PMP HIS A 5 ? UNP I7I3K3 ? ? 'expression tag' 120 5 1 7PMP HIS A 6 ? UNP I7I3K3 ? ? 'expression tag' 121 6 1 7PMP HIS A 7 ? UNP I7I3K3 ? ? 'expression tag' 122 7 1 7PMP HIS A 8 ? UNP I7I3K3 ? ? 'expression tag' 123 8 1 7PMP VAL A 9 ? UNP I7I3K3 ? ? 'expression tag' 124 9 1 7PMP ASP A 10 ? UNP I7I3K3 ? ? 'expression tag' 125 10 1 7PMP ASP A 11 ? UNP I7I3K3 ? ? 'expression tag' 126 11 1 7PMP ASP A 12 ? UNP I7I3K3 ? ? 'expression tag' 127 12 1 7PMP ASP A 13 ? UNP I7I3K3 ? ? 'expression tag' 128 13 1 7PMP LYS A 14 ? UNP I7I3K3 ? ? 'expression tag' 129 14 1 7PMP MET A 15 ? UNP I7I3K3 ? ? 'expression tag' 130 15 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 8680 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ILE A 27 ? GLY A 39 ? ILE A 142 GLY A 154 1 ? 13 HELX_P HELX_P2 AA2 SER A 61 ? GLY A 77 ? SER A 176 GLY A 192 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ALA A 25 ? ASP A 26 ? ALA A 140 ASP A 141 AA1 2 LYS A 51 ? VAL A 52 ? LYS A 166 VAL A 167 AA2 1 ASN A 41 ? ILE A 44 ? ASN A 156 ILE A 159 AA2 2 ILE A 86 ? ILE A 90 ? ILE A 201 ILE A 205 AA2 3 ALA A 79 ? ASN A 83 ? ALA A 194 ASN A 198 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ALA A 25 ? N ALA A 140 O VAL A 52 ? O VAL A 167 AA2 1 2 N ASN A 41 ? N ASN A 156 O ILE A 87 ? O ILE A 202 AA2 2 3 O LYS A 88 ? O LYS A 203 N ILE A 81 ? N ILE A 196 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 119 ? ? -65.74 96.98 2 1 HIS A 120 ? ? -130.34 -74.89 3 1 HIS A 122 ? ? -111.21 64.74 4 1 VAL A 124 ? ? -93.30 36.76 5 1 ASP A 128 ? ? 54.17 82.73 6 1 MET A 130 ? ? -86.86 42.21 7 1 ASN A 139 ? ? -39.56 99.24 8 1 SER A 172 ? ? -62.38 -175.54 9 1 THR A 173 ? ? -38.53 157.78 10 1 PRO A 174 ? ? -36.33 135.97 11 1 ASN A 198 ? ? -100.49 70.42 12 1 THR A 212 ? ? -130.59 -63.10 13 1 GLN A 213 ? ? 62.06 78.32 14 1 LEU A 217 ? ? -96.42 37.03 15 1 LYS A 222 ? ? 60.75 89.99 16 2 ALA A 117 ? ? -148.94 -35.54 17 2 HIS A 120 ? ? 55.25 70.74 18 2 HIS A 123 ? ? 47.09 70.28 19 2 ASP A 126 ? ? -142.54 -63.83 20 2 ASN A 139 ? ? -32.35 99.23 21 2 SER A 172 ? ? -53.33 -176.03 22 2 THR A 173 ? ? -38.65 156.54 23 2 PRO A 174 ? ? -37.04 130.63 24 2 ASN A 198 ? ? -104.90 64.54 25 2 THR A 212 ? ? -150.21 64.67 26 2 GLN A 213 ? ? 65.13 104.77 27 3 HIS A 122 ? ? 64.16 84.57 28 3 ASP A 125 ? ? -115.39 -71.43 29 3 MET A 130 ? ? 68.92 89.60 30 3 LYS A 133 ? ? -161.46 106.12 31 3 ASN A 139 ? ? -43.58 101.61 32 3 SER A 172 ? ? -69.26 87.87 33 3 ASN A 198 ? ? -108.06 79.06 34 3 ASP A 209 ? ? 71.59 -47.84 35 3 LYS A 222 ? ? 