data_7PQV # _entry.id 7PQV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7PQV pdb_00007pqv 10.2210/pdb7pqv/pdb WWPDB D_1292118193 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7PQV _pdbx_database_status.recvd_initial_deposition_date 2021-09-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _audit_author.name 'Moebitz, H.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID 0000-0002-8398-6121 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 65 _citation.language ? _citation.page_first 4350 _citation.page_last 4366 _citation.title 'Discovery of MAP855, an Efficacious and Selective MEK1/2 Inhibitor with an ATP-Competitive Mode of Action.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.1c02192 _citation.pdbx_database_id_PubMed 35195996 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Poddutoori, R.' 1 ? primary 'Aardalen, K.' 2 ? primary 'Aithal, K.' 3 ? primary 'Barahagar, S.S.' 4 ? primary 'Belliappa, C.' 5 ? primary 'Bock, M.' 6 ? primary 'Chelur, S.' 7 ? primary 'Gerken, A.' 8 ? primary 'Gopinath, S.' 9 ? primary 'Gruenenfelder, B.' 10 ? primary 'Kiffe, M.' 11 ? primary 'Krishnaswami, M.' 12 ? primary 'Langowski, J.' 13 ? primary 'Madapa, S.' 14 ? primary 'Narayanan, K.' 15 ? primary 'Pandit, C.' 16 ? primary 'Panigrahi, S.K.' 17 ? primary 'Perrone, M.' 18 ? primary 'Potakamuri, R.K.' 19 ? primary 'Ramachandra, M.' 20 ? primary 'Ramanathan, A.' 21 ? primary 'Ramos, R.' 22 ? primary 'Sager, E.' 23 ? primary 'Samajdar, S.' 24 ? primary 'Subramanya, H.S.' 25 ? primary 'Thimmasandra, D.S.' 26 ? primary 'Venetsanakos, E.' 27 ? primary 'Mobitz, H.' 28 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7PQV _cell.details ? _cell.formula_units_Z ? _cell.length_a 77.158 _cell.length_a_esd ? _cell.length_b 77.158 _cell.length_b_esd ? _cell.length_c 222.649 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7PQV _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Dual specificity mitogen-activated protein kinase kinase 1' 38507.414 1 2.7.12.2 ? 'KINASE DOMAIN' ? 2 non-polymer syn '8-(2-chloranyl-4-methoxy-phenyl)-7-fluoranyl-1-piperidin-4-yl-imidazo[4,5-c]quinoline' 410.872 1 ? ? ? ? 3 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? 4 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 5 water nat water 18.015 190 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'MAP kinase kinase 1,MAPKK 1,MKK1,ERK activator kinase 1,MAPK/ERK kinase 1,MEK 1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVL HECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILV NSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCQ VEGDAAETPPRPRTPGRPLNKFGMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVH AFIKRSDAEEVDFAGWLCSTIGLN ; _entity_poly.pdbx_seq_one_letter_code_can ;ELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVL HECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILV NSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCQ VEGDAAETPPRPRTPGRPLNKFGMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVH AFIKRSDAEEVDFAGWLCSTIGLN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 LEU n 1 3 GLU n 1 4 LEU n 1 5 ASP n 1 6 GLU n 1 7 GLN n 1 8 GLN n 1 9 ARG n 1 10 LYS n 1 11 ARG n 1 12 LEU n 1 13 GLU n 1 14 ALA n 1 15 PHE n 1 16 LEU n 1 17 THR n 1 18 GLN n 1 19 LYS n 1 20 GLN n 1 21 LYS n 1 22 VAL n 1 23 GLY n 1 24 GLU n 1 25 LEU n 1 26 LYS n 1 27 ASP n 1 28 ASP n 1 29 ASP n 1 30 PHE n 1 31 GLU n 1 32 LYS n 1 33 ILE n 1 34 SER n 1 35 GLU n 1 36 LEU n 1 37 GLY n 1 38 ALA n 1 39 GLY n 1 40 ASN n 1 41 GLY n 1 42 GLY n 1 43 VAL n 1 44 VAL n 1 45 PHE n 1 46 LYS n 1 47 VAL n 1 48 SER n 1 49 HIS n 1 50 LYS n 1 51 PRO n 1 52 SER n 1 53 GLY n 1 54 LEU n 1 55 VAL n 1 56 MET n 1 57 ALA n 1 58 ARG n 1 59 LYS n 1 60 LEU n 1 61 ILE n 1 62 HIS n 1 63 LEU n 1 64 GLU n 1 65 ILE n 1 66 LYS n 1 67 PRO n 1 68 ALA n 1 69 ILE n 1 70 ARG n 1 71 ASN n 1 72 GLN n 1 73 ILE n 1 74 ILE n 1 75 ARG n 1 76 GLU n 1 77 LEU n 1 78 GLN n 1 79 VAL n 1 80 LEU n 1 81 HIS n 1 82 GLU n 1 83 CYS n 1 84 ASN n 1 85 SER n 1 86 PRO n 1 87 TYR n 1 88 ILE n 1 89 VAL n 1 90 GLY n 1 91 PHE n 1 92 TYR n 1 93 GLY n 1 94 ALA n 1 95 PHE n 1 96 TYR n 1 97 SER n 1 98 ASP n 1 99 GLY n 1 100 GLU n 1 101 ILE n 1 102 SER n 1 103 ILE n 1 104 CYS n 1 105 MET n 1 106 GLU n 1 107 HIS n 1 108 MET n 1 109 ASP n 1 110 GLY n 1 111 GLY n 1 112 SER n 1 113 LEU n 1 114 ASP n 1 115 GLN n 1 116 VAL n 1 117 LEU n 1 118 LYS n 1 119 LYS n 1 120 ALA n 1 121 GLY n 1 122 ARG n 1 123 ILE n 1 124 PRO n 1 125 GLU n 1 126 GLN n 1 127 ILE n 1 128 LEU n 1 129 GLY n 1 130 LYS n 1 131 VAL n 1 132 SER n 1 133 ILE n 1 134 ALA n 1 135 VAL n 1 136 ILE n 1 137 LYS n 1 138 GLY n 1 139 LEU n 1 140 THR n 1 141 TYR n 1 142 LEU n 1 143 ARG n 1 144 GLU n 1 145 LYS n 1 146 HIS n 1 147 LYS n 1 148 ILE n 1 149 MET n 1 150 HIS n 1 151 ARG n 1 152 ASP n 1 153 VAL n 1 154 LYS n 1 155 PRO n 1 156 SER n 1 157 ASN n 1 158 ILE n 1 159 LEU n 1 160 VAL n 1 161 ASN n 1 162 SER n 1 163 ARG n 1 164 GLY n 1 165 GLU n 1 166 ILE n 1 167 LYS n 1 168 LEU n 1 169 CYS n 1 170 ASP n 1 171 PHE n 1 172 GLY n 1 173 VAL n 1 174 SER n 1 175 GLY n 1 176 GLN n 1 177 LEU n 1 178 ILE n 1 179 ASP n 1 180 SER n 1 181 MET n 1 182 ALA n 1 183 ASN n 1 184 SER n 1 185 PHE n 1 186 VAL n 1 187 GLY n 1 188 THR n 1 189 ARG n 1 190 SER n 1 191 TYR n 1 192 MET n 1 193 SER n 1 194 PRO n 1 195 GLU n 1 196 ARG n 1 197 LEU n 1 198 GLN n 1 199 GLY n 1 200 THR n 1 201 HIS n 1 202 TYR n 1 203 SER n 1 204 VAL n 1 205 GLN n 1 206 SER n 1 207 ASP n 1 208 ILE n 1 209 TRP n 1 210 SER n 1 211 MET n 1 212 GLY n 1 213 LEU n 1 214 SER n 1 215 LEU n 1 216 VAL n 1 217 GLU n 1 218 MET n 1 219 ALA n 1 220 VAL n 1 221 GLY n 1 222 ARG n 1 223 TYR n 1 224 PRO n 1 225 ILE n 1 226 PRO n 1 227 PRO n 1 228 PRO n 1 229 ASP n 1 230 ALA n 1 231 LYS n 1 232 GLU n 1 233 LEU n 1 234 GLU n 1 235 LEU n 1 236 MET n 1 237 PHE n 1 238 GLY n 1 239 CYS n 1 240 GLN n 1 241 VAL n 1 242 GLU n 1 243 GLY n 1 244 ASP n 1 245 ALA n 1 246 ALA n 1 247 GLU n 1 248 THR n 1 249 PRO n 1 250 PRO n 1 251 ARG n 1 252 PRO n 1 253 ARG n 1 254 THR n 1 255 PRO n 1 256 GLY n 1 257 ARG n 1 258 PRO n 1 259 LEU n 1 260 ASN n 1 261 LYS n 1 262 PHE n 1 263 GLY n 1 264 MET n 1 265 ASP n 1 266 SER n 1 267 ARG n 1 268 PRO n 1 269 PRO n 1 270 MET n 1 271 ALA n 1 272 ILE n 1 273 PHE n 1 274 GLU n 1 275 LEU n 1 276 LEU n 1 277 ASP n 1 278 TYR n 1 279 ILE n 1 280 VAL n 1 281 ASN n 1 282 GLU n 1 283 PRO n 1 284 PRO n 1 285 PRO n 1 286 LYS n 1 287 LEU n 1 288 PRO n 1 289 SER n 1 290 GLY n 1 291 VAL n 1 292 PHE n 1 293 SER n 1 294 LEU n 1 295 GLU n 1 296 PHE n 1 297 GLN n 1 298 ASP n 1 299 PHE n 1 300 VAL n 1 301 ASN n 1 302 LYS n 1 303 CYS n 1 304 LEU n 1 305 ILE n 1 306 LYS n 1 307 ASN n 1 308 PRO n 1 309 ALA n 1 310 GLU n 1 311 ARG n 1 312 ALA n 1 313 ASP n 1 314 LEU n 1 315 LYS n 1 316 GLN n 1 317 LEU n 1 318 MET n 1 319 VAL n 1 320 HIS n 1 321 ALA n 1 322 PHE n 1 323 ILE n 1 324 LYS n 1 325 ARG n 1 326 SER n 1 327 ASP n 1 328 ALA n 1 329 GLU n 1 330 GLU n 1 331 VAL n 1 332 ASP n 1 333 PHE n 1 334 ALA n 1 335 GLY n 1 336 TRP n 1 337 LEU n 1 338 CYS n 1 339 SER n 1 340 THR n 1 341 ILE n 1 342 GLY n 1 343 LEU n 1 344 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 344 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'MAP2K1, MEK1, PRKMK1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MP2K1_HUMAN _struct_ref.pdbx_db_accession Q02750 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVL HECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILV NSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCQ VEGDAAETPPRPRTPGRPLSSYGMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVH AFIKRSDAEEVDFAGWLCSTIGLN ; _struct_ref.pdbx_align_begin 39 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7PQV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 344 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q02750 _struct_ref_seq.db_align_beg 39 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 382 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 39 _struct_ref_seq.pdbx_auth_seq_align_end 382 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7PQV ASN A 260 ? UNP Q02750 SER 298 conflict 298 1 1 7PQV LYS A 261 ? UNP Q02750 SER 299 conflict 299 2 1 7PQV PHE A 262 ? UNP Q02750 TYR 300 conflict 300 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 80C non-polymer . '8-(2-chloranyl-4-methoxy-phenyl)-7-fluoranyl-1-piperidin-4-yl-imidazo[4,5-c]quinoline' ? 'C22 H20 Cl F N4 O' 410.872 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7PQV _exptl.crystals_number 2 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.240 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 54.0 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'BATCH MODE' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 310 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;The purified protein was used in crystallisation trials employing both, a standard screen with approximately 1200 different conditions, as well as crystallisation conditions identified using literature data. Condi- tions initially obtained have been optimised using standard strategies, systematically varying parameters critically influencing crystallisation, such as temperature, protein concentration, drop ratio, and others. These conditions were also refined by systematically varying pH or precipitant concentrations. ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100.000 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2011-05-02 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97980 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X06SA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97980 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X06SA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7PQV _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.130 _reflns.d_resolution_low 66.820 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 22886 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.200 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.700 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.075 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14.66 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.081 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.130 _reflns_shell.d_res_low 2.3 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.07 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 4328 _reflns_shell.percent_possible_all 95.600 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 5.900 _reflns_shell.pdbx_Rsym_value 0.44 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.479 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 2.7000 _refine.aniso_B[1][2] 1.3500 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 2.7000 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] -4.0600 _refine.B_iso_max 81.220 _refine.B_iso_mean 34.6190 _refine.B_iso_min 17.760 _refine.correlation_coeff_Fo_to_Fc 0.9370 _refine.correlation_coeff_Fo_to_Fc_free 0.9050 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7PQV _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.1300 _refine.ls_d_res_low 66.8200 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 20635 _refine.ls_number_reflns_R_free 1614 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.2500 _refine.ls_percent_reflns_R_free 7.3000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2389 _refine.ls_R_factor_R_free 0.2869 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2353 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model NONE _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.2590 _refine.pdbx_overall_ESU_R_Free 0.2230 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 7.9290 _refine.overall_SU_ML 0.1950 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.1300 _refine_hist.d_res_low 66.8200 _refine_hist.number_atoms_solvent 190 _refine_hist.number_atoms_total 2663 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 310 _refine_hist.pdbx_B_iso_mean_ligand 39.06 _refine_hist.pdbx_B_iso_mean_solvent 40.06 _refine_hist.pdbx_number_atoms_protein 2441 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 32 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 0.022 2427 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 2265 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.077 1.992 3281 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.897 3.000 5240 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.167 5.000 309 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 31.558 23.736 91 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 11.468 15.000 415 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 13.228 15.000 14 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.061 0.200 368 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 2688 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 476 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.146 0.200 461 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.123 0.200 2126 ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.149 0.200 1168 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.072 0.200 1239 ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? 0.082 0.200 147 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.059 0.200 6 ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? 0.153 0.200 11 ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? 0.093 0.200 37 ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? 0.045 0.200 9 ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? 0.022 0.200 2 ? r_symmetry_metal_ion_refined ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.1300 _refine_ls_shell.d_res_low 2.1850 _refine_ls_shell.number_reflns_all 1550 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 121 _refine_ls_shell.number_reflns_R_work 1429 _refine_ls_shell.percent_reflns_obs 94.1100 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3770 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.3350 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7PQV _struct.title 'MEK1 IN COMPLEX WITH COMPOUND 7' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7PQV _struct_keywords.text 'MEK1 MITOGEN-ACTIVATED PROTEIN KINASE 1, KINASE INHIBITOR, ANTI-CANCER DRUG, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 5 ? LYS A 21 ? ASP A 43 LYS A 59 1 ? 17 HELX_P HELX_P2 AA2 LYS A 26 ? ASP A 28 ? LYS A 64 ASP A 66 5 ? 3 HELX_P HELX_P3 AA3 LYS A 66 ? LEU A 77 ? LYS A 104 LEU A 115 1 ? 12 HELX_P HELX_P4 AA4 GLN A 78 ? GLU A 82 ? GLN A 116 GLU A 120 5 ? 5 HELX_P HELX_P5 AA5 SER A 112 ? GLY A 121 ? SER A 150 GLY A 159 1 ? 10 HELX_P HELX_P6 AA6 PRO A 124 ? LYS A 147 ? PRO A 162 LYS A 185 1 ? 24 HELX_P HELX_P7 AA7 LYS A 154 ? SER A 156 ? LYS A 192 SER A 194 5 ? 3 HELX_P HELX_P8 AA8 SER A 174 ? ALA A 182 ? SER A 212 ALA A 220 1 ? 9 HELX_P HELX_P9 AA9 SER A 193 ? GLN A 198 ? SER A 231 GLN A 236 1 ? 6 HELX_P HELX_P10 AB1 VAL A 204 ? GLY A 221 ? VAL A 242 GLY A 259 1 ? 18 HELX_P HELX_P11 AB2 ASP A 229 ? PHE A 237 ? ASP A 267 PHE A 275 1 ? 9 HELX_P HELX_P12 AB3 ALA A 271 ? GLU A 282 ? ALA A 309 GLU A 320 1 ? 12 HELX_P HELX_P13 AB4 SER A 293 ? LEU A 304 ? SER A 331 LEU A 342 1 ? 12 HELX_P HELX_P14 AB5 ASP A 313 ? VAL A 319 ? ASP A 351 VAL A 357 1 ? 7 HELX_P HELX_P15 AB6 HIS A 320 ? GLU A 329 ? HIS A 358 GLU A 367 1 ? 10 HELX_P HELX_P16 AB7 ASP A 332 ? GLY A 342 ? ASP A 370 GLY A 380 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 27 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 65 A CA 402 1_555 ? ? ? ? ? ? ? 2.660 ? ? metalc2 metalc ? ? A ASP 27 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 65 A CA 402 11_555 ? ? ? ? ? ? ? 2.659 ? ? metalc3 metalc ? ? A ASP 27 OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 65 A CA 403 11_555 ? ? ? ? ? ? ? 3.062 ? ? metalc4 metalc ? ? A ASP 27 OD2 ? ? ? 1_555 D CA . CA ? ? A ASP 65 A CA 403 11_555 ? ? ? ? ? ? ? 2.682 ? ? metalc5 metalc ? ? A ASP 28 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 66 A CA 402 1_555 ? ? ? ? ? ? ? 2.408 ? ? metalc6 metalc ? ? A ASP 28 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 66 A CA 402 11_555 ? ? ? ? ? ? ? 2.405 ? ? metalc7 metalc ? ? A ASP 28 OD2 ? ? ? 1_555 D CA . CA ? ? A ASP 66 A CA 403 1_555 ? ? ? ? ? ? ? 2.341 ? ? metalc8 metalc ? ? A ASP 152 OD2 ? ? ? 1_555 E MG . MG ? ? A ASP 190 A MG 404 1_555 ? ? ? ? ? ? ? 2.259 ? ? metalc9 metalc ? ? A ASP 170 OD2 ? ? ? 1_555 E MG . MG ? ? A ASP 208 A MG 404 1_555 ? ? ? ? ? ? ? 2.300 ? ? metalc10 metalc ? ? C CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 402 A HOH 528 1_555 ? ? ? ? ? ? ? 2.387 ? ? metalc11 metalc ? ? C CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 402 A HOH 528 11_555 ? ? ? ? ? ? ? 2.390 ? ? metalc12 metalc ? ? D CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 403 A HOH 540 11_555 ? ? ? ? ? ? ? 2.306 ? ? metalc13 metalc ? ? D CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 403 A HOH 556 11_555 ? ? ? ? ? ? ? 2.430 ? ? metalc14 metalc ? ? D CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 403 A HOH 611 1_555 ? ? ? ? ? ? ? 2.401 ? ? metalc15 metalc ? ? D CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 403 A HOH 646 11_555 ? ? ? ? ? ? ? 2.408 ? ? metalc16 metalc ? ? E MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 404 A HOH 621 1_555 ? ? ? ? ? ? ? 2.679 ? ? metalc17 metalc ? ? E MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 404 A HOH 630 1_555 ? ? ? ? ? ? ? 2.272 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ILE _struct_mon_prot_cis.label_seq_id 225 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ILE _struct_mon_prot_cis.auth_seq_id 263 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 226 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 264 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 3.56 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 30 ? ALA A 38 ? PHE A 68 ALA A 76 AA1 2 VAL A 43 ? HIS A 49 ? VAL A 81 HIS A 87 AA1 3 LEU A 54 ? HIS A 62 ? LEU A 92 HIS A 100 AA1 4 GLU A 100 ? MET A 105 ? GLU A 138 MET A 143 AA1 5 PHE A 91 ? TYR A 96 ? PHE A 129 TYR A 134 AA2 1 ILE A 158 ? VAL A 160 ? ILE A 196 VAL A 198 AA2 2 ILE A 166 ? LEU A 168 ? ILE A 204 LEU A 206 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N SER A 34 ? N SER A 72 O LYS A 46 ? O LYS A 84 AA1 2 3 N HIS A 49 ? N HIS A 87 O LEU A 54 ? O LEU A 92 AA1 3 4 N ILE A 61 ? N ILE A 99 O ILE A 101 ? O ILE A 139 AA1 4 5 O SER A 102 ? O SER A 140 N PHE A 95 ? N PHE A 133 AA2 1 2 N LEU A 159 ? N LEU A 197 O LYS A 167 ? O LYS A 205 # _atom_sites.entry_id 7PQV _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.012960 _atom_sites.fract_transf_matrix[1][2] 0.007483 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014965 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004491 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CA CL F MG N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 39 39 GLU GLU A . n A 1 2 LEU 2 40 40 LEU LEU A . n A 1 3 GLU 3 41 41 GLU GLU A . n A 1 4 LEU 4 42 42 LEU LEU A . n A 1 5 ASP 5 43 43 ASP ASP A . n A 1 6 GLU 6 44 44 GLU GLU A . n A 1 7 GLN 7 45 45 GLN GLN A . n A 1 8 GLN 8 46 46 GLN GLN A . n A 1 9 ARG 9 47 47 ARG ARG A . n A 1 10 LYS 10 48 48 LYS LYS A . n A 1 11 ARG 11 49 49 ARG ARG A . n A 1 12 LEU 12 50 50 LEU LEU A . n A 1 13 GLU 13 51 51 GLU GLU A . n A 1 14 ALA 14 52 52 ALA ALA A . n A 1 15 PHE 15 53 53 PHE PHE A . n A 1 16 LEU 16 54 54 LEU LEU A . n A 1 17 THR 17 55 55 THR THR A . n A 1 18 GLN 18 56 56 GLN GLN A . n A 1 19 LYS 19 57 57 LYS LYS A . n A 1 20 GLN 20 58 58 GLN GLN A . n A 1 21 LYS 21 59 59 LYS LYS A . n A 1 22 VAL 22 60 60 VAL VAL A . n A 1 23 GLY 23 61 61 GLY GLY A . n A 1 24 GLU 24 62 62 GLU GLU A . n A 1 25 LEU 25 63 63 LEU LEU A . n A 1 26 LYS 26 64 64 LYS LYS A . n A 1 27 ASP 27 65 65 ASP ASP A . n A 1 28 ASP 28 66 66 ASP ASP A . n A 1 29 ASP 29 67 67 ASP ASP A . n A 1 30 PHE 30 68 68 PHE PHE A . n A 1 31 GLU 31 69 69 GLU GLU A . n A 1 32 LYS 32 70 70 LYS LYS A . n A 1 33 ILE 33 71 71 ILE ILE A . n A 1 34 SER 34 72 72 SER SER A . n A 1 35 GLU 35 73 73 GLU GLU A . n A 1 36 LEU 36 74 74 LEU LEU A . n A 1 37 GLY 37 75 75 GLY GLY A . n A 1 38 ALA 38 76 76 ALA ALA A . n A 1 39 GLY 39 77 77 GLY GLY A . n A 1 40 ASN 40 78 78 ASN ASN A . n A 1 41 GLY 41 79 79 GLY GLY A . n A 1 42 GLY 42 80 80 GLY GLY A . n A 1 43 VAL 43 81 81 VAL VAL A . n A 1 44 VAL 44 82 82 VAL VAL A . n A 1 45 PHE 45 83 83 PHE PHE A . n A 1 46 LYS 46 84 84 LYS LYS A . n A 1 47 VAL 47 85 85 VAL VAL A . n A 1 48 SER 48 86 86 SER SER A . n A 1 49 HIS 49 87 87 HIS HIS A . n A 1 50 LYS 50 88 88 LYS LYS A . n A 1 51 PRO 51 89 89 PRO PRO A . n A 1 52 SER 52 90 90 SER SER A . n A 1 53 GLY 53 91 91 GLY GLY A . n A 1 54 LEU 54 92 92 LEU LEU A . n A 1 55 VAL 55 93 93 VAL VAL A . n A 1 56 MET 56 94 94 MET MET A . n A 1 57 ALA 57 95 95 ALA ALA A . n A 1 58 ARG 58 96 96 ARG ARG A . n A 1 59 LYS 59 97 97 LYS LYS A . n A 1 60 LEU 60 98 98 LEU LEU A . n A 1 61 ILE 61 99 99 ILE ILE A . n A 1 62 HIS 62 100 100 HIS HIS A . n A 1 63 LEU 63 101 101 LEU LEU A . n A 1 64 GLU 64 102 102 GLU GLU A . n A 1 65 ILE 65 103 103 ILE ILE A . n A 1 66 LYS 66 104 104 LYS LYS A . n A 1 67 PRO 67 105 105 PRO PRO A . n A 1 68 ALA 68 106 106 ALA ALA A . n A 1 69 ILE 69 107 107 ILE ILE A . n A 1 70 ARG 70 108 108 ARG ARG A . n A 1 71 ASN 71 109 109 ASN ASN A . n A 1 72 GLN 72 110 110 GLN GLN A . n A 1 73 ILE 73 111 111 ILE ILE A . n A 1 74 ILE 74 112 112 ILE ILE A . n A 1 75 ARG 75 113 113 ARG ARG A . n A 1 76 GLU 76 114 114 GLU GLU A . n A 1 77 LEU 77 115 115 LEU LEU A . n A 1 78 GLN 78 116 116 GLN GLN A . n A 1 79 VAL 79 117 117 VAL VAL A . n A 1 80 LEU 80 118 118 LEU LEU A . n A 1 81 HIS 81 119 119 HIS HIS A . n A 1 82 GLU 82 120 120 GLU GLU A . n A 1 83 CYS 83 121 121 CYS CYS A . n A 1 84 ASN 84 122 122 ASN ASN A . n A 1 85 SER 85 123 123 SER SER A . n A 1 86 PRO 86 124 124 PRO PRO A . n A 1 87 TYR 87 125 125 TYR TYR A . n A 1 88 ILE 88 126 126 ILE ILE A . n A 1 89 VAL 89 127 127 VAL VAL A . n A 1 90 GLY 90 128 128 GLY GLY A . n A 1 91 PHE 91 129 129 PHE PHE A . n A 1 92 TYR 92 130 130 TYR TYR A . n A 1 93 GLY 93 131 131 GLY GLY A . n A 1 94 ALA 94 132 132 ALA ALA A . n A 1 95 PHE 95 133 133 PHE PHE A . n A 1 96 TYR 96 134 134 TYR TYR A . n A 1 97 SER 97 135 135 SER SER A . n A 1 98 ASP 98 136 136 ASP ASP A . n A 1 99 GLY 99 137 137 GLY GLY A . n A 1 100 GLU 100 138 138 GLU GLU A . n A 1 101 ILE 101 139 139 ILE ILE A . n A 1 102 SER 102 140 140 SER SER A . n A 1 103 ILE 103 141 141 ILE ILE A . n A 1 104 CYS 104 142 142 CYS CYS A . n A 1 105 MET 105 143 143 MET MET A . n A 1 106 GLU 106 144 144 GLU GLU A . n A 1 107 HIS 107 145 145 HIS HIS A . n A 1 108 MET 108 146 146 MET MET A . n A 1 109 ASP 109 147 147 ASP ASP A . n A 1 110 GLY 110 148 148 GLY GLY A . n A 1 111 GLY 111 149 149 GLY GLY A . n A 1 112 SER 112 150 150 SER SER A . n A 1 113 LEU 113 151 151 LEU LEU A . n A 1 114 ASP 114 152 152 ASP ASP A . n A 1 115 GLN 115 153 153 GLN GLN A . n A 1 116 VAL 116 154 154 VAL VAL A . n A 1 117 LEU 117 155 155 LEU LEU A . n A 1 118 LYS 118 156 156 LYS LYS A . n A 1 119 LYS 119 157 157 LYS LYS A . n A 1 120 ALA 120 158 158 ALA ALA A . n A 1 121 GLY 121 159 159 GLY GLY A . n A 1 122 ARG 122 160 160 ARG ARG A . n A 1 123 ILE 123 161 161 ILE ILE A . n A 1 124 PRO 124 162 162 PRO PRO A . n A 1 125 GLU 125 163 163 GLU GLU A . n A 1 126 GLN 126 164 164 GLN GLN A . n A 1 127 ILE 127 165 165 ILE ILE A . n A 1 128 LEU 128 166 166 LEU LEU A . n A 1 129 GLY 129 167 167 GLY GLY A . n A 1 130 LYS 130 168 168 LYS LYS A . n A 1 131 VAL 131 169 169 VAL VAL A . n A 1 132 SER 132 170 170 SER SER A . n A 1 133 ILE 133 171 171 ILE ILE A . n A 1 134 ALA 134 172 172 ALA ALA A . n A 1 135 VAL 135 173 173 VAL VAL A . n A 1 136 ILE 136 174 174 ILE ILE A . n A 1 137 LYS 137 175 175 LYS LYS A . n A 1 138 GLY 138 176 176 GLY GLY A . n A 1 139 LEU 139 177 177 LEU LEU A . n A 1 140 THR 140 178 178 THR THR A . n A 1 141 TYR 141 179 179 TYR TYR A . n A 1 142 LEU 142 180 180 LEU LEU A . n A 1 143 ARG 143 181 181 ARG ARG A . n A 1 144 GLU 144 182 182 GLU GLU A . n A 1 145 LYS 145 183 183 LYS LYS A . n A 1 146 HIS 146 184 184 HIS HIS A . n A 1 147 LYS 147 185 185 LYS LYS A . n A 1 148 ILE 148 186 186 ILE ILE A . n A 1 149 MET 149 187 187 MET MET A . n A 1 150 HIS 150 188 188 HIS HIS A . n A 1 151 ARG 151 189 189 ARG ARG A . n A 1 152 ASP 152 190 190 ASP ASP A . n A 1 153 VAL 153 191 191 VAL VAL A . n A 1 154 LYS 154 192 192 LYS LYS A . n A 1 155 PRO 155 193 193 PRO PRO A . n A 1 156 SER 156 194 194 SER SER A . n A 1 157 ASN 157 195 195 ASN ASN A . n A 1 158 ILE 158 196 196 ILE ILE A . n A 1 159 LEU 159 197 197 LEU LEU A . n A 1 160 VAL 160 198 198 VAL VAL A . n A 1 161 ASN 161 199 199 ASN ASN A . n A 1 162 SER 162 200 200 SER SER A . n A 1 163 ARG 163 201 201 ARG ARG A . n A 1 164 GLY 164 202 202 GLY GLY A . n A 1 165 GLU 165 203 203 GLU GLU A . n A 1 166 ILE 166 204 204 ILE ILE A . n A 1 167 LYS 167 205 205 LYS LYS A . n A 1 168 LEU 168 206 206 LEU LEU A . n A 1 169 CYS 169 207 207 CYS CYS A . n A 1 170 ASP 170 208 208 ASP ASP A . n A 1 171 PHE 171 209 209 PHE PHE A . n A 1 172 GLY 172 210 210 GLY GLY A . n A 1 173 VAL 173 211 211 VAL VAL A . n A 1 174 SER 174 212 212 SER SER A . n A 1 175 GLY 175 213 213 GLY GLY A . n A 1 176 GLN 176 214 214 GLN GLN A . n A 1 177 LEU 177 215 215 LEU LEU A . n A 1 178 ILE 178 216 216 ILE ILE A . n A 1 179 ASP 179 217 217 ASP ASP A . n A 1 180 SER 180 218 218 SER SER A . n A 1 181 MET 181 219 219 MET MET A . n A 1 182 ALA 182 220 220 ALA ALA A . n A 1 183 ASN 183 221 ? ? ? A . n A 1 184 SER 184 222 ? ? ? A . n A 1 185 PHE 185 223 ? ? ? A . n A 1 186 VAL 186 224 224 VAL VAL A . n A 1 187 GLY 187 225 225 GLY GLY A . n A 1 188 THR 188 226 226 THR THR A . n A 1 189 ARG 189 227 227 ARG ARG A . n A 1 190 SER 190 228 228 SER SER A . n A 1 191 TYR 191 229 229 TYR TYR A . n A 1 192 MET 192 230 230 MET MET A . n A 1 193 SER 193 231 231 SER SER A . n A 1 194 PRO 194 232 232 PRO PRO A . n A 1 195 GLU 195 233 233 GLU GLU A . n A 1 196 ARG 196 234 234 ARG ARG A . n A 1 197 LEU 197 235 235 LEU LEU A . n A 1 198 GLN 198 236 236 GLN GLN A . n A 1 199 GLY 199 237 237 GLY GLY A . n A 1 200 THR 200 238 238 THR THR A . n A 1 201 HIS 201 239 239 HIS HIS A . n A 1 202 TYR 202 240 240 TYR TYR A . n A 1 203 SER 203 241 241 SER SER A . n A 1 204 VAL 204 242 242 VAL VAL A . n A 1 205 GLN 205 243 243 GLN GLN A . n A 1 206 SER 206 244 244 SER SER A . n A 1 207 ASP 207 245 245 ASP ASP A . n A 1 208 ILE 208 246 246 ILE ILE A . n A 1 209 TRP 209 247 247 TRP TRP A . n A 1 210 SER 210 248 248 SER SER A . n A 1 211 MET 211 249 249 MET MET A . n A 1 212 GLY 212 250 250 GLY GLY A . n A 1 213 LEU 213 251 251 LEU LEU A . n A 1 214 SER 214 252 252 SER SER A . n A 1 215 LEU 215 253 253 LEU LEU A . n A 1 216 VAL 216 254 254 VAL VAL A . n A 1 217 GLU 217 255 255 GLU GLU A . n A 1 218 MET 218 256 256 MET MET A . n A 1 219 ALA 219 257 257 ALA ALA A . n A 1 220 VAL 220 258 258 VAL VAL A . n A 1 221 GLY 221 259 259 GLY GLY A . n A 1 222 ARG 222 260 260 ARG ARG A . n A 1 223 TYR 223 261 261 TYR TYR A . n A 1 224 PRO 224 262 262 PRO PRO A . n A 1 225 ILE 225 263 263 ILE ILE A . n A 1 226 PRO 226 264 264 PRO PRO A . n A 1 227 PRO 227 265 265 PRO PRO A . n A 1 228 PRO 228 266 266 PRO PRO A . n A 1 229 ASP 229 267 267 ASP ASP A . n A 1 230 ALA 230 268 268 ALA ALA A . n A 1 231 LYS 231 269 269 LYS LYS A . n A 1 232 GLU 232 270 270 GLU GLU A . n A 1 233 LEU 233 271 271 LEU LEU A . n A 1 234 GLU 234 272 272 GLU GLU A . n A 1 235 LEU 235 273 273 LEU LEU A . n A 1 236 MET 236 274 274 MET MET A . n A 1 237 PHE 237 275 275 PHE PHE A . n A 1 238 GLY 238 276 ? ? ? A . n A 1 239 CYS 239 277 ? ? ? A . n A 1 240 GLN 240 278 ? ? ? A . n A 1 241 VAL 241 279 ? ? ? A . n A 1 242 GLU 242 280 ? ? ? A . n A 1 243 GLY 243 281 ? ? ? A . n A 1 244 ASP 244 282 ? ? ? A . n A 1 245 ALA 245 283 ? ? ? A . n A 1 246 ALA 246 284 ? ? ? A . n A 1 247 GLU 247 285 ? ? ? A . n A 1 248 THR 248 286 ? ? ? A . n A 1 249 PRO 249 287 ? ? ? A . n A 1 250 PRO 250 288 ? ? ? A . n A 1 251 ARG 251 289 ? ? ? A . n A 1 252 PRO 252 290 ? ? ? A . n A 1 253 ARG 253 291 ? ? ? A . n A 1 254 THR 254 292 ? ? ? A . n A 1 255 PRO 255 293 ? ? ? A . n A 1 256 GLY 256 294 ? ? ? A . n A 1 257 ARG 257 295 ? ? ? A . n A 1 258 PRO 258 296 ? ? ? A . n A 1 259 LEU 259 297 ? ? ? A . n A 1 260 ASN 260 298 ? ? ? A . n A 1 261 LYS 261 299 ? ? ? A . n A 1 262 PHE 262 300 ? ? ? A . n A 1 263 GLY 263 301 ? ? ? A . n A 1 264 MET 264 302 ? ? ? A . n A 1 265 ASP 265 303 ? ? ? A . n A 1 266 SER 266 304 ? ? ? A . n A 1 267 ARG 267 305 ? ? ? A . n A 1 268 PRO 268 306 ? ? ? A . n A 1 269 PRO 269 307 307 PRO PRO A . n A 1 270 MET 270 308 308 MET MET A . n A 1 271 ALA 271 309 309 ALA ALA A . n A 1 272 ILE 272 310 310 ILE ILE A . n A 1 273 PHE 273 311 311 PHE PHE A . n A 1 274 GLU 274 312 312 GLU GLU A . n A 1 275 LEU 275 313 313 LEU LEU A . n A 1 276 LEU 276 314 314 LEU LEU A . n A 1 277 ASP 277 315 315 ASP ASP A . n A 1 278 TYR 278 316 316 TYR TYR A . n A 1 279 ILE 279 317 317 ILE ILE A . n A 1 280 VAL 280 318 318 VAL VAL A . n A 1 281 ASN 281 319 319 ASN ASN A . n A 1 282 GLU 282 320 320 GLU GLU A . n A 1 283 PRO 283 321 321 PRO PRO A . n A 1 284 PRO 284 322 322 PRO PRO A . n A 1 285 PRO 285 323 323 PRO PRO A . n A 1 286 LYS 286 324 324 LYS LYS A . n A 1 287 LEU 287 325 325 LEU LEU A . n A 1 288 PRO 288 326 326 PRO PRO A . n A 1 289 SER 289 327 327 SER SER A . n A 1 290 GLY 290 328 328 GLY GLY A . n A 1 291 VAL 291 329 329 VAL VAL A . n A 1 292 PHE 292 330 330 PHE PHE A . n A 1 293 SER 293 331 331 SER SER A . n A 1 294 LEU 294 332 332 LEU LEU A . n A 1 295 GLU 295 333 333 GLU GLU A . n A 1 296 PHE 296 334 334 PHE PHE A . n A 1 297 GLN 297 335 335 GLN GLN A . n A 1 298 ASP 298 336 336 ASP ASP A . n A 1 299 PHE 299 337 337 PHE PHE A . n A 1 300 VAL 300 338 338 VAL VAL A . n A 1 301 ASN 301 339 339 ASN ASN A . n A 1 302 LYS 302 340 340 LYS LYS A . n A 1 303 CYS 303 341 341 CYS CYS A . n A 1 304 LEU 304 342 342 LEU LEU A . n A 1 305 ILE 305 343 343 ILE ILE A . n A 1 306 LYS 306 344 344 LYS LYS A . n A 1 307 ASN 307 345 345 ASN ASN A . n A 1 308 PRO 308 346 346 PRO PRO A . n A 1 309 ALA 309 347 347 ALA ALA A . n A 1 310 GLU 310 348 348 GLU GLU A . n A 1 311 ARG 311 349 349 ARG ARG A . n A 1 312 ALA 312 350 350 ALA ALA A . n A 1 313 ASP 313 351 351 ASP ASP A . n A 1 314 LEU 314 352 352 LEU LEU A . n A 1 315 LYS 315 353 353 LYS LYS A . n A 1 316 GLN 316 354 354 GLN GLN A . n A 1 317 LEU 317 355 355 LEU LEU A . n A 1 318 MET 318 356 356 MET MET A . n A 1 319 VAL 319 357 357 VAL VAL A . n A 1 320 HIS 320 358 358 HIS HIS A . n A 1 321 ALA 321 359 359 ALA ALA A . n A 1 322 PHE 322 360 360 PHE PHE A . n A 1 323 ILE 323 361 361 ILE ILE A . n A 1 324 LYS 324 362 362 LYS LYS A . n A 1 325 ARG 325 363 363 ARG ARG A . n A 1 326 SER 326 364 364 SER SER A . n A 1 327 ASP 327 365 365 ASP ASP A . n A 1 328 ALA 328 366 366 ALA ALA A . n A 1 329 GLU 329 367 367 GLU GLU A . n A 1 330 GLU 330 368 368 GLU GLU A . n A 1 331 VAL 331 369 369 VAL VAL A . n A 1 332 ASP 332 370 370 ASP ASP A . n A 1 333 PHE 333 371 371 PHE PHE A . n A 1 334 ALA 334 372 372 ALA ALA A . n A 1 335 GLY 335 373 373 GLY GLY A . n A 1 336 TRP 336 374 374 TRP TRP A . n A 1 337 LEU 337 375 375 LEU LEU A . n A 1 338 CYS 338 376 376 CYS CYS A . n A 1 339 SER 339 377 377 SER SER A . n A 1 340 THR 340 378 378 THR THR A . n A 1 341 ILE 341 379 379 ILE ILE A . n A 1 342 GLY 342 380 380 GLY GLY A . n A 1 343 LEU 343 381 381 LEU LEU A . n A 1 344 ASN 344 382 382 ASN ASN A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 80C 1 401 1 80C INX A . C 3 CA 1 402 1 CA CA A . D 3 CA 1 403 2 CA CA A . E 4 MG 1 404 3 MG MG A . F 5 HOH 1 501 186 HOH HOH A . F 5 HOH 2 502 126 HOH HOH A . F 5 HOH 3 503 63 HOH HOH A . F 5 HOH 4 504 178 HOH HOH A . F 5 HOH 5 505 35 HOH HOH A . F 5 HOH 6 506 47 HOH HOH A . F 5 HOH 7 507 149 HOH HOH A . F 5 HOH 8 508 98 HOH HOH A . F 5 HOH 9 509 30 HOH HOH A . F 5 HOH 10 510 105 HOH HOH A . F 5 HOH 11 511 29 HOH HOH A . F 5 HOH 12 512 9 HOH HOH A . F 5 HOH 13 513 32 HOH HOH A . F 5 HOH 14 514 170 HOH HOH A . F 5 HOH 15 515 39 HOH HOH A . F 5 HOH 16 516 40 HOH HOH A . F 5 HOH 17 517 104 HOH HOH A . F 5 HOH 18 518 37 HOH HOH A . F 5 HOH 19 519 89 HOH HOH A . F 5 HOH 20 520 102 HOH HOH A . F 5 HOH 21 521 142 HOH HOH A . F 5 HOH 22 522 21 HOH HOH A . F 5 HOH 23 523 81 HOH HOH A . F 5 HOH 24 524 36 HOH HOH A . F 5 HOH 25 525 70 HOH HOH A . F 5 HOH 26 526 135 HOH HOH A . F 5 HOH 27 527 38 HOH HOH A . F 5 HOH 28 528 127 HOH HOH A . F 5 HOH 29 529 64 HOH HOH A . F 5 HOH 30 530 189 HOH HOH A . F 5 HOH 31 531 106 HOH HOH A . F 5 HOH 32 532 164 HOH HOH A . F 5 HOH 33 533 95 HOH HOH A . F 5 HOH 34 534 50 HOH HOH A . F 5 HOH 35 535 61 HOH HOH A . F 5 HOH 36 536 59 HOH HOH A . F 5 HOH 37 537 148 HOH HOH A . F 5 HOH 38 538 60 HOH HOH A . F 5 HOH 39 539 17 HOH HOH A . F 5 HOH 40 540 183 HOH HOH A . F 5 HOH 41 541 125 HOH HOH A . F 5 HOH 42 542 76 HOH HOH A . F 5 HOH 43 543 121 HOH HOH A . F 5 HOH 44 544 162 HOH HOH A . F 5 HOH 45 545 8 HOH HOH A . F 5 HOH 46 546 52 HOH HOH A . F 5 HOH 47 547 31 HOH HOH A . F 5 HOH 48 548 12 HOH HOH A . F 5 HOH 49 549 180 HOH HOH A . F 5 HOH 50 550 49 HOH HOH A . F 5 HOH 51 551 94 HOH HOH A . F 5 HOH 52 552 168 HOH HOH A . F 5 HOH 53 553 3 HOH HOH A . F 5 HOH 54 554 156 HOH HOH A . F 5 HOH 55 555 100 HOH HOH A . F 5 HOH 56 556 97 HOH HOH A . F 5 HOH 57 557 145 HOH HOH A . F 5 HOH 58 558 115 HOH HOH A . F 5 HOH 59 559 2 HOH HOH A . F 5 HOH 60 560 33 HOH HOH A . F 5 HOH 61 561 1 HOH HOH A . F 5 HOH 62 562 27 HOH HOH A . F 5 HOH 63 563 129 HOH HOH A . F 5 HOH 64 564 87 HOH HOH A . F 5 HOH 65 565 140 HOH HOH A . F 5 HOH 66 566 10 HOH HOH A . F 5 HOH 67 567 58 HOH HOH A . F 5 HOH 68 568 84 HOH HOH A . F 5 HOH 69 569 55 HOH HOH A . F 5 HOH 70 570 163 HOH HOH A . F 5 HOH 71 571 85 HOH HOH A . F 5 HOH 72 572 44 HOH HOH A . F 5 HOH 73 573 45 HOH HOH A . F 5 HOH 74 574 22 HOH HOH A . F 5 HOH 75 575 7 HOH HOH A . F 5 HOH 76 576 117 HOH HOH A . F 5 HOH 77 577 62 HOH HOH A . F 5 HOH 78 578 13 HOH HOH A . F 5 HOH 79 579 165 HOH HOH A . F 5 HOH 80 580 99 HOH HOH A . F 5 HOH 81 581 66 HOH HOH A . F 5 HOH 82 582 68 HOH HOH A . F 5 HOH 83 583 34 HOH HOH A . F 5 HOH 84 584 190 HOH HOH A . F 5 HOH 85 585 26 HOH HOH A . F 5 HOH 86 586 101 HOH HOH A . F 5 HOH 87 587 14 HOH HOH A . F 5 HOH 88 588 185 HOH HOH A . F 5 HOH 89 589 46 HOH HOH A . F 5 HOH 90 590 154 HOH HOH A . F 5 HOH 91 591 28 HOH HOH A . F 5 HOH 92 592 110 HOH HOH A . F 5 HOH 93 593 25 HOH HOH A . F 5 HOH 94 594 88 HOH HOH A . F 5 HOH 95 595 69 HOH HOH A . F 5 HOH 96 596 6 HOH HOH A . F 5 HOH 97 597 93 HOH HOH A . F 5 HOH 98 598 18 HOH HOH A . F 5 HOH 99 599 188 HOH HOH A . F 5 HOH 100 600 96 HOH HOH A . F 5 HOH 101 601 75 HOH HOH A . F 5 HOH 102 602 174 HOH HOH A . F 5 HOH 103 603 15 HOH HOH A . F 5 HOH 104 604 23 HOH HOH A . F 5 HOH 105 605 133 HOH HOH A . F 5 HOH 106 606 137 HOH HOH A . F 5 HOH 107 607 11 HOH HOH A . F 5 HOH 108 608 43 HOH HOH A . F 5 HOH 109 609 109 HOH HOH A . F 5 HOH 110 610 150 HOH HOH A . F 5 HOH 111 611 112 HOH HOH A . F 5 HOH 112 612 77 HOH HOH A . F 5 HOH 113 613 146 HOH HOH A . F 5 HOH 114 614 161 HOH HOH A . F 5 HOH 115 615 56 HOH HOH A . F 5 HOH 116 616 5 HOH HOH A . F 5 HOH 117 617 114 HOH HOH A . F 5 HOH 118 618 90 HOH HOH A . F 5 HOH 119 619 107 HOH HOH A . F 5 HOH 120 620 92 HOH HOH A . F 5 HOH 121 621 91 HOH HOH A . F 5 HOH 122 622 184 HOH HOH A . F 5 HOH 123 623 108 HOH HOH A . F 5 HOH 124 624 138 HOH HOH A . F 5 HOH 125 625 71 HOH HOH A . F 5 HOH 126 626 65 HOH HOH A . F 5 HOH 127 627 72 HOH HOH A . F 5 HOH 128 628 143 HOH HOH A . F 5 HOH 129 629 16 HOH HOH A . F 5 HOH 130 630 187 HOH HOH A . F 5 HOH 131 631 42 HOH HOH A . F 5 HOH 132 632 147 HOH HOH A . F 5 HOH 133 633 123 HOH HOH A . F 5 HOH 134 634 139 HOH HOH A . F 5 HOH 135 635 51 HOH HOH A . F 5 HOH 136 636 152 HOH HOH A . F 5 HOH 137 637 83 HOH HOH A . F 5 HOH 138 638 19 HOH HOH A . F 5 HOH 139 639 128 HOH HOH A . F 5 HOH 140 640 176 HOH HOH A . F 5 HOH 141 641 54 HOH HOH A . F 5 HOH 142 642 132 HOH HOH A . F 5 HOH 143 643 175 HOH HOH A . F 5 HOH 144 644 111 HOH HOH A . F 5 HOH 145 645 120 HOH HOH A . F 5 HOH 146 646 118 HOH HOH A . F 5 HOH 147 647 4 HOH HOH A . F 5 HOH 148 648 116 HOH HOH A . F 5 HOH 149 649 155 HOH HOH A . F 5 HOH 150 650 67 HOH HOH A . F 5 HOH 151 651 122 HOH HOH A . F 5 HOH 152 652 160 HOH HOH A . F 5 HOH 153 653 86 HOH HOH A . F 5 HOH 154 654 119 HOH HOH A . F 5 HOH 155 655 134 HOH HOH A . F 5 HOH 156 656 53 HOH HOH A . F 5 HOH 157 657 57 HOH HOH A . F 5 HOH 158 658 41 HOH HOH A . F 5 HOH 159 659 24 HOH HOH A . F 5 HOH 160 660 131 HOH HOH A . F 5 HOH 161 661 157 HOH HOH A . F 5 HOH 162 662 144 HOH HOH A . F 5 HOH 163 663 113 HOH HOH A . F 5 HOH 164 664 179 HOH HOH A . F 5 HOH 165 665 103 HOH HOH A . F 5 HOH 166 666 166 HOH HOH A . F 5 HOH 167 667 182 HOH HOH A . F 5 HOH 168 668 151 HOH HOH A . F 5 HOH 169 669 130 HOH HOH A . F 5 HOH 170 670 73 HOH HOH A . F 5 HOH 171 671 136 HOH HOH A . F 5 HOH 172 672 20 HOH HOH A . F 5 HOH 173 673 173 HOH HOH A . F 5 HOH 174 674 181 HOH HOH A . F 5 HOH 175 675 158 HOH HOH A . F 5 HOH 176 676 82 HOH HOH A . F 5 HOH 177 677 172 HOH HOH A . F 5 HOH 178 678 124 HOH HOH A . F 5 HOH 179 679 169 HOH HOH A . F 5 HOH 180 680 153 HOH HOH A . F 5 HOH 181 681 159 HOH HOH A . F 5 HOH 182 682 141 HOH HOH A . F 5 HOH 183 683 79 HOH HOH A . F 5 HOH 184 684 167 HOH HOH A . F 5 HOH 185 685 177 HOH HOH A . F 5 HOH 186 686 48 HOH HOH A . F 5 HOH 187 687 74 HOH HOH A . F 5 HOH 188 688 80 HOH HOH A . F 5 HOH 189 689 171 HOH HOH A . F 5 HOH 190 690 78 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 250 ? 1 MORE -22 ? 1 'SSA (A^2)' 15120 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A CA 402 ? C CA . 2 1 A HOH 576 ? F HOH . 3 1 A HOH 617 ? F HOH . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD2 ? A ASP 27 ? A ASP 65 ? 1_555 CA ? C CA . ? A CA 402 ? 1_555 OD2 ? A ASP 27 ? A ASP 65 ? 1_555 0.0 ? 2 OD2 ? A ASP 27 ? A ASP 65 ? 1_555 CA ? C CA . ? A CA 402 ? 1_555 OD1 ? A ASP 28 ? A ASP 66 ? 1_555 88.2 ? 3 OD2 ? A ASP 27 ? A ASP 65 ? 1_555 CA ? C CA . ? A CA 402 ? 1_555 OD1 ? A ASP 28 ? A ASP 66 ? 1_555 88.2 ? 4 OD2 ? A ASP 27 ? A ASP 65 ? 1_555 CA ? C CA . ? A CA 402 ? 1_555 OD1 ? A ASP 28 ? A ASP 66 ? 1_555 88.2 ? 5 OD2 ? A ASP 27 ? A ASP 65 ? 1_555 CA ? C CA . ? A CA 402 ? 1_555 OD1 ? A ASP 28 ? A ASP 66 ? 1_555 88.2 ? 6 OD1 ? A ASP 28 ? A ASP 66 ? 1_555 CA ? C CA . ? A CA 402 ? 1_555 OD1 ? A ASP 28 ? A ASP 66 ? 1_555 0.0 ? 7 OD2 ? A ASP 27 ? A ASP 65 ? 1_555 CA ? C CA . ? A CA 402 ? 1_555 O ? F HOH . ? A HOH 528 ? 1_555 90.1 ? 8 OD2 ? A ASP 27 ? A ASP 65 ? 1_555 CA ? C CA . ? A CA 402 ? 1_555 O ? F HOH . ? A HOH 528 ? 1_555 90.1 ? 9 OD1 ? A ASP 28 ? A ASP 66 ? 1_555 CA ? C CA . ? A CA 402 ? 1_555 O ? F HOH . ? A HOH 528 ? 1_555 168.7 ? 10 OD1 ? A ASP 28 ? A ASP 66 ? 1_555 CA ? C CA . ? A CA 402 ? 1_555 O ? F HOH . ? A HOH 528 ? 1_555 168.7 ? 11 OD2 ? A ASP 27 ? A ASP 65 ? 1_555 CA ? C CA . ? A CA 402 ? 1_555 O ? F HOH . ? A HOH 528 ? 11_555 96.3 ? 12 OD2 ? A ASP 27 ? A ASP 65 ? 1_555 CA ? C CA . ? A CA 402 ? 1_555 O ? F HOH . ? A HOH 528 ? 11_555 96.3 ? 13 OD1 ? A ASP 28 ? A ASP 66 ? 1_555 CA ? C CA . ? A CA 402 ? 1_555 O ? F HOH . ? A HOH 528 ? 11_555 74.4 ? 14 OD1 ? A ASP 28 ? A ASP 66 ? 1_555 CA ? C CA . ? A CA 402 ? 1_555 O ? F HOH . ? A HOH 528 ? 11_555 74.4 ? 15 O ? F HOH . ? A HOH 528 ? 1_555 CA ? C CA . ? A CA 402 ? 1_555 O ? F HOH . ? A HOH 528 ? 11_555 116.9 ? 16 OD1 ? A ASP 27 ? A ASP 65 ? 1_555 CA ? D CA . ? A CA 403 ? 11_555 OD2 ? A ASP 27 ? A ASP 65 ? 1_555 44.1 ? 17 OD1 ? A ASP 27 ? A ASP 65 ? 1_555 CA ? D CA . ? A CA 403 ? 11_555 OD2 ? A ASP 28 ? A ASP 66 ? 1_555 73.8 ? 18 OD2 ? A ASP 27 ? A ASP 65 ? 1_555 CA ? D CA . ? A CA 403 ? 11_555 OD2 ? A ASP 28 ? A ASP 66 ? 1_555 30.3 ? 19 OD1 ? A ASP 27 ? A ASP 65 ? 1_555 CA ? D CA . ? A CA 403 ? 11_555 O ? F HOH . ? A HOH 540 ? 11_555 90.0 ? 20 OD2 ? A ASP 27 ? A ASP 65 ? 1_555 CA ? D CA . ? A CA 403 ? 11_555 O ? F HOH . ? A HOH 540 ? 11_555 48.5 ? 21 OD2 ? A ASP 28 ? A ASP 66 ? 1_555 CA ? D CA . ? A CA 403 ? 11_555 O ? F HOH . ? A HOH 540 ? 11_555 19.3 ? 22 OD1 ? A ASP 27 ? A ASP 65 ? 1_555 CA ? D CA . ? A CA 403 ? 11_555 O ? F HOH . ? A HOH 556 ? 11_555 67.7 ? 23 OD2 ? A ASP 27 ? A ASP 65 ? 1_555 CA ? D CA . ? A CA 403 ? 11_555 O ? F HOH . ? A HOH 556 ? 11_555 39.5 ? 24 OD2 ? A ASP 28 ? A ASP 66 ? 1_555 CA ? D CA . ? A CA 403 ? 11_555 O ? F HOH . ? A HOH 556 ? 11_555 30.5 ? 25 O ? F HOH . ? A HOH 540 ? 11_555 CA ? D CA . ? A CA 403 ? 11_555 O ? F HOH . ? A HOH 556 ? 11_555 30.4 ? 26 OD1 ? A ASP 27 ? A ASP 65 ? 1_555 CA ? D CA . ? A CA 403 ? 11_555 O ? F HOH . ? A HOH 611 ? 1_555 63.2 ? 27 OD2 ? A ASP 27 ? A ASP 65 ? 1_555 CA ? D CA . ? A CA 403 ? 11_555 O ? F HOH . ? A HOH 611 ? 1_555 24.2 ? 28 OD2 ? A ASP 28 ? A ASP 66 ? 1_555 CA ? D CA . ? A CA 403 ? 11_555 O ? F HOH . ? A HOH 611 ? 1_555 15.0 ? 29 O ? F HOH . ? A HOH 540 ? 11_555 CA ? D CA . ? A CA 403 ? 11_555 O ? F HOH . ? A HOH 611 ? 1_555 26.9 ? 30 O ? F HOH . ? A HOH 556 ? 11_555 CA ? D CA . ? A CA 403 ? 11_555 O ? F HOH . ? A HOH 611 ? 1_555 19.0 ? 31 OD1 ? A ASP 27 ? A ASP 65 ? 1_555 CA ? D CA . ? A CA 403 ? 11_555 O ? F HOH . ? A HOH 646 ? 11_555 78.7 ? 32 OD2 ? A ASP 27 ? A ASP 65 ? 1_555 CA ? D CA . ? A CA 403 ? 11_555 O ? F HOH . ? A HOH 646 ? 11_555 41.2 ? 33 OD2 ? A ASP 28 ? A ASP 66 ? 1_555 CA ? D CA . ? A CA 403 ? 11_555 O ? F HOH . ? A HOH 646 ? 11_555 19.0 ? 34 O ? F HOH . ? A HOH 540 ? 11_555 CA ? D CA . ? A CA 403 ? 11_555 O ? F HOH . ? A HOH 646 ? 11_555 14.1 ? 35 O ? F HOH . ? A HOH 556 ? 11_555 CA ? D CA . ? A CA 403 ? 11_555 O ? F HOH . ? A HOH 646 ? 11_555 16.4 ? 36 O ? F HOH . ? A HOH 611 ? 1_555 CA ? D CA . ? A CA 403 ? 11_555 O ? F HOH . ? A HOH 646 ? 11_555 17.1 ? 37 OD2 ? A ASP 152 ? A ASP 190 ? 1_555 MG ? E MG . ? A MG 404 ? 1_555 OD2 ? A ASP 170 ? A ASP 208 ? 1_555 97.3 ? 38 OD2 ? A ASP 152 ? A ASP 190 ? 1_555 MG ? E MG . ? A MG 404 ? 1_555 O ? F HOH . ? A HOH 621 ? 1_555 172.6 ? 39 OD2 ? A ASP 170 ? A ASP 208 ? 1_555 MG ? E MG . ? A MG 404 ? 1_555 O ? F HOH . ? A HOH 621 ? 1_555 75.9 ? 40 OD2 ? A ASP 152 ? A ASP 190 ? 1_555 MG ? E MG . ? A MG 404 ? 1_555 O ? F HOH . ? A HOH 630 ? 1_555 91.0 ? 41 OD2 ? A ASP 170 ? A ASP 208 ? 1_555 MG ? E MG . ? A MG 404 ? 1_555 O ? F HOH . ? A HOH 630 ? 1_555 83.8 ? 42 O ? F HOH . ? A HOH 621 ? 1_555 MG ? E MG . ? A MG 404 ? 1_555 O ? F HOH . ? A HOH 630 ? 1_555 91.3 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-03-16 2 'Structure model' 1 1 2022-03-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation_author.identifier_ORCID' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.2.0005 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 4 # _pdbx_entry_details.entry_id 7PQV _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 135 ? ? -162.55 115.79 2 1 ARG A 189 ? ? 78.98 -5.23 3 1 ASP A 190 ? ? -158.79 54.09 4 1 VAL A 211 ? ? -130.10 -41.54 5 1 THR A 238 ? ? -109.49 -169.62 6 1 HIS A 239 ? ? -55.59 103.34 7 1 SER A 241 ? ? -147.61 -157.02 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 0 A GLU 39 ? CG ? A GLU 1 CG 2 1 Y 0 A GLU 39 ? CD ? A GLU 1 CD 3 1 Y 0 A GLU 39 ? OE1 ? A GLU 1 OE1 4 1 Y 0 A GLU 39 ? OE2 ? A GLU 1 OE2 5 1 Y 0 A LEU 40 ? CG ? A LEU 2 CG 6 1 Y 0 A LEU 40 ? CD1 ? A LEU 2 CD1 7 1 Y 0 A LEU 40 ? CD2 ? A LEU 2 CD2 8 1 Y 0 A GLU 41 ? CG ? A GLU 3 CG 9 1 Y 0 A GLU 41 ? CD ? A GLU 3 CD 10 1 Y 0 A GLU 41 ? OE1 ? A GLU 3 OE1 11 1 Y 0 A GLU 41 ? OE2 ? A GLU 3 OE2 12 1 Y 0 A GLU 44 ? OE1 ? A GLU 6 OE1 13 1 Y 0 A GLU 44 ? OE2 ? A GLU 6 OE2 14 1 Y 0 A ARG 47 ? CD ? A ARG 9 CD 15 1 Y 0 A ARG 47 ? NE ? A ARG 9 NE 16 1 Y 0 A ARG 47 ? CZ ? A ARG 9 CZ 17 1 Y 0 A ARG 47 ? NH1 ? A ARG 9 NH1 18 1 Y 0 A ARG 47 ? NH2 ? A ARG 9 NH2 19 1 Y 0 A LYS 48 ? CD ? A LYS 10 CD 20 1 Y 0 A LYS 48 ? CE ? A LYS 10 CE 21 1 Y 0 A LYS 48 ? NZ ? A LYS 10 NZ 22 1 Y 0 A GLU 51 ? CD ? A GLU 13 CD 23 1 Y 0 A GLU 51 ? OE1 ? A GLU 13 OE1 24 1 Y 0 A GLU 51 ? OE2 ? A GLU 13 OE2 25 1 Y 0 A GLN 56 ? OE1 ? A GLN 18 OE1 26 1 Y 0 A GLN 56 ? NE2 ? A GLN 18 NE2 27 1 Y 0 A GLN 58 ? CG ? A GLN 20 CG 28 1 Y 0 A GLN 58 ? CD ? A GLN 20 CD 29 1 Y 0 A GLN 58 ? OE1 ? A GLN 20 OE1 30 1 Y 0 A GLN 58 ? NE2 ? A GLN 20 NE2 31 1 Y 0 A LYS 59 ? NZ ? A LYS 21 NZ 32 1 Y 0 A GLU 62 ? CD ? A GLU 24 CD 33 1 Y 0 A GLU 62 ? OE1 ? A GLU 24 OE1 34 1 Y 0 A GLU 62 ? OE2 ? A GLU 24 OE2 35 1 Y 0 A LYS 64 ? CE ? A LYS 26 CE 36 1 Y 0 A LYS 64 ? NZ ? A LYS 26 NZ 37 1 Y 0 A GLU 69 ? CD ? A GLU 31 CD 38 1 Y 0 A GLU 69 ? OE1 ? A GLU 31 OE1 39 1 Y 0 A GLU 69 ? OE2 ? A GLU 31 OE2 40 1 Y 0 A LYS 70 ? CD ? A LYS 32 CD 41 1 Y 0 A LYS 70 ? CE ? A LYS 32 CE 42 1 Y 0 A LYS 70 ? NZ ? A LYS 32 NZ 43 1 Y 0 A GLU 73 ? CD ? A GLU 35 CD 44 1 Y 0 A GLU 73 ? OE1 ? A GLU 35 OE1 45 1 Y 0 A GLU 73 ? OE2 ? A GLU 35 OE2 46 1 Y 0 A VAL 81 ? CG1 ? A VAL 43 CG1 47 1 Y 0 A VAL 81 ? CG2 ? A VAL 43 CG2 48 1 Y 0 A HIS 100 ? ND1 ? A HIS 62 ND1 49 1 Y 0 A HIS 100 ? CD2 ? A HIS 62 CD2 50 1 Y 0 A HIS 100 ? CE1 ? A HIS 62 CE1 51 1 Y 0 A HIS 100 ? NE2 ? A HIS 62 NE2 52 1 Y 0 A GLU 102 ? CG ? A GLU 64 CG 53 1 Y 0 A GLU 102 ? CD ? A GLU 64 CD 54 1 Y 0 A GLU 102 ? OE1 ? A GLU 64 OE1 55 1 Y 0 A GLU 102 ? OE2 ? A GLU 64 OE2 56 1 Y 0 A ILE 103 ? CD1 ? A ILE 65 CD1 57 1 Y 0 A LYS 104 ? CG ? A LYS 66 CG 58 1 Y 0 A LYS 104 ? CD ? A LYS 66 CD 59 1 Y 0 A LYS 104 ? CE ? A LYS 66 CE 60 1 Y 0 A LYS 104 ? NZ ? A LYS 66 NZ 61 1 Y 0 A LYS 157 ? NZ ? A LYS 119 NZ 62 1 Y 0 A LYS 183 ? NZ ? A LYS 145 NZ 63 1 Y 0 A LYS 185 ? CD ? A LYS 147 CD 64 1 Y 0 A LYS 185 ? CE ? A LYS 147 CE 65 1 Y 0 A LYS 185 ? NZ ? A LYS 147 NZ 66 1 Y 0 A ILE 186 ? CD1 ? A ILE 148 CD1 67 1 Y 0 A ILE 216 ? CG1 ? A ILE 178 CG1 68 1 Y 0 A ILE 216 ? CG2 ? A ILE 178 CG2 69 1 Y 0 A ILE 216 ? CD1 ? A ILE 178 CD1 70 1 Y 0 A GLN 236 ? OE1 ? A GLN 198 OE1 71 1 Y 0 A GLN 236 ? NE2 ? A GLN 198 NE2 72 1 Y 0 A HIS 239 ? CG ? A HIS 201 CG 73 1 Y 0 A HIS 239 ? ND1 ? A HIS 201 ND1 74 1 Y 0 A HIS 239 ? CD2 ? A HIS 201 CD2 75 1 Y 0 A HIS 239 ? CE1 ? A HIS 201 CE1 76 1 Y 0 A HIS 239 ? NE2 ? A HIS 201 NE2 77 1 Y 0 A LYS 269 ? CG ? A LYS 231 CG 78 1 Y 0 A LYS 269 ? CD ? A LYS 231 CD 79 1 Y 0 A LYS 269 ? CE ? A LYS 231 CE 80 1 Y 0 A LYS 269 ? NZ ? A LYS 231 NZ 81 1 Y 0 A GLU 270 ? CG ? A GLU 232 CG 82 1 Y 0 A GLU 270 ? CD ? A GLU 232 CD 83 1 Y 0 A GLU 270 ? OE1 ? A GLU 232 OE1 84 1 Y 0 A GLU 270 ? OE2 ? A GLU 232 OE2 85 1 Y 0 A GLU 272 ? CG ? A GLU 234 CG 86 1 Y 0 A GLU 272 ? CD ? A GLU 234 CD 87 1 Y 0 A GLU 272 ? OE1 ? A GLU 234 OE1 88 1 Y 0 A GLU 272 ? OE2 ? A GLU 234 OE2 89 1 Y 0 A LEU 273 ? CG ? A LEU 235 CG 90 1 Y 0 A LEU 273 ? CD1 ? A LEU 235 CD1 91 1 Y 0 A LEU 273 ? CD2 ? A LEU 235 CD2 92 1 Y 0 A GLU 348 ? OE1 ? A GLU 310 OE1 93 1 Y 0 A GLU 348 ? OE2 ? A GLU 310 OE2 94 1 Y 0 A LYS 362 ? CD ? A LYS 324 CD 95 1 Y 0 A LYS 362 ? CE ? A LYS 324 CE 96 1 Y 0 A LYS 362 ? NZ ? A LYS 324 NZ 97 1 Y 0 A GLU 368 ? CG ? A GLU 330 CG 98 1 Y 0 A GLU 368 ? CD ? A GLU 330 CD 99 1 Y 0 A GLU 368 ? OE1 ? A GLU 330 OE1 100 1 Y 0 A GLU 368 ? OE2 ? A GLU 330 OE2 101 1 Y 0 A ASN 382 ? CG ? A ASN 344 CG 102 1 Y 0 A ASN 382 ? OD1 ? A ASN 344 OD1 103 1 Y 0 A ASN 382 ? ND2 ? A ASN 344 ND2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ASN 221 ? A ASN 183 2 1 Y 1 A SER 222 ? A SER 184 3 1 Y 1 A PHE 223 ? A PHE 185 4 1 Y 1 A GLY 276 ? A GLY 238 5 1 Y 1 A CYS 277 ? A CYS 239 6 1 Y 1 A GLN 278 ? A GLN 240 7 1 Y 1 A VAL 279 ? A VAL 241 8 1 Y 1 A GLU 280 ? A GLU 242 9 1 Y 1 A GLY 281 ? A GLY 243 10 1 Y 1 A ASP 282 ? A ASP 244 11 1 Y 1 A ALA 283 ? A ALA 245 12 1 Y 1 A ALA 284 ? A ALA 246 13 1 Y 1 A GLU 285 ? A GLU 247 14 1 Y 1 A THR 286 ? A THR 248 15 1 Y 1 A PRO 287 ? A PRO 249 16 1 Y 1 A PRO 288 ? A PRO 250 17 1 Y 1 A ARG 289 ? A ARG 251 18 1 Y 1 A PRO 290 ? A PRO 252 19 1 Y 1 A ARG 291 ? A ARG 253 20 1 Y 1 A THR 292 ? A THR 254 21 1 Y 1 A PRO 293 ? A PRO 255 22 1 Y 1 A GLY 294 ? A GLY 256 23 1 Y 1 A ARG 295 ? A ARG 257 24 1 Y 1 A PRO 296 ? A PRO 258 25 1 Y 1 A LEU 297 ? A LEU 259 26 1 Y 1 A ASN 298 ? A ASN 260 27 1 Y 1 A LYS 299 ? A LYS 261 28 1 Y 1 A PHE 300 ? A PHE 262 29 1 Y 1 A GLY 301 ? A GLY 263 30 1 Y 1 A MET 302 ? A MET 264 31 1 Y 1 A ASP 303 ? A ASP 265 32 1 Y 1 A SER 304 ? A SER 266 33 1 Y 1 A ARG 305 ? A ARG 267 34 1 Y 1 A PRO 306 ? A PRO 268 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id 80C _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id 80C _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '8-(2-chloranyl-4-methoxy-phenyl)-7-fluoranyl-1-piperidin-4-yl-imidazo[4,5-c]quinoline' 80C 3 'CALCIUM ION' CA 4 'MAGNESIUM ION' MG 5 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #