data_7PUZ # _entry.id 7PUZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7PUZ pdb_00007puz 10.2210/pdb7puz/pdb WWPDB D_1292118204 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-09-07 2 'Structure model' 1 1 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7PUZ _pdbx_database_status.recvd_initial_deposition_date 2021-10-01 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email oliver.daumke@mdc-berlin.de _pdbx_contact_author.name_first Oilver _pdbx_contact_author.name_last Daumke _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-6190-1414 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Bock-Bierbaum, T.' 1 0000-0003-0843-2716 'Funck, K.' 2 0000-0001-6478-5562 'Daumke, O.' 3 0000-0002-6190-1414 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Adv' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2375-2548 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 8 _citation.language ? _citation.page_first eabo4946 _citation.page_last eabo4946 _citation.title 'Structural insights into crista junction formation by the Mic60-Mic19 complex.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1126/sciadv.abo4946 _citation.pdbx_database_id_PubMed 36044574 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bock-Bierbaum, T.' 1 0000-0003-0843-2716 primary 'Funck, K.' 2 0000-0001-6478-5562 primary 'Wollweber, F.' 3 0000-0003-4191-5226 primary 'Lisicki, E.' 4 0000-0001-5012-8377 primary 'von der Malsburg, K.' 5 ? primary 'von der Malsburg, A.' 6 ? primary 'Laborenz, J.' 7 ? primary 'Noel, J.K.' 8 0000-0003-3168-6036 primary 'Hessenberger, M.' 9 0000-0003-3021-1100 primary 'Jungbluth, S.' 10 ? primary 'Bernert, C.' 11 ? primary 'Kunz, S.' 12 0000-0002-0131-3506 primary 'Riedel, D.' 13 0000-0003-2970-6894 primary 'Lilie, H.' 14 ? primary 'Jakobs, S.' 15 0000-0002-8028-3121 primary 'van der Laan, M.' 16 0000-0003-0789-9912 primary 'Daumke, O.' 17 0000-0002-6190-1414 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'MICOS complex subunit MIC60' _entity.formula_weight 20023.631 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name Mitofilin # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MNEDIRTNVAESVAVQYGQASKDLHESFEIRAKSREVELTQQFLNEFNAFKAQLEKHSSEELASALKANEQALLAKQSNE VALLSMKQVEEFTKILSEKLDQERQGRLSKLEALNGSVQELAEAVDQVDTLVMKSEVLSQLSLLTTLLKNKLHAGDESSV KIDSELARLKTLCDILPLE ; _entity_poly.pdbx_seq_one_letter_code_can ;MNEDIRTNVAESVAVQYGQASKDLHESFEIRAKSREVELTQQFLNEFNAFKAQLEKHSSEELASALKANEQALLAKQSNE VALLSMKQVEEFTKILSEKLDQERQGRLSKLEALNGSVQELAEAVDQVDTLVMKSEVLSQLSLLTTLLKNKLHAGDESSV KIDSELARLKTLCDILPLE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASN n 1 3 GLU n 1 4 ASP n 1 5 ILE n 1 6 ARG n 1 7 THR n 1 8 ASN n 1 9 VAL n 1 10 ALA n 1 11 GLU n 1 12 SER n 1 13 VAL n 1 14 ALA n 1 15 VAL n 1 16 GLN n 1 17 TYR n 1 18 GLY n 1 19 GLN n 1 20 ALA n 1 21 SER n 1 22 LYS n 1 23 ASP n 1 24 LEU n 1 25 HIS n 1 26 GLU n 1 27 SER n 1 28 PHE n 1 29 GLU n 1 30 ILE n 1 31 ARG n 1 32 ALA n 1 33 LYS n 1 34 SER n 1 35 ARG n 1 36 GLU n 1 37 VAL n 1 38 GLU n 1 39 LEU n 1 40 THR n 1 41 GLN n 1 42 GLN n 1 43 PHE n 1 44 LEU n 1 45 ASN n 1 46 GLU n 1 47 PHE n 1 48 ASN n 1 49 ALA n 1 50 PHE n 1 51 LYS n 1 52 ALA n 1 53 GLN n 1 54 LEU n 1 55 GLU n 1 56 LYS n 1 57 HIS n 1 58 SER n 1 59 SER n 1 60 GLU n 1 61 GLU n 1 62 LEU n 1 63 ALA n 1 64 SER n 1 65 ALA n 1 66 LEU n 1 67 LYS n 1 68 ALA n 1 69 ASN n 1 70 GLU n 1 71 GLN n 1 72 ALA n 1 73 LEU n 1 74 LEU n 1 75 ALA n 1 76 LYS n 1 77 GLN n 1 78 SER n 1 79 ASN n 1 80 GLU n 1 81 VAL n 1 82 ALA n 1 83 LEU n 1 84 LEU n 1 85 SER n 1 86 MET n 1 87 LYS n 1 88 GLN n 1 89 VAL n 1 90 GLU n 1 91 GLU n 1 92 PHE n 1 93 THR n 1 94 LYS n 1 95 ILE n 1 96 LEU n 1 97 SER n 1 98 GLU n 1 99 LYS n 1 100 LEU n 1 101 ASP n 1 102 GLN n 1 103 GLU n 1 104 ARG n 1 105 GLN n 1 106 GLY n 1 107 ARG n 1 108 LEU n 1 109 SER n 1 110 LYS n 1 111 LEU n 1 112 GLU n 1 113 ALA n 1 114 LEU n 1 115 ASN n 1 116 GLY n 1 117 SER n 1 118 VAL n 1 119 GLN n 1 120 GLU n 1 121 LEU n 1 122 ALA n 1 123 GLU n 1 124 ALA n 1 125 VAL n 1 126 ASP n 1 127 GLN n 1 128 VAL n 1 129 ASP n 1 130 THR n 1 131 LEU n 1 132 VAL n 1 133 MET n 1 134 LYS n 1 135 SER n 1 136 GLU n 1 137 VAL n 1 138 LEU n 1 139 SER n 1 140 GLN n 1 141 LEU n 1 142 SER n 1 143 LEU n 1 144 LEU n 1 145 THR n 1 146 THR n 1 147 LEU n 1 148 LEU n 1 149 LYS n 1 150 ASN n 1 151 LYS n 1 152 LEU n 1 153 HIS n 1 154 ALA n 1 155 GLY n 1 156 ASP n 1 157 GLU n 1 158 SER n 1 159 SER n 1 160 VAL n 1 161 LYS n 1 162 ILE n 1 163 ASP n 1 164 SER n 1 165 GLU n 1 166 LEU n 1 167 ALA n 1 168 ARG n 1 169 LEU n 1 170 LYS n 1 171 THR n 1 172 LEU n 1 173 CYS n 1 174 ASP n 1 175 ILE n 1 176 LEU n 1 177 PRO n 1 178 LEU n 1 179 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 179 _entity_src_gen.gene_src_common_name 'Yeast, Kluyveromyces thermotolerans' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'MIC60, KLTH0H09724g' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 56472 / CBS 6340 / NRRL Y-8284' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 559295 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 206 ? ? ? A . n A 1 2 ASN 2 207 ? ? ? A . n A 1 3 GLU 3 208 ? ? ? A . n A 1 4 ASP 4 209 ? ? ? A . n A 1 5 ILE 5 210 ? ? ? A . n A 1 6 ARG 6 211 ? ? ? A . n A 1 7 THR 7 212 ? ? ? A . n A 1 8 ASN 8 213 ? ? ? A . n A 1 9 VAL 9 214 ? ? ? A . n A 1 10 ALA 10 215 ? ? ? A . n A 1 11 GLU 11 216 ? ? ? A . n A 1 12 SER 12 217 ? ? ? A . n A 1 13 VAL 13 218 ? ? ? A . n A 1 14 ALA 14 219 ? ? ? A . n A 1 15 VAL 15 220 ? ? ? A . n A 1 16 GLN 16 221 ? ? ? A . n A 1 17 TYR 17 222 ? ? ? A . n A 1 18 GLY 18 223 ? ? ? A . n A 1 19 GLN 19 224 ? ? ? A . n A 1 20 ALA 20 225 ? ? ? A . n A 1 21 SER 21 226 ? ? ? A . n A 1 22 LYS 22 227 ? ? ? A . n A 1 23 ASP 23 228 ? ? ? A . n A 1 24 LEU 24 229 ? ? ? A . n A 1 25 HIS 25 230 ? ? ? A . n A 1 26 GLU 26 231 ? ? ? A . n A 1 27 SER 27 232 ? ? ? A . n A 1 28 PHE 28 233 ? ? ? A . n A 1 29 GLU 29 234 ? ? ? A . n A 1 30 ILE 30 235 235 ILE ILE A . n A 1 31 ARG 31 236 236 ARG ARG A . n A 1 32 ALA 32 237 237 ALA ALA A . n A 1 33 LYS 33 238 238 LYS LYS A . n A 1 34 SER 34 239 239 SER SER A . n A 1 35 ARG 35 240 240 ARG ARG A . n A 1 36 GLU 36 241 241 GLU GLU A . n A 1 37 VAL 37 242 242 VAL VAL A . n A 1 38 GLU 38 243 243 GLU GLU A . n A 1 39 LEU 39 244 244 LEU LEU A . n A 1 40 THR 40 245 245 THR THR A . n A 1 41 GLN 41 246 246 GLN GLN A . n A 1 42 GLN 42 247 247 GLN GLN A . n A 1 43 PHE 43 248 248 PHE PHE A . n A 1 44 LEU 44 249 249 LEU LEU A . n A 1 45 ASN 45 250 250 ASN ASN A . n A 1 46 GLU 46 251 251 GLU GLU A . n A 1 47 PHE 47 252 252 PHE PHE A . n A 1 48 ASN 48 253 253 ASN ASN A . n A 1 49 ALA 49 254 254 ALA ALA A . n A 1 50 PHE 50 255 255 PHE PHE A . n A 1 51 LYS 51 256 256 LYS LYS A . n A 1 52 ALA 52 257 257 ALA ALA A . n A 1 53 GLN 53 258 258 GLN GLN A . n A 1 54 LEU 54 259 259 LEU LEU A . n A 1 55 GLU 55 260 260 GLU GLU A . n A 1 56 LYS 56 261 261 LYS LYS A . n A 1 57 HIS 57 262 262 HIS HIS A . n A 1 58 SER 58 263 263 SER SER A . n A 1 59 SER 59 264 264 SER SER A . n A 1 60 GLU 60 265 265 GLU GLU A . n A 1 61 GLU 61 266 266 GLU GLU A . n A 1 62 LEU 62 267 267 LEU LEU A . n A 1 63 ALA 63 268 268 ALA ALA A . n A 1 64 SER 64 269 269 SER SER A . n A 1 65 ALA 65 270 270 ALA ALA A . n A 1 66 LEU 66 271 271 LEU LEU A . n A 1 67 LYS 67 272 272 LYS LYS A . n A 1 68 ALA 68 273 273 ALA ALA A . n A 1 69 ASN 69 274 274 ASN ASN A . n A 1 70 GLU 70 275 275 GLU GLU A . n A 1 71 GLN 71 276 276 GLN GLN A . n A 1 72 ALA 72 277 277 ALA ALA A . n A 1 73 LEU 73 278 278 LEU LEU A . n A 1 74 LEU 74 279 279 LEU LEU A . n A 1 75 ALA 75 280 280 ALA ALA A . n A 1 76 LYS 76 281 281 LYS LYS A . n A 1 77 GLN 77 282 282 GLN GLN A . n A 1 78 SER 78 283 283 SER SER A . n A 1 79 ASN 79 284 284 ASN ASN A . n A 1 80 GLU 80 285 285 GLU GLU A . n A 1 81 VAL 81 286 286 VAL VAL A . n A 1 82 ALA 82 287 287 ALA ALA A . n A 1 83 LEU 83 288 288 LEU LEU A . n A 1 84 LEU 84 289 289 LEU LEU A . n A 1 85 SER 85 290 290 SER SER A . n A 1 86 MET 86 291 291 MET MET A . n A 1 87 LYS 87 292 292 LYS LYS A . n A 1 88 GLN 88 293 293 GLN GLN A . n A 1 89 VAL 89 294 294 VAL VAL A . n A 1 90 GLU 90 295 295 GLU GLU A . n A 1 91 GLU 91 296 296 GLU GLU A . n A 1 92 PHE 92 297 297 PHE PHE A . n A 1 93 THR 93 298 298 THR THR A . n A 1 94 LYS 94 299 299 LYS LYS A . n A 1 95 ILE 95 300 300 ILE ILE A . n A 1 96 LEU 96 301 301 LEU LEU A . n A 1 97 SER 97 302 302 SER SER A . n A 1 98 GLU 98 303 303 GLU GLU A . n A 1 99 LYS 99 304 304 LYS LYS A . n A 1 100 LEU 100 305 305 LEU LEU A . n A 1 101 ASP 101 306 306 ASP ASP A . n A 1 102 GLN 102 307 307 GLN GLN A . n A 1 103 GLU 103 308 308 GLU GLU A . n A 1 104 ARG 104 309 309 ARG ARG A . n A 1 105 GLN 105 310 310 GLN GLN A . n A 1 106 GLY 106 311 311 GLY GLY A . n A 1 107 ARG 107 312 312 ARG ARG A . n A 1 108 LEU 108 313 313 LEU LEU A . n A 1 109 SER 109 314 314 SER SER A . n A 1 110 LYS 110 315 315 LYS LYS A . n A 1 111 LEU 111 316 316 LEU LEU A . n A 1 112 GLU 112 317 317 GLU GLU A . n A 1 113 ALA 113 318 318 ALA ALA A . n A 1 114 LEU 114 319 319 LEU LEU A . n A 1 115 ASN 115 320 320 ASN ASN A . n A 1 116 GLY 116 321 321 GLY GLY A . n A 1 117 SER 117 322 322 SER SER A . n A 1 118 VAL 118 323 323 VAL VAL A . n A 1 119 GLN 119 324 324 GLN GLN A . n A 1 120 GLU 120 325 325 GLU GLU A . n A 1 121 LEU 121 326 326 LEU LEU A . n A 1 122 ALA 122 327 327 ALA ALA A . n A 1 123 GLU 123 328 328 GLU GLU A . n A 1 124 ALA 124 329 329 ALA ALA A . n A 1 125 VAL 125 330 330 VAL VAL A . n A 1 126 ASP 126 331 331 ASP ASP A . n A 1 127 GLN 127 332 332 GLN GLN A . n A 1 128 VAL 128 333 333 VAL VAL A . n A 1 129 ASP 129 334 334 ASP ASP A . n A 1 130 THR 130 335 335 THR THR A . n A 1 131 LEU 131 336 336 LEU LEU A . n A 1 132 VAL 132 337 337 VAL VAL A . n A 1 133 MET 133 338 338 MET MET A . n A 1 134 LYS 134 339 339 LYS LYS A . n A 1 135 SER 135 340 340 SER SER A . n A 1 136 GLU 136 341 341 GLU GLU A . n A 1 137 VAL 137 342 342 VAL VAL A . n A 1 138 LEU 138 343 343 LEU LEU A . n A 1 139 SER 139 344 344 SER SER A . n A 1 140 GLN 140 345 345 GLN GLN A . n A 1 141 LEU 141 346 346 LEU LEU A . n A 1 142 SER 142 347 347 SER SER A . n A 1 143 LEU 143 348 348 LEU LEU A . n A 1 144 LEU 144 349 349 LEU LEU A . n A 1 145 THR 145 350 350 THR THR A . n A 1 146 THR 146 351 351 THR THR A . n A 1 147 LEU 147 352 352 LEU LEU A . n A 1 148 LEU 148 353 353 LEU LEU A . n A 1 149 LYS 149 354 354 LYS LYS A . n A 1 150 ASN 150 355 355 ASN ASN A . n A 1 151 LYS 151 356 356 LYS LYS A . n A 1 152 LEU 152 357 357 LEU LEU A . n A 1 153 HIS 153 358 358 HIS HIS A . n A 1 154 ALA 154 359 359 ALA ALA A . n A 1 155 GLY 155 360 ? ? ? A . n A 1 156 ASP 156 361 ? ? ? A . n A 1 157 GLU 157 362 362 GLU GLU A . n A 1 158 SER 158 363 363 SER SER A . n A 1 159 SER 159 364 364 SER SER A . n A 1 160 VAL 160 365 365 VAL VAL A . n A 1 161 LYS 161 366 366 LYS LYS A . n A 1 162 ILE 162 367 367 ILE ILE A . n A 1 163 ASP 163 368 368 ASP ASP A . n A 1 164 SER 164 369 369 SER SER A . n A 1 165 GLU 165 370 370 GLU GLU A . n A 1 166 LEU 166 371 371 LEU LEU A . n A 1 167 ALA 167 372 372 ALA ALA A . n A 1 168 ARG 168 373 373 ARG ARG A . n A 1 169 LEU 169 374 374 LEU LEU A . n A 1 170 LYS 170 375 375 LYS LYS A . n A 1 171 THR 171 376 376 THR THR A . n A 1 172 LEU 172 377 377 LEU LEU A . n A 1 173 CYS 173 378 378 CYS CYS A . n A 1 174 ASP 174 379 379 ASP ASP A . n A 1 175 ILE 175 380 380 ILE ILE A . n A 1 176 LEU 176 381 381 LEU LEU A . n A 1 177 PRO 177 382 382 PRO PRO A . n A 1 178 LEU 178 383 383 LEU LEU A . n A 1 179 GLU 179 384 384 GLU GLU A . n # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ILE 235 ? CG1 ? A ILE 30 CG1 2 1 Y 1 A ILE 235 ? CG2 ? A ILE 30 CG2 3 1 Y 1 A ILE 235 ? CD1 ? A ILE 30 CD1 4 1 Y 1 A ARG 236 ? CG ? A ARG 31 CG 5 1 Y 1 A ARG 236 ? CD ? A ARG 31 CD 6 1 Y 1 A ARG 236 ? NE ? A ARG 31 NE 7 1 Y 1 A ARG 236 ? CZ ? A ARG 31 CZ 8 1 Y 1 A ARG 236 ? NH1 ? A ARG 31 NH1 9 1 Y 1 A ARG 236 ? NH2 ? A ARG 31 NH2 10 1 Y 1 A LYS 292 ? CG ? A LYS 87 CG 11 1 Y 1 A LYS 292 ? CD ? A LYS 87 CD 12 1 Y 1 A LYS 292 ? CE ? A LYS 87 CE 13 1 Y 1 A LYS 292 ? NZ ? A LYS 87 NZ 14 1 Y 1 A LYS 299 ? CG ? A LYS 94 CG 15 1 Y 1 A LYS 299 ? CD ? A LYS 94 CD 16 1 Y 1 A LYS 299 ? CE ? A LYS 94 CE 17 1 Y 1 A LYS 299 ? NZ ? A LYS 94 NZ 18 1 Y 1 A GLU 362 ? CG ? A GLU 157 CG 19 1 Y 1 A GLU 362 ? CD ? A GLU 157 CD 20 1 Y 1 A GLU 362 ? OE1 ? A GLU 157 OE1 21 1 Y 1 A GLU 362 ? OE2 ? A GLU 157 OE2 22 1 Y 1 A ARG 373 ? CG ? A ARG 168 CG 23 1 Y 1 A ARG 373 ? CD ? A ARG 168 CD 24 1 Y 1 A ARG 373 ? NE ? A ARG 168 NE 25 1 Y 1 A ARG 373 ? CZ ? A ARG 168 CZ 26 1 Y 1 A ARG 373 ? NH1 ? A ARG 168 NH1 27 1 Y 1 A ARG 373 ? NH2 ? A ARG 168 NH2 28 1 Y 1 A LYS 375 ? CG ? A LYS 170 CG 29 1 Y 1 A LYS 375 ? CD ? A LYS 170 CD 30 1 Y 1 A LYS 375 ? CE ? A LYS 170 CE 31 1 Y 1 A LYS 375 ? NZ ? A LYS 170 NZ 32 1 Y 1 A GLU 384 ? CG ? A GLU 179 CG 33 1 Y 1 A GLU 384 ? CD ? A GLU 179 CD 34 1 Y 1 A GLU 384 ? OE1 ? A GLU 179 OE1 35 1 Y 1 A GLU 384 ? OE2 ? A GLU 179 OE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.14_3260 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? AMPLE ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7PUZ _cell.details ? _cell.formula_units_Z ? _cell.length_a 54.194 _cell.length_a_esd ? _cell.length_b 54.194 _cell.length_b_esd ? _cell.length_c 134.042 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7PUZ _symmetry.cell_setting ? _symmetry.Int_Tables_number 90 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 4 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7PUZ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.98 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 58.78 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '17.5 % PEG 1500, 0.1 M MMT buffer pH 7.1, 0.1 M D-Sorbitol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-12-13 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9184 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'BESSY BEAMLINE 14.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9184 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 14.1 _diffrn_source.pdbx_synchrotron_site BESSY # _reflns.B_iso_Wilson_estimate 81.653 _reflns.entry_id 7PUZ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.840 _reflns.d_resolution_low 44.681 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 5166 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.700 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 13.499 _reflns.pdbx_Rmerge_I_obs 0.161 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.110 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.916 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.168 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 69737 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.840 3.010 ? 0.990 ? 11230 809 ? 801 99.000 ? ? ? ? 2.542 ? ? ? ? ? ? ? ? 14.020 ? ? ? ? 2.638 ? ? 1 1 0.773 ? ? ? ? ? ? ? ? ? ? 3.010 3.220 ? 1.690 ? 10754 752 ? 752 100.000 ? ? ? ? 1.594 ? ? ? ? ? ? ? ? 14.301 ? ? ? ? 1.654 ? ? 2 1 0.707 ? ? ? ? ? ? ? ? ? ? 3.220 3.480 ? 2.960 ? 9503 704 ? 704 100.000 ? ? ? ? 0.935 ? ? ? ? ? ? ? ? 13.499 ? ? ? ? 0.972 ? ? 3 1 0.850 ? ? ? ? ? ? ? ? ? ? 3.480 3.810 ? 7.840 ? 9075 653 ? 653 100.000 ? ? ? ? 0.357 ? ? ? ? ? ? ? ? 13.897 ? ? ? ? 0.371 ? ? 4 1 0.987 ? ? ? ? ? ? ? ? ? ? 3.810 4.250 ? 15.030 ? 8434 610 ? 609 99.800 ? ? ? ? 0.170 ? ? ? ? ? ? ? ? 13.849 ? ? ? ? 0.176 ? ? 5 1 0.997 ? ? ? ? ? ? ? ? ? ? 4.250 4.900 ? 25.070 ? 7018 542 ? 541 99.800 ? ? ? ? 0.088 ? ? ? ? ? ? ? ? 12.972 ? ? ? ? 0.092 ? ? 6 1 0.999 ? ? ? ? ? ? ? ? ? ? 4.900 5.990 ? 24.410 ? 6435 473 ? 473 100.000 ? ? ? ? 0.081 ? ? ? ? ? ? ? ? 13.605 ? ? ? ? 0.084 ? ? 7 1 1.000 ? ? ? ? ? ? ? ? ? ? 5.990 8.390 ? 29.760 ? 4598 378 ? 378 100.000 ? ? ? ? 0.060 ? ? ? ? ? ? ? ? 12.164 ? ? ? ? 0.063 ? ? 8 1 1.000 ? ? ? ? ? ? ? ? ? ? 8.390 44.681 ? 50.740 ? 2690 259 ? 255 98.500 ? ? ? ? 0.036 ? ? ? ? ? ? ? ? 10.549 ? ? ? ? 0.038 ? ? 9 1 0.999 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 163.540 _refine.B_iso_mean 94.4275 _refine.B_iso_min 52.500 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7PUZ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.8420 _refine.ls_d_res_low 44.6810 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 5156 _refine.ls_number_reflns_R_free 259 _refine.ls_number_reflns_R_work 4897 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.5800 _refine.ls_percent_reflns_R_free 5.0200 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2466 _refine.ls_R_factor_R_free 0.2896 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2442 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.360 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'idealized alpha helices' _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 25.7800 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.5000 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.8420 _refine_hist.d_res_low 44.6810 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1127 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 148 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1127 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.8420 3.5804 . . 124 2358 100.0000 . . . 0.3558 0.0000 0.3362 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.5804 44.6810 . . 135 2539 100.0000 . . . 0.2724 0.0000 0.2191 . . . . . . . . . . . # _struct.entry_id 7PUZ _struct.title 'Crystal structure of the Mic60 coiled coil domain' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7PUZ _struct_keywords.text 'MICOS, coiled coil, mitochondria, STRUCTURAL PROTEIN' _struct_keywords.pdbx_keywords 'STRUCTURAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MIC60_LACTC _struct_ref.pdbx_db_accession C5E325 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;NEDIRTNVAESVAVQYGQASKDLHESFEIRAKSREVELTQQFLNEFNAFKAQLEKHSSEELASALKANEQALLAKQSNEV ALLSMKQVEEFTKILSEKLDQERQGRLSKLEALNGSVQELAEAVDQVDTLVMKSEVLSQLSLLTTLLKNKLHAGDESSVK IDSELARLKTLCDILP ; _struct_ref.pdbx_align_begin 207 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7PUZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 177 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession C5E325 _struct_ref_seq.db_align_beg 207 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 382 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 207 _struct_ref_seq.pdbx_auth_seq_align_end 382 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7PUZ MET A 1 ? UNP C5E325 ? ? 'initiating methionine' 206 1 1 7PUZ LEU A 178 ? UNP C5E325 ? ? 'expression tag' 383 2 1 7PUZ GLU A 179 ? UNP C5E325 ? ? 'expression tag' 384 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 17660 ? 1 MORE -137 ? 1 'SSA (A^2)' 30620 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'light scattering' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_755 -x+2,-y,z -1.0000000000 0.0000000000 0.0000000000 108.3880000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 7_646 y+1,x-1,-z+1 0.0000000000 1.0000000000 0.0000000000 54.1940000000 1.0000000000 0.0000000000 0.0000000000 -54.1940000000 0.0000000000 0.0000000000 -1.0000000000 134.0420000000 4 'crystal symmetry operation' 8_666 -y+1,-x+1,-z+1 0.0000000000 -1.0000000000 0.0000000000 54.1940000000 -1.0000000000 0.0000000000 0.0000000000 54.1940000000 0.0000000000 0.0000000000 -1.0000000000 134.0420000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ILE A 30 ? VAL A 128 ? ILE A 235 VAL A 333 1 ? 99 HELX_P HELX_P2 AA2 LYS A 134 ? LEU A 152 ? LYS A 339 LEU A 357 1 ? 19 HELX_P HELX_P3 AA3 SER A 159 ? ASP A 163 ? SER A 364 ASP A 368 5 ? 5 HELX_P HELX_P4 AA4 SER A 164 ? ILE A 175 ? SER A 369 ILE A 380 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id LEU _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 383 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -64.61 _pdbx_validate_torsion.psi 89.48 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 55.1274 1.9007 63.9775 1.2926 ? -0.0315 ? 0.1564 ? 1.0830 ? 0.1316 ? 0.6277 ? 0.5192 ? 0.8502 ? -3.2037 ? 0.1110 ? -2.5995 ? 8.4198 ? -0.2097 ? -0.2373 ? -0.1734 ? -0.4330 ? -0.0916 ? 0.0794 ? 1.2442 ? 0.7162 ? 0.3825 ? 2 'X-RAY DIFFRACTION' ? refined 39.5522 -6.3520 121.1092 0.5866 ? 0.0024 ? -0.0307 ? 0.6914 ? -0.0457 ? 0.4869 ? 8.2183 ? 2.1932 ? -4.2460 ? 3.5558 ? -4.9629 ? 8.7303 ? 0.0407 ? -0.0062 ? -0.3180 ? 0.6826 ? -1.0116 ? -0.8762 ? -0.4969 ? 0.7749 ? 0.5950 ? 3 'X-RAY DIFFRACTION' ? refined 47.3598 -7.2660 114.1917 0.6819 ? 0.0829 ? 0.0301 ? 0.9896 ? -0.0122 ? 0.7824 ? 8.8376 ? 1.1253 ? -3.4349 ? 6.5720 ? -2.1324 ? 5.5259 ? -0.4119 ? -0.0726 ? 0.0008 ? -0.7948 ? -0.8140 ? -1.7328 ? 0.5042 ? 1.9360 ? 1.0036 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 235 ? ? ? A 332 ? ? ;chain 'A' and (resid 235 through 332 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? A 333 ? ? ? A 357 ? ? ;chain 'A' and (resid 333 through 357 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? A 358 ? ? ? A 384 ? ? ;chain 'A' and (resid 358 through 384 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 206 ? A MET 1 2 1 Y 1 A ASN 207 ? A ASN 2 3 1 Y 1 A GLU 208 ? A GLU 3 4 1 Y 1 A ASP 209 ? A ASP 4 5 1 Y 1 A ILE 210 ? A ILE 5 6 1 Y 1 A ARG 211 ? A ARG 6 7 1 Y 1 A THR 212 ? A THR 7 8 1 Y 1 A ASN 213 ? A ASN 8 9 1 Y 1 A VAL 214 ? A VAL 9 10 1 Y 1 A ALA 215 ? A ALA 10 11 1 Y 1 A GLU 216 ? A GLU 11 12 1 Y 1 A SER 217 ? A SER 12 13 1 Y 1 A VAL 218 ? A VAL 13 14 1 Y 1 A ALA 219 ? A ALA 14 15 1 Y 1 A VAL 220 ? A VAL 15 16 1 Y 1 A GLN 221 ? A GLN 16 17 1 Y 1 A TYR 222 ? A TYR 17 18 1 Y 1 A GLY 223 ? A GLY 18 19 1 Y 1 A GLN 224 ? A GLN 19 20 1 Y 1 A ALA 225 ? A ALA 20 21 1 Y 1 A SER 226 ? A SER 21 22 1 Y 1 A LYS 227 ? A LYS 22 23 1 Y 1 A ASP 228 ? A ASP 23 24 1 Y 1 A LEU 229 ? A LEU 24 25 1 Y 1 A HIS 230 ? A HIS 25 26 1 Y 1 A GLU 231 ? A GLU 26 27 1 Y 1 A SER 232 ? A SER 27 28 1 Y 1 A PHE 233 ? A PHE 28 29 1 Y 1 A GLU 234 ? A GLU 29 30 1 Y 1 A GLY 360 ? A GLY 155 31 1 Y 1 A ASP 361 ? A ASP 156 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TYR N N N N 318 TYR CA C N S 319 TYR C C N N 320 TYR O O N N 321 TYR CB C N N 322 TYR CG C Y N 323 TYR CD1 C Y N 324 TYR CD2 C Y N 325 TYR CE1 C Y N 326 TYR CE2 C Y N 327 TYR CZ C Y N 328 TYR OH O N N 329 TYR OXT O N N 330 TYR H H N N 331 TYR H2 H N N 332 TYR HA H N N 333 TYR HB2 H N N 334 TYR HB3 H N N 335 TYR HD1 H N N 336 TYR HD2 H N N 337 TYR HE1 H N N 338 TYR HE2 H N N 339 TYR HH H N N 340 TYR HXT H N N 341 VAL N N N N 342 VAL CA C N S 343 VAL C C N N 344 VAL O O N N 345 VAL CB C N N 346 VAL CG1 C N N 347 VAL CG2 C N N 348 VAL OXT O N N 349 VAL H H N N 350 VAL H2 H N N 351 VAL HA H N N 352 VAL HB H N N 353 VAL HG11 H N N 354 VAL HG12 H N N 355 VAL HG13 H N N 356 VAL HG21 H N N 357 VAL HG22 H N N 358 VAL HG23 H N N 359 VAL HXT H N N 360 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TYR N CA sing N N 304 TYR N H sing N N 305 TYR N H2 sing N N 306 TYR CA C sing N N 307 TYR CA CB sing N N 308 TYR CA HA sing N N 309 TYR C O doub N N 310 TYR C OXT sing N N 311 TYR CB CG sing N N 312 TYR CB HB2 sing N N 313 TYR CB HB3 sing N N 314 TYR CG CD1 doub Y N 315 TYR CG CD2 sing Y N 316 TYR CD1 CE1 sing Y N 317 TYR CD1 HD1 sing N N 318 TYR CD2 CE2 doub Y N 319 TYR CD2 HD2 sing N N 320 TYR CE1 CZ doub Y N 321 TYR CE1 HE1 sing N N 322 TYR CE2 CZ sing Y N 323 TYR CE2 HE2 sing N N 324 TYR CZ OH sing N N 325 TYR OH HH sing N N 326 TYR OXT HXT sing N N 327 VAL N CA sing N N 328 VAL N H sing N N 329 VAL N H2 sing N N 330 VAL CA C sing N N 331 VAL CA CB sing N N 332 VAL CA HA sing N N 333 VAL C O doub N N 334 VAL C OXT sing N N 335 VAL CB CG1 sing N N 336 VAL CB CG2 sing N N 337 VAL CB HB sing N N 338 VAL CG1 HG11 sing N N 339 VAL CG1 HG12 sing N N 340 VAL CG1 HG13 sing N N 341 VAL CG2 HG21 sing N N 342 VAL CG2 HG22 sing N N 343 VAL CG2 HG23 sing N N 344 VAL OXT HXT sing N N 345 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'European Research Council (ERC)' Germany ERC-2013-CoG-616024 1 'German Research Foundation (DFG)' Germany FOR2848/P06 2 # _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.details 'idealized alpha helices' # _atom_sites.entry_id 7PUZ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.018452 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018452 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007460 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_