53.40 79.19 36 4 HIS A 119 ? ? 58.97 -156.74 37 4 ASN A 139 ? ? -38.71 100.44 38 4 ASN A 198 ? ? -104.59 68.25 39 4 ILE A 208 ? ? -88.40 45.51 40 4 ALA A 210 ? ? -154.17 64.14 41 5 VAL A 124 ? ? 71.32 -73.11 42 5 ASP A 127 ? ? -99.84 32.03 43 5 ASN A 139 ? ? -38.81 98.45 44 5 SER A 172 ? ? -61.27 -176.23 45 5 THR A 173 ? ? -39.88 157.50 46 5 PRO A 174 ? ? -36.39 134.25 47 5 ALA A 210 ? ? 67.28 95.00 48 5 SER A 214 ? ? -165.98 102.07 49 5 LEU A 218 ? ? 68.04 77.05 50 5 PRO A 225 ? ? -67.53 76.49 51 6 HIS A 123 ? ? -140.59 -63.26 52 6 ASP A 128 ? ? -79.35 47.43 53 6 ASN A 139 ? ? -41.00 101.47 54 6 SER A 172 ? ? -59.77 -176.06 55 6 THR A 173 ? ? -39.38 156.04 56 6 PRO A 174 ? ? -36.47 132.41 57 6 ILE A 208 ? ? -57.31 102.57 58 6 ASP A 209 ? ? 66.48 -72.09 59 6 ASP A 216 ? ? -84.36 42.75 60 7 HIS A 120 ? ? 64.97 69.25 61 7 ASN A 139 ? ? -43.94 99.87 62 7 THR A 212 ? ? -92.88 -66.45 63 7 LEU A 217 ? ? -83.71 44.22 64 8 HIS A 121 ? ? 68.90 136.77 65 8 LYS A 129 ? ? -85.96 48.84 66 8 ASN A 139 ? ? -41.34 99.50 67 8 ASN A 198 ? ? -114.12 74.00 68 8 ASP A 209 ? ? 75.93 -31.31 69 8 ALA A 210 ? ? -78.68 46.47 70 8 GLN A 213 ? ? 57.12 75.71 71 8 LEU A 218 ? ? -98.74 47.20 72 8 SER A 219 ? ? 48.85 82.35 73 8 MET A 221 ? ? 67.04 120.01 74 8 PRO A 225 ? ? -68.85 81.37 75 9 HIS A 119 ? ? -107.94 -64.07 76 9 ASP A 128 ? ? 69.23 161.85 77 9 MET A 130 ? ? -90.71 39.71 78 9 SER A 132 ? ? -79.02 -79.87 79 9 ASN A 139 ? ? -41.93 102.09 80 9 SER A 172 ? ? -64.94 -174.83 81 9 THR A 173 ? ? -34.06 154.59 82 9 PRO A 174 ? ? -35.80 128.36 83 9 ALA A 210 ? ? 59.07 -95.93 84 9 LYS A 211 ? ? -145.10 -73.44 85 9 LEU A 218 ? ? -116.49 50.90 86 9 SER A 223 ? ? 60.92 74.99 87 10 HIS A 120 ? ? 59.73 77.90 88 10 ASP A 128 ? ? -120.84 -50.65 89 10 SER A 132 ? ? -137.62 -46.71 90 10 ASN A 139 ? ? -41.49 102.25 91 10 SER A 172 ? ? -66.48 -174.89 92 10 THR A 173 ? ? -33.96 153.68 93 10 PRO A 174 ? ? -36.86 125.17 94 10 SER A 219 ? ? -93.63 40.38 95 11 HIS A 119 ? ? -65.72 96.99 96 11 HIS A 120 ? ? -130.35 -74.87 97 11 HIS A 122 ? ? -111.19 64.74 98 11 VAL A 124 ? ? -93.35 36.81 99 11 ASP A 128 ? ? 54.16 82.71 100 11 MET A 130 ? ? -86.89 42.15 101 11 ASN A 139 ? ? -39.61 99.28 102 11 SER A 172 ? ? -62.32 -175.55 103 11 THR A 173 ? ? -38.55 157.73 104 11 PRO A 174 ? ? -36.32 135.97 105 11 ASN A 198 ? ? -100.46 70.43 106 11 THR A 212 ? ? -130.51 -63.09 107 11 GLN A 213 ? ? 62.06 78.31 108 11 LEU A 217 ? ? -96.38 37.01 109 11 LYS A 222 ? ? 60.80 89.99 110 12 ALA A 117 ? ? -148.89 -35.54 111 12 HIS A 120 ? ? 55.26 70.72 112 12 HIS A 123 ? ? 47.08 70.27 113 12 ASP A 126 ? ? -142.58 -63.85 114 12 ASN A 139 ? ? -32.40 99.26 115 12 SER A 172 ? ? -53.31 -176.05 116 12 THR A 173 ? ? -38.66 156.53 117 12 PRO A 174 ? ? -37.02 130.66 118 12 ASN A 198 ? ? -104.92 64.57 119 12 THR A 212 ? ? -150.21 64.71 120 12 GLN A 213 ? ? 65.12 104.74 121 13 HIS A 122 ? ? 64.19 84.57 122 13 ASP A 125 ? ? -115.41 -71.37 123 13 MET A 130 ? ? 68.91 89.58 124 13 LYS A 133 ? ? -161.48 106.11 125 13 ASN A 139 ? ? -43.61 101.59 126 13 SER A 172 ? ? -69.16 87.87 127 13 ASN A 198 ? ? -108.10 79.04 128 13 ASP A 209 ? ? 71.63 -47.87 129 13 LYS A 222 ? ? 53.41 79.23 130 14 HIS A 119 ? ? 58.96 -156.71 131 14 ASN A 139 ? ? -38.70 100.42 132 14 ASN A 198 ? ? -104.58 68.23 133 14 ILE A 208 ? ? -88.37 45.44 134 14 ALA A 210 ? ? -154.20 64.14 135 15 VAL A 124 ? ? 71.36 -73.16 136 15 ASP A 127 ? ? -99.89 32.00 137 15 ASN A 139 ? ? -38.77 98.43 138 15 SER A 172 ? ? -61.24 -176.28 139 15 THR A 173 ? ? -39.89 157.44 140 15 PRO A 174 ? ? -36.30 134.24 141 15 ALA A 210 ? ? 67.25 95.01 142 15 SER A 214 ? ? -165.97 102.08 143 15 LEU A 218 ? ? 68.04 77.07 144 15 PRO A 225 ? ? -67.51 76.48 145 16 HIS A 123 ? ? -140.62 -63.22 146 16 ASP A 128 ? ? -79.34 47.47 147 16 ASN A 139 ? ? -41.04 101.48 148 16 SER A 172 ? ? -59.76 -176.13 149 16 THR A 173 ? ? -39.33 156.06 150 16 PRO A 174 ? ? -36.49 132.40 151 16 ILE A 208 ? ? -57.30 102.52 152 16 ASP A 209 ? ? 66.49 -72.10 153 16 ASP A 216 ? ? -84.34 42.73 154 17 HIS A 120 ? ? 64.97 69.27 155 17 ASN A 139 ? ? -44.02 99.87 156 17 THR A 212 ? ? -92.91 -66.40 157 17 LEU A 217 ? ? -83.67 44.16 158 18 HIS A 121 ? ? 68.92 136.76 159 18 LYS A 129 ? ? -85.97 48.88 160 18 ASN A 139 ? ? -41.34 99.50 161 18 ASN A 198 ? ? -114.14 74.06 162 18 ASP A 209 ? ? 75.89 -31.34 163 18 ALA A 210 ? ? -78.59 46.45 164 18 GLN A 213 ? ? 57.14 75.69 165 18 LEU A 218 ? ? -98.81 47.25 166 18 SER A 219 ? ? 48.83 82.35 167 18 MET A 221 ? ? 67.05 120.05 168 18 PRO A 225 ? ? -68.82 81.36 169 19 HIS A 119 ? ? -107.93 -64.03 170 19 ASP A 128 ? ? 69.28 161.85 171 19 MET A 130 ? ? -90.64 39.67 172 19 SER A 132 ? ? -79.01 -79.80 173 19 ASN A 139 ? ? -41.91 102.09 174 19 SER A 172 ? ? -64.93 -174.83 175 19 THR A 173 ? ? -34.07 154.58 176 19 PRO A 174 ? ? -35.87 128.42 177 19 ALA A 210 ? ? 59.01 -95.85 178 19 LYS A 211 ? ? -145.17 -73.45 179 19 LEU A 218 ? ? -116.49 50.93 180 19 SER A 223 ? ? 60.95 74.98 181 20 HIS A 120 ? ? 59.72 77.93 182 20 ASP A 128 ? ? -120.78 -50.70 183 20 SER A 132 ? ? -137.63 -46.70 184 20 ASN A 139 ? ? -41.51 102.27 185 20 SER A 172 ? ? -66.53 -174.89 186 20 THR A 173 ? ? -33.94 153.68 187 20 PRO A 174 ? ? -36.87 125.18 188 20 SER A 219 ? ? -93.63 40.39 # _pdbx_nmr_ensemble.entry_id 7PMP _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'all calculated structures submitted' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7PMP _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.4 mM [U-99% 13C; U-99% 15N] LspD N0, 50 mM sodium phosphate, 50 mM sodium chloride, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label 15N_13C_sample _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'LspD N0' 0.4 ? mM '[U-99% 13C; U-99% 15N]' 1 'sodium phosphate' 50 ? mM 'natural abundance' 1 'sodium chloride' 50 ? mM 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength '50 mM NaCl, 50 mM sodium phosphate' _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units 'Not defined' _pdbx_nmr_exptl_sample_conditions.label Condition1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '3D CBCA(CO)NH' 1 isotropic 3 1 1 '3D HNCO' 1 isotropic 4 1 1 '3D HCCH-TOCSY' 1 isotropic 5 1 1 '3D CCH-TOCSY' 1 isotropic 6 1 1 '3D HNCA' 1 isotropic 10 1 1 '3D HN(CO)CA' 1 isotropic 9 1 1 '3D HNCACB' 1 isotropic 8 1 1 '3D 1H-13C NOESY' 1 isotropic 7 1 1 '3D 1H-15N NOESY' 1 isotropic 11 1 1 '2D 1H-13C HSQC' 1 isotropic # _pdbx_nmr_refine.entry_id 7PMP _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 2 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CNS ? 'Brunger, Adams, Clore, Gros, Nilges and Read' 2 'structure calculation' ARIA ? ;Linge, O'Donoghue and Nilges ; 3 'chemical shift assignment' 'CcpNmr Analysis' ? CCPN 4 'peak picking' 'CcpNmr Analysis' ? CCPN # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TRP N N N N 304 TRP CA C N S 305 TRP C C N N 306 TRP O O N N 307 TRP CB C N N 308 TRP CG C Y N 309 TRP CD1 C Y N 310 TRP CD2 C Y N 311 TRP NE1 N Y N 312 TRP CE2 C Y N 313 TRP CE3 C Y N 314 TRP CZ2 C Y N 315 TRP CZ3 C Y N 316 TRP CH2 C Y N 317 TRP OXT O N N 318 TRP H H N N 319 TRP H2 H N N 320 TRP HA H N N 321 TRP HB2 H N N 322 TRP HB3 H N N 323 TRP HD1 H N N 324 TRP HE1 H N N 325 TRP HE3 H N N 326 TRP HZ2 H N N 327 TRP HZ3 H N N 328 TRP HH2 H N N 329 TRP HXT H N N 330 TYR N N N N 331 TYR CA C N S 332 TYR C C N N 333 TYR O O N N 334 TYR CB C N N 335 TYR CG C Y N 336 TYR CD1 C Y N 337 TYR CD2 C Y N 338 TYR CE1 C Y N 339 TYR CE2 C Y N 340 TYR CZ C Y N 341 TYR OH O N N 342 TYR OXT O N N 343 TYR H H N N 344 TYR H2 H N N 345 TYR HA H N N 346 TYR HB2 H N N 347 TYR HB3 H N N 348 TYR HD1 H N N 349 TYR HD2 H N N 350 TYR HE1 H N N 351 TYR HE2 H N N 352 TYR HH H N N 353 TYR HXT H N N 354 VAL N N N N 355 VAL CA C N S 356 VAL C C N N 357 VAL O O N N 358 VAL CB C N N 359 VAL CG1 C N N 360 VAL CG2 C N N 361 VAL OXT O N N 362 VAL H H N N 363 VAL H2 H N N 364 VAL HA H N N 365 VAL HB H N N 366 VAL HG11 H N N 367 VAL HG12 H N N 368 VAL HG13 H N N 369 VAL HG21 H N N 370 VAL HG22 H N N 371 VAL HG23 H N N 372 VAL HXT H N N 373 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TRP N CA sing N N 291 TRP N H sing N N 292 TRP N H2 sing N N 293 TRP CA C sing N N 294 TRP CA CB sing N N 295 TRP CA HA sing N N 296 TRP C O doub N N 297 TRP C OXT sing N N 298 TRP CB CG sing N N 299 TRP CB HB2 sing N N 300 TRP CB HB3 sing N N 301 TRP CG CD1 doub Y N 302 TRP CG CD2 sing Y N 303 TRP CD1 NE1 sing Y N 304 TRP CD1 HD1 sing N N 305 TRP CD2 CE2 doub Y N 306 TRP CD2 CE3 sing Y N 307 TRP NE1 CE2 sing Y N 308 TRP NE1 HE1 sing N N 309 TRP CE2 CZ2 sing Y N 310 TRP CE3 CZ3 doub Y N 311 TRP CE3 HE3 sing N N 312 TRP CZ2 CH2 doub Y N 313 TRP CZ2 HZ2 sing N N 314 TRP CZ3 CH2 sing Y N 315 TRP CZ3 HZ3 sing N N 316 TRP CH2 HH2 sing N N 317 TRP OXT HXT sing N N 318 TYR N CA sing N N 319 TYR N H sing N N 320 TYR N H2 sing N N 321 TYR CA C sing N N 322 TYR CA CB sing N N 323 TYR CA HA sing N N 324 TYR C O doub N N 325 TYR C OXT sing N N 326 TYR CB CG sing N N 327 TYR CB HB2 sing N N 328 TYR CB HB3 sing N N 329 TYR CG CD1 doub Y N 330 TYR CG CD2 sing Y N 331 TYR CD1 CE1 sing Y N 332 TYR CD1 HD1 sing N N 333 TYR CD2 CE2 doub Y N 334 TYR CD2 HD2 sing N N 335 TYR CE1 CZ doub Y N 336 TYR CE1 HE1 sing N N 337 TYR CE2 CZ sing Y N 338 TYR CE2 HE2 sing N N 339 TYR CZ OH sing N N 340 TYR OH HH sing N N 341 TYR OXT HXT sing N N 342 VAL N CA sing N N 343 VAL N H sing N N 344 VAL N H2 sing N N 345 VAL CA C sing N N 346 VAL CA CB sing N N 347 VAL CA HA sing N N 348 VAL C O doub N N 349 VAL C OXT sing N N 350 VAL CB CG1 sing N N 351 VAL CB CG2 sing N N 352 VAL CB HB sing N N 353 VAL CG1 HG11 sing N N 354 VAL CG1 HG12 sing N N 355 VAL CG1 HG13 sing N N 356 VAL CG2 HG21 sing N N 357 VAL CG2 HG22 sing N N 358 VAL CG2 HG23 sing N N 359 VAL OXT HXT sing N N 360 # _pdbx_audit_support.funding_organization 'Engineering and Physical Sciences Research Council' _pdbx_audit_support.country 'United Kingdom' _pdbx_audit_support.grant_number 1806169 _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 7PMP _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #